F479533

General Info

Members Datasets Scaffolds Average Seq Length
760 395 1520 207

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10096455|Ga0316576_100964552
Length 197
Sequence MVTAMLLIEQVLGNAAEPDWSERLTGARLDVLELDHWEAQKSRLRKHTAGGTELAISLPRGTFLHNGDILLWDAQVSAAPAAVIVRVRLRDVMVVHLDEVAQGSIELALRTCVELGHALGNQHWPALVKGDRVFVPLTVDRKVMASVMQTHGFEGIRWEFLPGADVVPYLAPHESRRLFGGAEGPVHRHPHAHGDAS

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
209 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
210 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
211 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
242 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
256 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
257 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
290 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
291 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
292 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
293 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
304 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
305 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
332 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
337 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
355 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
356 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
357 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
358 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
359 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
360 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
361 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
362 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
363 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
364 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
365 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
366 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
367 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
368 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
369 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
372 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
373 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
374 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
375 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
376 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
379 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
380 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
381 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
382 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
383 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
384 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
385 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
386 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
387 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
388 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
389 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
390 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
391 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
392 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
393 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
394 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
395 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0.53
Rhizoplane 4.47
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10096455 3300031727 Bacteria 2207
2 JGI24032J14994_101058 3300001430 Unclassified 1268
3 JGI24746J21847_1004410 3300001977 Unclassified 2214
4 JGI24747J21853_1002696 3300001978 Unclassified 1473
5 JGI24739J22299_10020515 3300001989 Unclassified 2360
6 JGI24739J22299_10052123 3300001989 Unclassified 1317
7 JGI24737J22298_10008590 3300001990 Bacteria 3415
8 JGI24750J21931_1000755 3300002070 Unclassified 4572
9 JGI24738J21930_10004536 3300002075 Bacteria 3394
10 JGI24749J21850_1002363 3300002076 Unclassified 2653
11 JGI24744J21845_10011217 3300002077 Bacteria 1834
12 JGI24035J26624_1007247 3300002126 Unclassified 1076
13 Ga0065712_10070241 3300005290 Archaea 6187
14 Ga0065715_10052913 3300005293 Bacteria 1062
15 Ga0065715_10143134 3300005293 Archaea 1808
16 Ga0070676_10000488 3300005328 Archaea 18902
17 Ga0070676_10030159 3300005328 Bacteria 3090
18 Ga0070690_100151027 3300005330 Bacteria 1585
19 Ga0070690_100217094 3300005330 Bacteria 1338
20 Ga0070670_100078352 3300005331 Archaea 2839
21 Ga0070670_100122317 3300005331 Bacteria 2245
22 Ga0070677_10001656 3300005333 Archaea 7044
23 Ga0070677_10005516 3300005333 Bacteria 4170
24 Ga0068869_100034424 3300005334 Bacteria 3583
25 Ga0068869_100279780 3300005334 Archaea 1341
26 Ga0068869_100350914 3300005334 Bacteria 1202
27 Ga0070666_10001043 3300005335 Bacteria 16953
28 Ga0070666_10023151 3300005335 Bacteria 4041
29 Ga0070666_10172957 3300005335 Bacteria 1513
30 Ga0070666_10228096 3300005335 Bacteria 1315
31 Ga0070680_100144623 3300005336 Archaea 1994
32 Ga0070680_100427181 3300005336 Bacteria 1130
33 Ga0068868_100005575 3300005338 Bacteria 8851
34 Ga0068868_100186026 3300005338 Bacteria 1726
35 Ga0068868_100251876 3300005338 Bacteria 1486
36 Ga0070660_100129119 3300005339 Archaea 2021
37 Ga0070660_100229795 3300005339 Archaea 1509
38 Ga0070660_100257311 3300005339 Bacteria 1425
39 Ga0070660_100756777 3300005339 Bacteria 816
40 Ga0070689_100138302 3300005340 Bacteria 1957
41 Ga0070689_100231648 3300005340 Bacteria 1519
42 Ga0070689_100307751 3300005340 Bacteria 1320
43 Ga0070687_100374840 3300005343 Bacteria 925
44 Ga0070661_100006772 3300005344 Archaea 7897
45 Ga0070661_100031175 3300005344 Archaea 3854
46 Ga0070661_100137178 3300005344 Bacteria 1841
47 Ga0070692_10020356 3300005345 Archaea 3216
48 Ga0070668_100000894 3300005347 Bacteria 20754
49 Ga0070668_100009105 3300005347 Archaea 7373
50 Ga0070668_100016153 3300005347 Archaea 5586
51 Ga0070668_100023482 3300005347 Bacteria 4664
52 Ga0070668_100079593 3300005347 Bacteria 2566
53 Ga0070668_100211883 3300005347 Bacteria 1594
54 Ga0070668_100398950 3300005347 Bacteria 1174
55 Ga0070669_100000507 3300005353 Bacteria 29367
56 Ga0070669_100006903 3300005353 Archaea 8161
57 Ga0070669_100066333 3300005353 Bacteria 2660
58 Ga0070675_100006111 3300005354 Bacteria 9238
59 Ga0070675_100028761 3300005354 Archaea 4476
60 Ga0070675_100105192 3300005354 Archaea 2381
61 Ga0070675_100188163 3300005354 Bacteria 1788
62 Ga0070675_100582013 3300005354 Bacteria 1014
63 Ga0070671_100002975 3300005355 Bacteria 13183
64 Ga0070671_100014890 3300005355 Bacteria 6284
65 Ga0070671_100079467 3300005355 Bacteria 2742
66 Ga0070671_100094449 3300005355 Bacteria 2506
67 Ga0070674_100000847 3300005356 Archaea 15860
68 Ga0070674_100015894 3300005356 Bacteria 4709
69 Ga0070674_100086013 3300005356 Bacteria 2257
70 Ga0070674_100401670 3300005356 Bacteria 1120
71 Ga0070673_100002386 3300005364 Bacteria 11439
72 Ga0070673_100130559 3300005364 Archaea 2107
73 Ga0070673_100136974 3300005364 Bacteria 2062
74 Ga0070673_100347085 3300005364 Archaea 1316
75 Ga0070673_100358057 3300005364 Bacteria 1296
76 Ga0070673_100542276 3300005364 Bacteria 1056
77 Ga0070688_100037680 3300005365 Archaea 2947
78 Ga0070688_100129450 3300005365 Bacteria 1701
79 Ga0070659_100023199 3300005366 Archaea 4745
80 Ga0070667_100002800 3300005367 Archaea 15053
81 Ga0070667_100002999 3300005367 Bacteria 14505
82 Ga0070667_100047077 3300005367 Bacteria 3628
83 Ga0070667_100296623 3300005367 Bacteria 1455
84 Ga0070667_100369229 3300005367 Bacteria 1301
85 Ga0070667_100489586 3300005367 Bacteria 1126
86 Ga0070667_100514806 3300005367 Bacteria 1098
87 Ga0070714_100672961 3300005435 Bacteria 997
88 Ga0070713_100053014 3300005436 Bacteria 3360
89 Ga0070713_100276951 3300005436 Bacteria 1538
90 Ga0070713_100488323 3300005436 Bacteria 1161
91 Ga0070701_10124406 3300005438 Archaea 1457
92 Ga0070705_100043670 3300005440 Archaea 2570
93 Ga0070705_100323385 3300005440 Bacteria 1114
94 Ga0070705_100714283 3300005440 Bacteria 789
95 Ga0070700_100001137 3300005441 Archaea 13152
96 Ga0070700_100223103 3300005441 Bacteria 1336
97 Ga0070700_100235428 3300005441 Archaea 1305
98 Ga0070694_100323529 3300005444 Bacteria 1187
99 Ga0070708_100075609 3300005445 Bacteria 3040
100 Ga0070663_100000969 3300005455 Archaea 15590
101 Ga0070663_100024659 3300005455 Archaea 4052
102 Ga0070663_100099471 3300005455 Bacteria 2168
103 Ga0070663_100192353 3300005455 Bacteria 1588
104 Ga0070678_100000115 3300005456 Bacteria 31495
105 Ga0070678_100003105 3300005456 Bacteria 9208
106 Ga0070678_100081754 3300005456 Bacteria 2450
107 Ga0070678_100998137 3300005456 Bacteria 769
108 Ga0070662_100036321 3300005457 Bacteria 3484
109 Ga0070681_10038852 3300005458 Archaea 4772
110 Ga0070681_10109006 3300005458 Archaea 2709
111 Ga0068867_100325222 3300005459 Bacteria 1275
112 Ga0068867_100536100 3300005459 Bacteria 1011
113 Ga0070685_10009209 3300005466 Bacteria 5097
114 Ga0070685_10059768 3300005466 Bacteria 2226
115 Ga0070706_100023227 3300005467 Bacteria 5713
116 Ga0070707_100038571 3300005468 Bacteria 4563
117 Ga0070698_100018853 3300005471 Bacteria 7259
118 Ga0070698_100034624 3300005471 Bacteria 5226
119 Ga0070699_100023750 3300005518 Bacteria 5282
120 Ga0070679_100003124 3300005530 Archaea 15146
121 Ga0070679_100191755 3300005530 Archaea 2012
122 Ga0070697_100000584 3300005536 Bacteria 27501
123 Ga0068853_100264494 3300005539 Bacteria 1582
124 Ga0068853_100506815 3300005539 Bacteria 1140
125 Ga0070672_100005089 3300005543 Bacteria 8674
126 Ga0070672_100068820 3300005543 Bacteria 2808
127 Ga0070672_100110248 3300005543 Archaea 2242
128 Ga0070672_100308474 3300005543 Bacteria 1343
129 Ga0070672_100789334 3300005543 Bacteria 835
130 Ga0070686_100084455 3300005544 Bacteria 2110
131 Ga0070686_100229889 3300005544 Bacteria 1345
132 Ga0070695_100027897 3300005545 Bacteria 3500
133 Ga0070695_100153198 3300005545 Bacteria 1611
134 Ga0070695_100608559 3300005545 Bacteria 858
135 Ga0070696_100011679 3300005546 Archaea 5885
136 Ga0070696_100415453 3300005546 Bacteria 1055
137 Ga0070696_100689455 3300005546 Bacteria 832
138 Ga0070693_100031106 3300005547 Archaea 2923
139 Ga0070693_100664057 3300005547 Bacteria 759
140 Ga0070665_100005678 3300005548 Bacteria 12823
141 Ga0070665_100035444 3300005548 Bacteria 5017
142 Ga0070665_100042450 3300005548 Bacteria 4571
143 Ga0070665_100285423 3300005548 Bacteria 1653
144 Ga0070704_100017782 3300005549 Archaea 4531
145 Ga0070704_100081684 3300005549 Archaea 2381
146 Ga0070704_100186749 3300005549 Bacteria 1663
147 Ga0068855_100022529 3300005563 Bacteria 7548
148 Ga0070664_100002231 3300005564 Archaea 15590
149 Ga0070664_100030828 3300005564 Archaea 4476
150 Ga0070664_100162620 3300005564 Bacteria 1976
151 Ga0068857_100165244 3300005577 Bacteria 2010
152 Ga0068854_100058560 3300005578 Archaea 2781
153 Ga0068854_100245536 3300005578 Archaea 1427
154 Ga0068854_100316600 3300005578 Bacteria 1267
155 Ga0068856_100068520 3300005614 Archaea 3507
156 Ga0068856_100102076 3300005614 Bacteria 2861
157 Ga0068856_100449191 3300005614 Bacteria 1310
158 Ga0070702_100014115 3300005615 Archaea 4047
159 Ga0070702_100116942 3300005615 Bacteria 1663
160 Ga0070702_100201997 3300005615 Archaea 1316
161 Ga0068852_100464749 3300005616 Bacteria 1255
162 Ga0068852_100694179 3300005616 Bacteria 1027
163 Ga0068859_100004058 3300005617 Bacteria 14931
164 Ga0068859_100037212 3300005617 Bacteria 4884
165 Ga0068859_100072233 3300005617 Bacteria 3487
166 Ga0068859_100168670 3300005617 Bacteria 2269
167 Ga0068859_100231786 3300005617 Bacteria 1935
168 Ga0068864_100001052 3300005618 Bacteria 23163
169 Ga0068864_100007287 3300005618 Archaea 9095
170 Ga0068864_100016020 3300005618 Bacteria 6236
171 Ga0068866_10229291 3300005718 Bacteria 1125
172 Ga0068861_100004075 3300005719 Archaea 9792
173 Ga0068861_100840869 3300005719 Bacteria 865
174 Ga0068870_10051147 3300005840 Bacteria 2186
175 Ga0068870_10271345 3300005840 Bacteria 1060
176 Ga0068863_100001955 3300005841 Bacteria 20467
177 Ga0068863_100112350 3300005841 Bacteria 2595
178 Ga0068863_100365405 3300005841 Archaea 1407
179 Ga0068858_100000652 3300005842 Bacteria 36211
180 Ga0068858_100012921 3300005842 Archaea 7873
181 Ga0068858_100039443 3300005842 Bacteria 4379
182 Ga0068858_100273585 3300005842 Bacteria 1607
183 Ga0068860_100001238 3300005843 Bacteria 27863
184 Ga0068860_100015005 3300005843 Archaea 7571
185 Ga0068860_100037718 3300005843 Bacteria 4625
186 Ga0068860_100669629 3300005843 Bacteria 1046
187 Ga0068862_100031518 3300005844 Archaea 4476
188 Ga0068862_100034995 3300005844 Archaea 4251
189 Ga0068862_100169567 3300005844 Bacteria 1953
190 Ga0068862_100194096 3300005844 Bacteria 1828
191 Ga0068862_100361368 3300005844 Bacteria 1349
192 Ga0081455_10006813 3300005937 Bacteria 12181
193 Ga0081455_10008401 3300005937 Archaea 10739
194 Ga0081455_10071436 3300005937 Bacteria 2877
195 Ga0081455_10110896 3300005937 Bacteria 2180
196 Ga0081455_10437466 3300005937 Bacteria 897
197 Ga0081540_1005099 3300005983 Bacteria 9851
198 Ga0081540_1065367 3300005983 Bacteria 1711
199 Ga0070717_10067604 3300006028 Bacteria 2973
200 Ga0075365_10146228 3300006038 Bacteria 1642
201 Ga0075365_10162994 3300006038 Bacteria 1554
202 Ga0075368_10004209 3300006042 Bacteria 4852
203 Ga0075364_10015864 3300006051 Bacteria 4676
204 Ga0075362_10141562 3300006177 Bacteria 1149
205 Ga0075367_10201910 3300006178 Bacteria 1242
206 Ga0075367_10488794 3300006178 Bacteria 780
207 Ga0075369_10002216 3300006186 Bacteria 6884
208 Ga0075369_10069284 3300006186 Bacteria 1551
209 Ga0075369_10079763 3300006186 Bacteria 1450
210 Ga0075369_10101072 3300006186 Bacteria 1294
211 Ga0075366_10066401 3300006195 Bacteria 2146
212 Ga0075366_10270790 3300006195 Bacteria 1037
213 Ga0097621_100117011 3300006237 Bacteria 2258
214 Ga0097621_100128412 3300006237 Bacteria 2155
215 Ga0097621_100212461 3300006237 Bacteria 1683
216 Ga0097621_100508910 3300006237 Unclassified 1091
217 Ga0075370_10037229 3300006353 Bacteria 2735
218 Ga0075370_10111238 3300006353 Bacteria 1591
219 Ga0068871_100001467 3300006358 Bacteria 15798
220 Ga0068871_100018490 3300006358 Archaea 5297
221 Ga0068871_100273032 3300006358 Bacteria 1477
222 Ga0075428_100001449 3300006844 Bacteria 25361
223 Ga0075428_100036753 3300006844 Bacteria 5393
224 Ga0075428_100114192 3300006844 Bacteria 2942
225 Ga0075428_100287568 3300006844 Bacteria 1768
226 Ga0075430_100013601 3300006846 Bacteria 6936
227 Ga0075430_100163918 3300006846 Bacteria 1850
228 Ga0075431_100001649 3300006847 Bacteria 20906
229 Ga0075433_10032317 3300006852 Archaea 4482
230 Ga0075433_10061874 3300006852 Bacteria 3279
231 Ga0075434_100021260 3300006871 Bacteria 6308
232 Ga0075434_100365636 3300006871 Archaea 1463
233 Ga0075434_100546007 3300006871 Bacteria 1178
234 Ga0075429_100001932 3300006880 Bacteria 17185
235 Ga0075429_100161245 3300006880 Bacteria 1964
236 Ga0068865_100003023 3300006881 Bacteria 10049
237 Ga0068865_100128322 3300006881 Bacteria 1896
238 Ga0068865_100380215 3300006881 Archaea 1151
239 Ga0075436_100729620 3300006914 Bacteria 735
240 Ga0097620_100004058 3300006931 Bacteria 14931
241 Ga0097620_100037211 3300006931 Bacteria 4884
242 Ga0097620_100072237 3300006931 Bacteria 3487
243 Ga0097620_100168683 3300006931 Bacteria 2269
244 Ga0097620_100231777 3300006931 Bacteria 1935
245 Ga0075435_100102457 3300007076 Bacteria 2373
246 Ga0075435_100201357 3300007076 Bacteria 1687
247 Ga0099795_10029817 3300007788 Bacteria 1867
248 Ga0105250_10092274 3300009092 Archaea 1232
249 Ga0111539_10003434 3300009094 Bacteria 20870
250 Ga0111539_10026817 3300009094 Archaea 7039
251 Ga0111539_10068917 3300009094 Archaea 4177
252 Ga0111539_10101010 3300009094 Bacteria 3386
253 Ga0111539_10164658 3300009094 Bacteria 2593
254 Ga0111539_10224203 3300009094 Bacteria 2189
255 Ga0105245_10451507 3300009098 Bacteria 1294
256 Ga0105245_10957047 3300009098 Bacteria 899
257 Ga0105247_10014020 3300009101 Archaea 4807
258 Ga0105247_10098275 3300009101 Bacteria 1868
259 Ga0105247_10200368 3300009101 Bacteria 1341
260 Ga0105247_10496840 3300009101 Bacteria 888
261 Ga0114129_10004462 3300009147 Bacteria 19737
262 Ga0114129_10416433 3300009147 Bacteria 1768
263 Ga0114129_11423808 3300009147 Bacteria 854
264 Ga0105243_10001434 3300009148 Archaea 21009
265 Ga0105243_10233431 3300009148 Bacteria 1633
266 Ga0105241_10009164 3300009174 Archaea 7284
267 Ga0105241_10011633 3300009174 Bacteria 6455
268 Ga0105242_10064605 3300009176 Bacteria 3018
269 Ga0105248_10017306 3300009177 Bacteria 7943
270 Ga0105248_10109780 3300009177 Archaea 3110
271 Ga0105248_10191298 3300009177 Bacteria 2306
272 Ga0105248_10305245 3300009177 Bacteria 1792
273 Ga0105248_10378777 3300009177 Bacteria 1593
274 Ga0105248_10536069 3300009177 Archaea 1320
275 Ga0105237_10154970 3300009545 Bacteria 2287
276 Ga0105237_10456891 3300009545 Bacteria 1283
277 Ga0105237_10646022 3300009545 Bacteria 1065
278 Ga0105238_10147251 3300009551 Bacteria 2331
279 Ga0105238_10630285 3300009551 Bacteria 1081
280 Ga0105249_10228334 3300009553 Bacteria 1835
281 Ga0105249_10930773 3300009553 Bacteria 937
282 Ga0105239_10046138 3300010375 Archaea 4775
283 Ga0105239_10060655 3300010375 Bacteria 4151
284 Ga0105239_10084926 3300010375 Archaea 3488
285 Ga0105239_10212361 3300010375 Bacteria 2169
286 Ga0105246_10004943 3300011119 Bacteria 8116
287 Ga0105246_10016713 3300011119 Archaea 4651
288 Ga0105246_10078826 3300011119 Archaea 2341
289 Ga0105246_10163619 3300011119 Bacteria 1697
290 Ga0157373_10087335 3300013100 Archaea 2197
291 Ga0157370_10391943 3300013104 Viruses 1279
292 Ga0157374_10005514 3300013296 Bacteria 10634
293 Ga0157374_10078791 3300013296 Bacteria 3121
294 Ga0157374_10119987 3300013296 Archaea 2537
295 Ga0157378_10050263 3300013297 Archaea 3710
296 Ga0157378_10400917 3300013297 Bacteria 1352
297 Ga0157378_10465973 3300013297 Bacteria 1256
298 Ga0157378_10508740 3300013297 Bacteria 1204
299 Ga0163162_10001804 3300013306 Bacteria 20096
300 Ga0163162_10030693 3300013306 Archaea 5326
301 Ga0163162_10053705 3300013306 Archaea 4050
302 Ga0163162_10102742 3300013306 Bacteria 2952
303 Ga0163162_10304472 3300013306 Bacteria 1726
304 Ga0163162_10387687 3300013306 Bacteria 1530
305 Ga0163162_10873171 3300013306 Bacteria 1014
306 Ga0157372_10341925 3300013307 Archaea 1743
307 Ga0157375_10018575 3300013308 Bacteria 6307
308 Ga0157375_10101635 3300013308 Bacteria 2958
309 Ga0157375_10167411 3300013308 Bacteria 2343
310 Ga0157375_10718807 3300013308 Bacteria 1152
311 Ga0157375_10731863 3300013308 Archaea 1141
312 Ga0157375_10735347 3300013308 Bacteria 1139
313 Ga0163163_10037607 3300014325 Archaea 4710
314 Ga0163163_10153267 3300014325 Bacteria 2348
315 Ga0157380_10187765 3300014326 Bacteria 1822
316 Ga0157380_10277446 3300014326 Bacteria 1531
317 Ga0157380_10365328 3300014326 Bacteria 1356
318 Ga0157380_10382489 3300014326 Bacteria 1329
319 Ga0157380_10535685 3300014326 Archaea 1145
320 Ga0157377_10029641 3300014745 Archaea 2957
321 Ga0157379_10000737 3300014968 Bacteria 26450
322 Ga0157379_10021700 3300014968 Archaea 5687
323 Ga0157379_10091259 3300014968 Archaea 2732
324 Ga0157379_10974523 3300014968 Bacteria 807
325 Ga0157376_10024078 3300014969 Archaea 4775
326 Ga0157376_10037504 3300014969 Bacteria 3935
327 Ga0157376_10124054 3300014969 Bacteria 2293
328 Ga0157376_10192656 3300014969 Archaea 1870
329 Ga0157376_10335681 3300014969 Bacteria 1442
330 Ga0163161_10021386 3300017792 Archaea 4547
331 Ga0163161_10031758 3300017792 Bacteria 3765
332 Ga0207666_1000101 3300025271 Archaea 13529
333 Ga0207673_1002259 3300025290 Archaea 2180
334 Ga0207697_10002688 3300025315 Bacteria 9086
335 Ga0207653_10005318 3300025885 Archaea 4022
336 Ga0207682_10004673 3300025893 Archaea 5687
337 Ga0207682_10098465 3300025893 Bacteria 1276
338 Ga0207642_10013225 3300025899 Archaea 3006
339 Ga0207642_10201887 3300025899 Bacteria 1099
340 Ga0207642_10242072 3300025899 Bacteria 1019
341 Ga0207710_10056612 3300025900 Bacteria 1770
342 Ga0207710_10066233 3300025900 Bacteria 1648
343 Ga0207710_10346982 3300025900 Bacteria 756
344 Ga0207688_10003967 3300025901 Archaea 8066
345 Ga0207688_10022121 3300025901 Bacteria 3478
346 Ga0207688_10130416 3300025901 Bacteria 1473
347 Ga0207680_10031554 3300025903 Bacteria 3002
348 Ga0207680_10261028 3300025903 Bacteria 1199
349 Ga0207647_10009033 3300025904 Archaea 7097
350 Ga0207645_10000517 3300025907 Bacteria 32075
351 Ga0207645_10001914 3300025907 Archaea 16809
352 Ga0207645_10171613 3300025907 Bacteria 1422
353 Ga0207643_10013736 3300025908 Archaea 4392
354 Ga0207643_10027830 3300025908 Bacteria 3137
355 Ga0207684_10025619 3300025910 Bacteria 5027
356 Ga0207654_10011911 3300025911 Archaea 4446
357 Ga0207654_10043685 3300025911 Bacteria 2542
358 Ga0207707_10078609 3300025912 Archaea 2881
359 Ga0207695_10104161 3300025913 Bacteria 2827
360 Ga0207671_10070766 3300025914 Archaea 2601
361 Ga0207671_10084605 3300025914 Bacteria 2382
362 Ga0207660_10014308 3300025917 Archaea 5214
363 Ga0207660_10150171 3300025917 Archaea 1789
364 Ga0207662_10219510 3300025918 Bacteria 1237
365 Ga0207662_10257087 3300025918 Bacteria 1148
366 Ga0207662_10372190 3300025918 Bacteria 964
367 Ga0207657_10068732 3300025919 Bacteria 3008
368 Ga0207649_10004140 3300025920 Archaea 7895
369 Ga0207649_10650740 3300025920 Bacteria 814
370 Ga0207652_10422043 3300025921 Archaea 1203
371 Ga0207646_10077568 3300025922 Bacteria 2969
372 Ga0207681_10001487 3300025923 Bacteria 15118
373 Ga0207681_10006451 3300025923 Archaea 7199
374 Ga0207681_10483640 3300025923 Bacteria 1011
375 Ga0207694_10158967 3300025924 Bacteria 1824
376 Ga0207650_10007806 3300025925 Bacteria 7292
377 Ga0207650_10192349 3300025925 Bacteria 1631
378 Ga0207659_10000171 3300025926 Archaea 38884
379 Ga0207659_10000719 3300025926 Bacteria 19676
380 Ga0207687_10017315 3300025927 Bacteria 4742
381 Ga0207687_10047238 3300025927 Archaea 2984
382 Ga0207700_10050091 3300025928 Bacteria 3111
383 Ga0207700_10223039 3300025928 Bacteria 1599
384 Ga0207700_10368985 3300025928 Bacteria 1253
385 Ga0207644_10161247 3300025931 Bacteria 1743
386 Ga0207644_10457091 3300025931 Bacteria 1049
387 Ga0207690_10004930 3300025932 Archaea 7876
388 Ga0207690_10148468 3300025932 Bacteria 1736
389 Ga0207706_10152920 3300025933 Bacteria 2029
390 Ga0207706_10226237 3300025933 Bacteria 1637
391 Ga0207686_10000913 3300025934 Archaea 17699
392 Ga0207686_10094042 3300025934 Bacteria 1986
393 Ga0207709_10011724 3300025935 Archaea 4833
394 Ga0207709_10032417 3300025935 Bacteria 3059
395 Ga0207670_10020802 3300025936 Archaea 4037
396 Ga0207669_10001405 3300025937 Archaea 10236
397 Ga0207669_10496761 3300025937 Bacteria 975
398 Ga0207704_10014535 3300025938 Bacteria 3977
399 Ga0207704_10027121 3300025938 Bacteria 3154
400 Ga0207691_10000464 3300025940 Bacteria 40043
401 Ga0207691_10048267 3300025940 Bacteria 3904
402 Ga0207691_10203860 3300025940 Bacteria 1720
403 Ga0207691_10443306 3300025940 Bacteria 1105
404 Ga0207711_10068066 3300025941 Bacteria 3083
405 Ga0207711_10388659 3300025941 Archaea 1295
406 Ga0207711_10650688 3300025941 Bacteria 983
407 Ga0207711_10677396 3300025941 Bacteria 962
408 Ga0207689_10002416 3300025942 Archaea 17380
409 Ga0207689_10024973 3300025942 Bacteria 5009
410 Ga0207689_10107124 3300025942 Bacteria 2297
411 Ga0207661_10020625 3300025944 Archaea 4929
412 Ga0207679_10001182 3300025945 Archaea 16618
413 Ga0207679_10001545 3300025945 Archaea 14398
414 Ga0207667_10130329 3300025949 Archaea 2590
415 Ga0207651_10005029 3300025960 Archaea 6739
416 Ga0207651_10311626 3300025960 Bacteria 1312
417 Ga0207712_10005210 3300025961 Archaea 8227
418 Ga0207712_10295388 3300025961 Bacteria 1328
419 Ga0207712_10768923 3300025961 Bacteria 845
420 Ga0207668_10005270 3300025972 Archaea 7611
421 Ga0207668_10008223 3300025972 Archaea 6215
422 Ga0207668_10017702 3300025972 Bacteria 4470
423 Ga0207668_10024803 3300025972 Bacteria 3874
424 Ga0207668_10172066 3300025972 Bacteria 1699
425 Ga0207658_10024005 3300025986 Archaea 4261
426 Ga0207658_10076093 3300025986 Bacteria 2556
427 Ga0207658_10181557 3300025986 Bacteria 1742
428 Ga0207677_10006947 3300026023 Bacteria 6224
429 Ga0207677_10076108 3300026023 Bacteria 2388
430 Ga0207677_10130796 3300026023 Bacteria 1905
431 Ga0207677_10853124 3300026023 Bacteria 818
432 Ga0207703_10014308 3300026035 Archaea 6189
433 Ga0207639_10178471 3300026041 Bacteria 1805
434 Ga0207678_10070111 3300026067 Bacteria 3005
435 Ga0207678_10120932 3300026067 Bacteria 2234
436 Ga0207708_10109168 3300026075 Bacteria 2146
437 Ga0207641_10004152 3300026088 Bacteria 12623
438 Ga0207641_10230074 3300026088 Archaea 1722
439 Ga0207641_10375101 3300026088 Bacteria 1361
440 Ga0207641_10924606 3300026088 Bacteria 867
441 Ga0207648_10000048 3300026089 Bacteria 109946
442 Ga0207648_10025128 3300026089 Bacteria 5311
443 Ga0207648_10365824 3300026089 Bacteria 1302
444 Ga0207648_10383846 3300026089 Bacteria 1270
445 Ga0207676_10020724 3300026095 Archaea 4813
446 Ga0207676_10112423 3300026095 Bacteria 2281
447 Ga0207674_10009330 3300026116 Archaea 11232
448 Ga0207674_10157464 3300026116 Bacteria 2226
449 Ga0207674_10481104 3300026116 Bacteria 1200
450 Ga0207675_100029842 3300026118 Bacteria 5078
451 Ga0207675_100105819 3300026118 Bacteria 2652
452 Ga0207675_100592022 3300026118 Bacteria 1111
453 Ga0207675_100599208 3300026118 Archaea 1105
454 Ga0207675_100600298 3300026118 Unclassified 1104
455 Ga0207683_10000303 3300026121 Bacteria 44549
456 Ga0207683_10000504 3300026121 Bacteria 36089
457 Ga0207683_10070378 3300026121 Bacteria 3091
458 Ga0207683_10394440 3300026121 Bacteria 1273
459 Ga0207698_10264609 3300026142 Bacteria 1581
460 Ga0207698_10591947 3300026142 Bacteria 1092
461 Ga0209973_1001236 3300027252 Archaea 2186
462 Ga0209968_1007211 3300027526 Unclassified 1682
463 Ga0210002_1000829 3300027617 Bacteria 4217
464 Ga0209971_1002674 3300027682 Archaea 4264
465 Ga0209966_1003425 3300027695 Archaea 2669
466 Ga0209813_10093307 3300027866 Bacteria 1014
467 Ga0209974_10001901 3300027876 Bacteria 7626
468 Ga0209974_10033688 3300027876 Archaea 1700
469 Ga0207428_10002387 3300027907 Archaea 18760
470 Ga0207428_10034111 3300027907 Bacteria 4173
471 Ga0207428_10205536 3300027907 Bacteria 1481
472 Ga0207428_10237067 3300027907 Bacteria 1364
473 Ga0268266_10023672 3300028379 Bacteria 5227
474 Ga0268266_10026298 3300028379 Bacteria 4951
475 Ga0268266_10329526 3300028379 Bacteria 1431
476 Ga0268266_10410626 3300028379 Bacteria 1282
477 Ga0268265_10004532 3300028380 Archaea 9613
478 Ga0268265_10234004 3300028380 Bacteria 1616
479 Ga0268264_10002663 3300028381 Bacteria 15595
480 Ga0268264_10008429 3300028381 Archaea 8570
481 Ga0268264_10300415 3300028381 Bacteria 1511
482 Ga0265334_10007256 3300028573 Bacteria 4755
483 Ga0265338_10156997 3300028800 Bacteria 1761
484 Ga0307513_10034450 3300031456 Bacteria 5683
485 Ga0307513_10218932 3300031456 Bacteria 1727
486 Ga0307513_10334889 3300031456 Bacteria 1266
487 Ga0307509_10356645 3300031507 Bacteria 1183
488 Ga0307508_10152655 3300031616 Bacteria 1913
489 Ga0316578_10170125 3300031728 Bacteria 1313
490 Ga0307409_100184446 3300031995 Bacteria 1851
491 Ga0307415_100017805 3300032126 Bacteria 4270
492 Ga0307507_10039493 3300033179 Bacteria 4762
493 Ga0373958_0006231 3300034819 Bacteria 1850
494 Ga0373938_0003150 3300034957 Bacteria 2679
495 Ga0373926_0008547 3300035083 Archaea 3410
496 Ga0373940_0077956 3300035088 Bacteria 975
497 Ga0373952_0005418 3300035092 Archaea 2333
498 Ga0373952_0070175 3300035092 Bacteria 874
499 Ga0373923_0159213 3300035111 Bacteria 1029
500 Ga0373932_0024111 3300035112 Archaea 1634
501 Ga0373936_0076888 3300035113 Archaea 1384
502 Ga0373939_0006425 3300035114 Archaea 2831
503 Ga0373941_0013860 3300035115 Bacteria 2141
504 Ga0373945_0291993 3300035116 Bacteria 697
505 Ga0373960_0099042 3300035121 Bacteria 942
506 Ga0373943_0039615 3300035170 Archaea 2271
507 Ga0373946_0003451 3300035171 Archaea 5608
508 Ga0373961_0062676 3300035241 Archaea 1132
509 Ga0373962_0002098 3300035242 Archaea 4759
510 Ga0373931_0006144 3300035691 Archaea 5597
511 Ga0373931_0012162 3300035691 Bacteria 4166
512 Ga0373935_0024430 3300035692 Archaea 3719
513 Ga0373927_0009318 3300035695 Bacteria 6587
514 Ga0373927_0206995 3300035695 Bacteria 1288
515 Ga0373927_0249502 3300035695 Bacteria 1167
516 Ga0373933_0094683 3300035724 Bacteria 1847
517 Ga0373933_0450651 3300035724 Bacteria 842
518 Ga0373947_0095178 3300035725 Bacteria 1863
519 Ga0373937_0049968 3300036401 Bacteria 3830
520 Ga0316584_0007935 3300036712 Bacteria 7282
521 Ga0373925_0266604 3300037068 Bacteria 1377
522 Ga0373925_0718609 3300037068 Bacteria 823
523 Ga0436364_0215433 3300037853 Bacteria 5213
524 Ga0436365_0851003 3300039437 Bacteria 2734
525 Ga0439465_0130179 3300041413 Bacteria 888
526 Ga0451802_1902684 3300041460 Bacteria 1164
527 Ga0439448_0096518 3300042005 Bacteria 1002
528 Ga0439455_0004210 3300042012 Archaea 2833
529 Ga0439463_004382 3300042016 Archaea 3539
530 Ga0439458_0066030 3300042157 Bacteria 909
531 Ga0439464_0032028 3300042439 Bacteria 1477
532 Ga0439464_0048678 3300042439 Bacteria 1221
533 Ga0439460_0017691 3300042461 Archaea 1912
534 Ga0451577_0023820 3300042876 Bacteria 5576
535 Ga0451577_0218534 3300042876 Bacteria 1722
536 Ga0453684_0081096 3300044712 Bacteria 4048
537 Ga0453684_0508603 3300044712 Bacteria 1332
538 Ga0451576_0273258 3300045051 Bacteria 1767
539 Ga0495617_013746 3300046452 Bacteria 2753
540 Ga0495592_0051693 3300046454 Archaea 3052
541 Ga0495603_0025211 3300046455 Archaea 3596
542 Ga0495629_0022749 3300046459 Archaea 4468
543 Ga0495651_0135284 3300046462 Bacteria 1794
544 Ga0495653_0093205 3300046463 Bacteria 2197
545 Ga0495580_0041240 3300046472 Archaea 3292
546 Ga0495580_0318147 3300046472 Bacteria 1058
547 Ga0495582_0284242 3300046473 Bacteria 950
548 Ga0495639_0034157 3300046475 Archaea 2274
549 Ga0495662_0017442 3300046476 Archaea 3474
550 Ga0495664_0002978 3300046477 Archaea 9150
551 Ga0495584_0108689 3300046491 Bacteria 1403
552 Ga0495585_0076555 3300046492 Bacteria 1817
553 Ga0495585_0116632 3300046492 Bacteria 1416
554 Ga0495594_0037632 3300046499 Bacteria 2640
555 Ga0495594_0105994 3300046499 Bacteria 1583
556 Ga0495616_0260988 3300046513 Bacteria 741
557 Ga0495618_0026228 3300046514 Archaea 3621
558 Ga0495628_0113876 3300046516 Archaea 2079
559 Ga0495628_0291381 3300046516 Bacteria 1210
560 Ga0495630_0013994 3300046517 Archaea 5838
561 Ga0495632_0047087 3300046519 Bacteria 2140
562 Ga0495643_0124857 3300046522 Bacteria 1297
563 Ga0495648_0089533 3300046524 Bacteria 1727
564 Ga0495648_0112762 3300046524 Bacteria 1476
565 Ga0495663_0008698 3300046525 Bacteria 2816
566 Ga0495666_0048834 3300046526 Archaea 2037
567 Ga0495666_0083705 3300046526 Bacteria 1508
568 Ga0495652_0023805 3300046529 Archaea 5426
569 Ga0495665_0015133 3300046531 Archaea 4157
570 Ga0495587_0066280 3300046536 Archaea 2107
571 Ga0495598_0021348 3300046537 Bacteria 1721
572 Ga0495621_0030286 3300046539 Bacteria 1849
573 Ga0495645_0041121 3300046543 Archaea 3371
574 Ga0495645_0393852 3300046543 Unclassified 884
575 Ga0495622_0092720 3300046557 Bacteria 1387
576 Ga0495656_0078089 3300046615 Bacteria 1487
577 Ga0495656_0125161 3300046615 Bacteria 1218
578 Ga0495668_0101132 3300046616 Bacteria 1577
579 Ga0495668_0202042 3300046616 Bacteria 1088
580 Ga0495634_0265565 3300046642 Bacteria 1046
581 Ga0495611_0126058 3300046648 Bacteria 1194
582 Ga0495625_0162660 3300046660 Bacteria 1494
583 Ga0495635_0188549 3300046663 Bacteria 1400
584 Ga0495588_0101347 3300046674 Archaea 1513
585 Ga0495657_0069441 3300046675 Archaea 2306
586 Ga0495623_0037848 3300046679 Bacteria 3086
587 Ga0495646_0077646 3300046680 Bacteria 1942
588 Ga0495658_0023831 3300046683 Archaea 3253
589 Ga0495658_0287558 3300046683 Bacteria 1038
590 Ga0495669_0073387 3300046684 Bacteria 1562
591 Ga0495670_0127274 3300046691 Bacteria 1326
592 Ga0495671_0184717 3300046692 Bacteria 1012
593 Ga0495649_0091613 3300046694 Bacteria 1620
594 Ga0495649_0204756 3300046694 Bacteria 1024
595 Ga0495600_0051858 3300046809 Bacteria 2678
596 Ga0495581_0053369 3300047315 Archaea 2335
597 Ga0495674_0081337 3300047319 Archaea 2778
598 Ga0495676_0074783 3300047321 Bacteria 2593
599 Ga0495676_0148083 3300047321 Bacteria 1674
600 Ga0495680_0064248 3300047322 Bacteria 2815
601 Ga0495683_0074249 3300047323 Bacteria 1667
602 Ga0495677_0025251 3300047445 Bacteria 2156
603 Ga0495602_0005122 3300048088 Bacteria 13732
604 Ga0495602_0170290 3300048088 Archaea 1691
605 Ga0495626_0114772 3300048091 Bacteria 1163
606 Ga0496100_0070201 3300048903 Archaea 2335
607 Ga0496101_0085349 3300048904 Archaea 2339
608 Ga0496101_0203685 3300048904 Archaea 1530
609 Ga0496102_0006299 3300048905 Archaea 10114
610 Ga0496102_0021460 3300048905 Archaea 5710
611 Ga0496102_0088374 3300048905 Bacteria 2865
612 Ga0496102_0397584 3300048905 Bacteria 1296
613 Ga0496102_0448147 3300048905 Bacteria 1211
614 Ga0496102_0669809 3300048905 Bacteria 961
615 Ga0496102_0793913 3300048905 Bacteria 869
616 Ga0496103_0388367 3300048906 Bacteria 897
617 Ga0496104_0019812 3300048907 Archaea 6160
618 Ga0496105_0262050 3300048908 Bacteria 1398
619 Ga0496106_0017342 3300048909 Archaea 5329
620 Ga0496106_0058920 3300048909 Bacteria 2908
621 Ga0496106_0144473 3300048909 Archaea 1873
622 Ga0496106_0196502 3300048909 Bacteria 1605
623 Ga0496107_0005487 3300048910 Archaea 8681
624 Ga0496107_0075599 3300048910 Archaea 2452
625 Ga0496108_0012653 3300048911 Archaea 6876
626 Ga0496108_0049030 3300048911 Bacteria 3532
627 Ga0496108_0162433 3300048911 Archaea 1931
628 Ga0496109_0001436 3300048912 Archaea 19764
629 Ga0496109_0231389 3300048912 Archaea 1739
630 Ga0496110_0077235 3300048913 Bacteria 2962
631 Ga0496111_0021668 3300048914 Bacteria 4491
632 Ga0496112_0010554 3300048915 Archaea 8388
633 Ga0496112_0075133 3300048915 Bacteria 3342
634 Ga0496113_0223065 3300048916 Bacteria 1502
635 Ga0496114_0233289 3300048917 Bacteria 1617
636 Ga0496114_0282838 3300048917 Bacteria 1463
637 Ga0496114_0427262 3300048917 Bacteria 1174
638 Ga0496116_0005852 3300048919 Bacteria 11296
639 Ga0496117_0023599 3300048920 Bacteria 4895
640 Ga0496118_0014340 3300048921 Bacteria 7428
641 Ga0496119_0148096 3300048922 Bacteria 1261
642 Ga0496121_0016471 3300048924 Bacteria 7631
643 Ga0496121_0094615 3300048924 Bacteria 2324
644 Ga0496121_0180043 3300048924 Bacteria 1526
645 Ga0496121_0443213 3300048924 Bacteria 839
646 Ga0496122_0044632 3300048925 Bacteria 3456
647 Ga0496124_0240630 3300048927 Bacteria 1346
648 Ga0496125_0014796 3300048928 Bacteria 7578
649 Ga0496125_0148867 3300048928 Bacteria 1612
650 Ga0496125_0341841 3300048928 Bacteria 898
651 Ga0496126_0016840 3300048929 Bacteria 7296
652 Ga0496126_0024234 3300048929 Bacteria 5861
653 Ga0496126_0145400 3300048929 Bacteria 2037
654 Ga0496126_0273149 3300048929 Bacteria 1402
655 Ga0496126_0409327 3300048929 Bacteria 1098
656 Ga0496126_0591454 3300048929 Bacteria 875
657 Ga0501033_0362666 3300049570 Bacteria 1014
658 Ga0501034_0241890 3300049571 Bacteria 1751
659 Ga0501038_0392249 3300049574 Unclassified 1075
660 Ga0501039_0373021 3300049575 Bacteria 1121
661 Ga0501041_0422059 3300049577 Bacteria 846
662 Ga0501042_0241666 3300049578 Bacteria 1303
663 Ga0501042_0413470 3300049578 Bacteria 977
664 Ga0501047_0134946 3300049581 Bacteria 2348
665 Ga0501068_0131861 3300049584 Bacteria 1563
666 Ga0501071_0094964 3300049587 Bacteria 2194
667 Ga0501071_0148155 3300049587 Bacteria 1749
668 Ga0501071_0256282 3300049587 Bacteria 1321
669 Ga0501071_0747589 3300049587 Bacteria 753
670 Ga0501072_0053280 3300049588 Unclassified 3186
671 Ga0501074_0026535 3300049590 Bacteria 4200
672 Ga0501075_0004864 3300049591 Bacteria 9150
673 Ga0501076_0006139 3300049592 Bacteria 8696
674 Ga0501076_0181933 3300049592 Bacteria 1714
675 Ga0501076_0403974 3300049592 Bacteria 1123
676 Ga0501077_0079770 3300049593 Bacteria 2074
677 Ga0501077_0174863 3300049593 Bacteria 1364
678 Ga0501081_0014098 3300049743 Bacteria 5267
679 Ga0501044_0053163 3300049823 Bacteria 4168
680 Ga0501045_0000352 3300049824 Bacteria 27284
681 nmdc:mga00v17_401491_c1 3300050491 Bacteria 891
682 nmdc:mga00v17_5666_c1 3300050491 Bacteria 6592
683 nmdc:mga0yw44_5859_c1 3300050492 Bacteria 5868
684 nmdc:mga0k408_207542_c1 3300050493 Bacteria 1170
685 nmdc:mga06z11_198794_c1 3300050494 Bacteria 1163
686 nmdc:mga06z11_28913_c1 3300050494 Bacteria 2665
687 nmdc:mga06z11_46274_c1 3300050494 Bacteria 2204
688 nmdc:mga04h51_30598_c1 3300050495 Bacteria 1695
689 nmdc:mga07m45_219846_c1 3300050496 Bacteria 1105
690 nmdc:mga07m45_36267_c1 3300050496 Bacteria 2746
691 nmdc:mga05p37_1011_c1 3300050507 Bacteria 32036
692 nmdc:mga09592_341147_c1 3300050508 Bacteria 1297
693 nmdc:mga0qj67_10025_c1 3300050509 Bacteria 7067
694 nmdc:mga0qj67_165003_c1 3300050509 Bacteria 1798
695 nmdc:mga06r32_163529_c1 3300050510 Bacteria 2208
696 nmdc:mga06r32_408_c1 3300050510 Bacteria 36183
697 nmdc:mga08y16_122980_c1 3300050511 Bacteria 2700
698 nmdc:mga08y16_156863_c1 3300050511 Bacteria 2365
699 nmdc:mga08y16_1987_c1 3300050511 Bacteria 20871
700 nmdc:mga08y16_781_c1 3300050511 Archaea 30392
701 nmdc:mga0n895_166674_c1 3300050512 Archaea 2235
702 nmdc:mga0n895_250258_c1 3300050512 Bacteria 1798
703 nmdc:mga0n895_295815_c1 3300050512 Bacteria 1641
704 nmdc:mga0n895_93324_c1 3300050512 Bacteria 3013
705 nmdc:mga0rr50_256943_c1 3300050513 Bacteria 1452
706 nmdc:mga08x19_213961_c1 3300050514 Bacteria 1323
707 nmdc:mga0a205_17275_c1 3300050515 Archaea 6759
708 nmdc:mga0a205_72149_c1 3300050515 Bacteria 3335
709 nmdc:mga0sz30_100506_c1 3300050516 Bacteria 1263
710 nmdc:mga0sz30_1038_c1 3300050516 Bacteria 9986
711 nmdc:mga0sz30_52989_c1 3300050516 Bacteria 1723
712 Ga0495601_0001238 3300053077 Archaea 13999
713 Ga0495601_0204991 3300053077 Archaea 1288
714 Ga0495612_0000681 3300053078 Archaea 13693
715 Ga0495595_0002694 3300053084 Bacteria 6969
716 Ga0495619_0000429 3300053085 Archaea 28523
717 Ga0495619_0004651 3300053085 Bacteria 8743
718 Ga0500644_0007346 3300053088 Bacteria 2867
719 Ga0500644_0055279 3300053088 Bacteria 1377
720 Ga0500646_0040651 3300053090 Bacteria 1308
721 Ga0500647_0055808 3300053091 Bacteria 1900
722 Ga0500566_0127876 3300053094 Bacteria 1363
723 Ga0500641_0084842 3300053096 Bacteria 1348
724 Ga0500556_0002198 3300053104 Bacteria 6544
725 Ga0500562_039975 3300053108 Bacteria 1246
726 Ga0500595_004192 3300053119 Bacteria 6523
727 Ga0500595_030339 3300053119 Bacteria 1823
728 Ga0500655_013727 3300053133 Bacteria 1480
729 Ga0500568_0103846 3300053139 Bacteria 1065
730 Ga0500603_011245 3300053150 Bacteria 2034
731 Ga0500604_0056681 3300053151 Bacteria 1222
732 Ga0500622_0005527 3300053156 Bacteria 7563
733 Ga0500633_0060550 3300053160 Bacteria 1331
734 Ga0500633_0221243 3300053160 Bacteria 707
735 Ga0500638_056006 3300053162 Bacteria 1900
736 Ga0500599_002626 3300053736 Bacteria 2166
737 Ga0501084_0005041 3300054114 Bacteria 10805
738 Ga0501084_0061850 3300054114 Archaea 3135
739 Ga0501082_0050781 3300060353 Bacteria 3576
740 Ga0501082_0105164 3300060353 Bacteria 2442
741 Ga0501082_0277148 3300060353 Bacteria 1460
742 Ga0501082_0557503 3300060353 Bacteria 1002
743 Ga0530510_0001421 3300061734 Bacteria 16031
744 Ga0530510_0556596 3300061734 Bacteria 871
745 2509074382 2508501114 Bacteria 7082538
746 2513641176 2513237094 Bacteria 8789602
747 2513703568 2513237102 Bacteria 7703324
748 2603860681 2602042107 Bacteria 6226103
749 2824618774 2824617872 Bacteria 8814715
750 2824628880 2824626560 Bacteria 8813858
751 2824638391 2824635225 Bacteria 8785348
752 2824647591 2824644064 Bacteria 8743947
753 2824717693 2824714736 Bacteria 8717648
754 2824725982 2824723954 Bacteria 8758240
755 2824761546 2824753945 Bacteria 9787441
756 2824766919 2824763712 Bacteria 9792355
757 2904712447 2904711408 Bacteria 9771557
758 2920113962 2920107658 Bacteria 10042636
759 8006985310 8006984368 Bacteria 9651211
760 8019656880 8019648815 Bacteria 10014479
761 Ga0316576_10096455
762 JGI24032J14994_101058
763 JGI24746J21847_1004410
764 JGI24747J21853_1002696
765 JGI24739J22299_10020515
766 JGI24739J22299_10052123
767 JGI24737J22298_10008590
768 JGI24750J21931_1000755
769 JGI24738J21930_10004536
770 JGI24749J21850_1002363
771 JGI24744J21845_10011217
772 JGI24035J26624_1007247
773 Ga0065712_10070241
774 Ga0065715_10052913
775 Ga0065715_10143134
776 Ga0070676_10000488
777 Ga0070676_10030159
778 Ga0070690_100151027
779 Ga0070690_100217094
780 Ga0070670_100078352
781 Ga0070670_100122317
782 Ga0070677_10001656
783 Ga0070677_10005516
784 Ga0068869_100034424
785 Ga0068869_100279780
786 Ga0068869_100350914
787 Ga0070666_10001043
788 Ga0070666_10023151
789 Ga0070666_10172957
790 Ga0070666_10228096
791 Ga0070680_100144623
792 Ga0070680_100427181
793 Ga0068868_100005575
794 Ga0068868_100186026
795 Ga0068868_100251876
796 Ga0070660_100129119
797 Ga0070660_100229795
798 Ga0070660_100257311
799 Ga0070660_100756777
800 Ga0070689_100138302
801 Ga0070689_100231648
802 Ga0070689_100307751
803 Ga0070687_100374840
804 Ga0070661_100006772
805 Ga0070661_100031175
806 Ga0070661_100137178
807 Ga0070692_10020356
808 Ga0070668_100000894
809 Ga0070668_100009105
810 Ga0070668_100016153
811 Ga0070668_100023482
812 Ga0070668_100079593
813 Ga0070668_100211883
814 Ga0070668_100398950
815 Ga0070669_100000507
816 Ga0070669_100006903
817 Ga0070669_100066333
818 Ga0070675_100006111
819 Ga0070675_100028761
820 Ga0070675_100105192
821 Ga0070675_100188163
822 Ga0070675_100582013
823 Ga0070671_100002975
824 Ga0070671_100014890
825 Ga0070671_100079467
826 Ga0070671_100094449
827 Ga0070674_100000847
828 Ga0070674_100015894
829 Ga0070674_100086013
830 Ga0070674_100401670
831 Ga0070673_100002386
832 Ga0070673_100130559
833 Ga0070673_100136974
834 Ga0070673_100347085
835 Ga0070673_100358057
836 Ga0070673_100542276
837 Ga0070688_100037680
838 Ga0070688_100129450
839 Ga0070659_100023199
840 Ga0070667_100002800
841 Ga0070667_100002999
842 Ga0070667_100047077
843 Ga0070667_100296623
844 Ga0070667_100369229
845 Ga0070667_100489586
846 Ga0070667_100514806
847 Ga0070714_100672961
848 Ga0070713_100053014
849 Ga0070713_100276951
850 Ga0070713_100488323
851 Ga0070701_10124406
852 Ga0070705_100043670
853 Ga0070705_100323385
854 Ga0070705_100714283
855 Ga0070700_100001137
856 Ga0070700_100223103
857 Ga0070700_100235428
858 Ga0070694_100323529
859 Ga0070708_100075609
860 Ga0070663_100000969
861 Ga0070663_100024659
862 Ga0070663_100099471
863 Ga0070663_100192353
864 Ga0070678_100000115
865 Ga0070678_100003105
866 Ga0070678_100081754
867 Ga0070678_100998137
868 Ga0070662_100036321
869 Ga0070681_10038852
870 Ga0070681_10109006
871 Ga0068867_100325222
872 Ga0068867_100536100
873 Ga0070685_10009209
874 Ga0070685_10059768
875 Ga0070706_100023227
876 Ga0070707_100038571
877 Ga0070698_100018853
878 Ga0070698_100034624
879 Ga0070699_100023750
880 Ga0070679_100003124
881 Ga0070679_100191755
882 Ga0070697_100000584
883 Ga0068853_100264494
884 Ga0068853_100506815
885 Ga0070672_100005089
886 Ga0070672_100068820
887 Ga0070672_100110248
888 Ga0070672_100308474
889 Ga0070672_100789334
890 Ga0070686_100084455
891 Ga0070686_100229889
892 Ga0070695_100027897
893 Ga0070695_100153198
894 Ga0070695_100608559
895 Ga0070696_100011679
896 Ga0070696_100415453
897 Ga0070696_100689455
898 Ga0070693_100031106
899 Ga0070693_100664057
900 Ga0070665_100005678
901 Ga0070665_100035444
902 Ga0070665_100042450
903 Ga0070665_100285423
904 Ga0070704_100017782
905 Ga0070704_100081684
906 Ga0070704_100186749
907 Ga0068855_100022529
908 Ga0070664_100002231
909 Ga0070664_100030828
910 Ga0070664_100162620
911 Ga0068857_100165244
912 Ga0068854_100058560
913 Ga0068854_100245536
914 Ga0068854_100316600
915 Ga0068856_100068520
916 Ga0068856_100102076
917 Ga0068856_100449191
918 Ga0070702_100014115
919 Ga0070702_100116942
920 Ga0070702_100201997
921 Ga0068852_100464749
922 Ga0068852_100694179
923 Ga0068859_100004058
924 Ga0068859_100037212
925 Ga0068859_100072233
926 Ga0068859_100168670
927 Ga0068859_100231786
928 Ga0068864_100001052
929 Ga0068864_100007287
930 Ga0068864_100016020
931 Ga0068866_10229291
932 Ga0068861_100004075
933 Ga0068861_100840869
934 Ga0068870_10051147
935 Ga0068870_10271345
936 Ga0068863_100001955
937 Ga0068863_100112350
938 Ga0068863_100365405
939 Ga0068858_100000652
940 Ga0068858_100012921
941 Ga0068858_100039443
942 Ga0068858_100273585
943 Ga0068860_100001238
944 Ga0068860_100015005
945 Ga0068860_100037718
946 Ga0068860_100669629
947 Ga0068862_100031518
948 Ga0068862_100034995
949 Ga0068862_100169567
950 Ga0068862_100194096
951 Ga0068862_100361368
952 Ga0081455_10006813
953 Ga0081455_10008401
954 Ga0081455_10071436
955 Ga0081455_10110896
956 Ga0081455_10437466
957 Ga0081540_1005099
958 Ga0081540_1065367
959 Ga0070717_10067604
960 Ga0075365_10146228
961 Ga0075365_10162994
962 Ga0075368_10004209
963 Ga0075364_10015864
964 Ga0075362_10141562
965 Ga0075367_10201910
966 Ga0075367_10488794
967 Ga0075369_10002216
968 Ga0075369_10069284
969 Ga0075369_10079763
970 Ga0075369_10101072
971 Ga0075366_10066401
972 Ga0075366_10270790
973 Ga0097621_100117011
974 Ga0097621_100128412
975 Ga0097621_100212461
976 Ga0097621_100508910
977 Ga0075370_10037229
978 Ga0075370_10111238
979 Ga0068871_100001467
980 Ga0068871_100018490
981 Ga0068871_100273032
982 Ga0075428_100001449
983 Ga0075428_100036753
984 Ga0075428_100114192
985 Ga0075428_100287568
986 Ga0075430_100013601
987 Ga0075430_100163918
988 Ga0075431_100001649
989 Ga0075433_10032317
990 Ga0075433_10061874
991 Ga0075434_100021260
992 Ga0075434_100365636
993 Ga0075434_100546007
994 Ga0075429_100001932
995 Ga0075429_100161245
996 Ga0068865_100003023
997 Ga0068865_100128322
998 Ga0068865_100380215
999 Ga0075436_100729620
1000 Ga0097620_100004058
1001 Ga0097620_100037211
1002 Ga0097620_100072237
1003 Ga0097620_100168683
1004 Ga0097620_100231777
1005 Ga0075435_100102457
1006 Ga0075435_100201357
1007 Ga0099795_10029817
1008 Ga0105250_10092274
1009 Ga0111539_10003434
1010 Ga0111539_10026817
1011 Ga0111539_10068917
1012 Ga0111539_10101010
1013 Ga0111539_10164658
1014 Ga0111539_10224203
1015 Ga0105245_10451507
1016 Ga0105245_10957047
1017 Ga0105247_10014020
1018 Ga0105247_10098275
1019 Ga0105247_10200368
1020 Ga0105247_10496840
1021 Ga0114129_10004462
1022 Ga0114129_10416433
1023 Ga0114129_11423808
1024 Ga0105243_10001434
1025 Ga0105243_10233431
1026 Ga0105241_10009164
1027 Ga0105241_10011633
1028 Ga0105242_10064605
1029 Ga0105248_10017306
1030 Ga0105248_10109780
1031 Ga0105248_10191298
1032 Ga0105248_10305245
1033 Ga0105248_10378777
1034 Ga0105248_10536069
1035 Ga0105237_10154970
1036 Ga0105237_10456891
1037 Ga0105237_10646022
1038 Ga0105238_10147251
1039 Ga0105238_10630285
1040 Ga0105249_10228334
1041 Ga0105249_10930773
1042 Ga0105239_10046138
1043 Ga0105239_10060655
1044 Ga0105239_10084926
1045 Ga0105239_10212361
1046 Ga0105246_10004943
1047 Ga0105246_10016713
1048 Ga0105246_10078826
1049 Ga0105246_10163619
1050 Ga0157373_10087335
1051 Ga0157370_10391943
1052 Ga0157374_10005514
1053 Ga0157374_10078791
1054 Ga0157374_10119987
1055 Ga0157378_10050263
1056 Ga0157378_10400917
1057 Ga0157378_10465973
1058 Ga0157378_10508740
1059 Ga0163162_10001804
1060 Ga0163162_10030693
1061 Ga0163162_10053705
1062 Ga0163162_10102742
1063 Ga0163162_10304472
1064 Ga0163162_10387687
1065 Ga0163162_10873171
1066 Ga0157372_10341925
1067 Ga0157375_10018575
1068 Ga0157375_10101635
1069 Ga0157375_10167411
1070 Ga0157375_10718807
1071 Ga0157375_10731863
1072 Ga0157375_10735347
1073 Ga0163163_10037607
1074 Ga0163163_10153267
1075 Ga0157380_10187765
1076 Ga0157380_10277446
1077 Ga0157380_10365328
1078 Ga0157380_10382489
1079 Ga0157380_10535685
1080 Ga0157377_10029641
1081 Ga0157379_10000737
1082 Ga0157379_10021700
1083 Ga0157379_10091259
1084 Ga0157379_10974523
1085 Ga0157376_10024078
1086 Ga0157376_10037504
1087 Ga0157376_10124054
1088 Ga0157376_10192656
1089 Ga0157376_10335681
1090 Ga0163161_10021386
1091 Ga0163161_10031758
1092 Ga0207666_1000101
1093 Ga0207673_1002259
1094 Ga0207697_10002688
1095 Ga0207653_10005318
1096 Ga0207682_10004673
1097 Ga0207682_10098465
1098 Ga0207642_10013225
1099 Ga0207642_10201887
1100 Ga0207642_10242072
1101 Ga0207710_10056612
1102 Ga0207710_10066233
1103 Ga0207710_10346982
1104 Ga0207688_10003967
1105 Ga0207688_10022121
1106 Ga0207688_10130416
1107 Ga0207680_10031554
1108 Ga0207680_10261028
1109 Ga0207647_10009033
1110 Ga0207645_10000517
1111 Ga0207645_10001914
1112 Ga0207645_10171613
1113 Ga0207643_10013736
1114 Ga0207643_10027830
1115 Ga0207684_10025619
1116 Ga0207654_10011911
1117 Ga0207654_10043685
1118 Ga0207707_10078609
1119 Ga0207695_10104161
1120 Ga0207671_10070766
1121 Ga0207671_10084605
1122 Ga0207660_10014308
1123 Ga0207660_10150171
1124 Ga0207662_10219510
1125 Ga0207662_10257087
1126 Ga0207662_10372190
1127 Ga0207657_10068732
1128 Ga0207649_10004140
1129 Ga0207649_10650740
1130 Ga0207652_10422043
1131 Ga0207646_10077568
1132 Ga0207681_10001487
1133 Ga0207681_10006451
1134 Ga0207681_10483640
1135 Ga0207694_10158967
1136 Ga0207650_10007806
1137 Ga0207650_10192349
1138 Ga0207659_10000171
1139 Ga0207659_10000719
1140 Ga0207687_10017315
1141 Ga0207687_10047238
1142 Ga0207700_10050091
1143 Ga0207700_10223039
1144 Ga0207700_10368985
1145 Ga0207644_10161247
1146 Ga0207644_10457091
1147 Ga0207690_10004930
1148 Ga0207690_10148468
1149 Ga0207706_10152920
1150 Ga0207706_10226237
1151 Ga0207686_10000913
1152 Ga0207686_10094042
1153 Ga0207709_10011724
1154 Ga0207709_10032417
1155 Ga0207670_10020802
1156 Ga0207669_10001405
1157 Ga0207669_10496761
1158 Ga0207704_10014535
1159 Ga0207704_10027121
1160 Ga0207691_10000464
1161 Ga0207691_10048267
1162 Ga0207691_10203860
1163 Ga0207691_10443306
1164 Ga0207711_10068066
1165 Ga0207711_10388659
1166 Ga0207711_10650688
1167 Ga0207711_10677396
1168 Ga0207689_10002416
1169 Ga0207689_10024973
1170 Ga0207689_10107124
1171 Ga0207661_10020625
1172 Ga0207679_10001182
1173 Ga0207679_10001545
1174 Ga0207667_10130329
1175 Ga0207651_10005029
1176 Ga0207651_10311626
1177 Ga0207712_10005210
1178 Ga0207712_10295388
1179 Ga0207712_10768923
1180 Ga0207668_10005270
1181 Ga0207668_10008223
1182 Ga0207668_10017702
1183 Ga0207668_10024803
1184 Ga0207668_10172066
1185 Ga0207658_10024005
1186 Ga0207658_10076093
1187 Ga0207658_10181557
1188 Ga0207677_10006947
1189 Ga0207677_10076108
1190 Ga0207677_10130796
1191 Ga0207677_10853124
1192 Ga0207703_10014308
1193 Ga0207639_10178471
1194 Ga0207678_10070111
1195 Ga0207678_10120932
1196 Ga0207708_10109168
1197 Ga0207641_10004152
1198 Ga0207641_10230074
1199 Ga0207641_10375101
1200 Ga0207641_10924606
1201 Ga0207648_10000048
1202 Ga0207648_10025128
1203 Ga0207648_10365824
1204 Ga0207648_10383846
1205 Ga0207676_10020724
1206 Ga0207676_10112423
1207 Ga0207674_10009330
1208 Ga0207674_10157464
1209 Ga0207674_10481104
1210 Ga0207675_100029842
1211 Ga0207675_100105819
1212 Ga0207675_100592022
1213 Ga0207675_100599208
1214 Ga0207675_100600298
1215 Ga0207683_10000303
1216 Ga0207683_10000504
1217 Ga0207683_10070378
1218 Ga0207683_10394440
1219 Ga0207698_10264609
1220 Ga0207698_10591947
1221 Ga0209973_1001236
1222 Ga0209968_1007211
1223 Ga0210002_1000829
1224 Ga0209971_1002674
1225 Ga0209966_1003425
1226 Ga0209813_10093307
1227 Ga0209974_10001901
1228 Ga0209974_10033688
1229 Ga0207428_10002387
1230 Ga0207428_10034111
1231 Ga0207428_10205536
1232 Ga0207428_10237067
1233 Ga0268266_10023672
1234 Ga0268266_10026298
1235 Ga0268266_10329526
1236 Ga0268266_10410626
1237 Ga0268265_10004532
1238 Ga0268265_10234004
1239 Ga0268264_10002663
1240 Ga0268264_10008429
1241 Ga0268264_10300415
1242 Ga0265334_10007256
1243 Ga0265338_10156997
1244 Ga0307513_10034450
1245 Ga0307513_10218932
1246 Ga0307513_10334889
1247 Ga0307509_10356645
1248 Ga0307508_10152655
1249 Ga0316578_10170125
1250 Ga0307409_100184446
1251 Ga0307415_100017805
1252 Ga0307507_10039493
1253 Ga0373958_0006231
1254 Ga0373938_0003150
1255 Ga0373926_0008547
1256 Ga0373940_0077956
1257 Ga0373952_0005418
1258 Ga0373952_0070175
1259 Ga0373923_0159213
1260 Ga0373932_0024111
1261 Ga0373936_0076888
1262 Ga0373939_0006425
1263 Ga0373941_0013860
1264 Ga0373945_0291993
1265 Ga0373960_0099042
1266 Ga0373943_0039615
1267 Ga0373946_0003451
1268 Ga0373961_0062676
1269 Ga0373962_0002098
1270 Ga0373931_0006144
1271 Ga0373931_0012162
1272 Ga0373935_0024430
1273 Ga0373927_0009318
1274 Ga0373927_0206995
1275 Ga0373927_0249502
1276 Ga0373933_0094683
1277 Ga0373933_0450651
1278 Ga0373947_0095178
1279 Ga0373937_0049968
1280 Ga0316584_0007935
1281 Ga0373925_0266604
1282 Ga0373925_0718609
1283 Ga0436364_0215433
1284 Ga0436365_0851003
1285 Ga0439465_0130179
1286 Ga0451802_1902684
1287 Ga0439448_0096518
1288 Ga0439455_0004210
1289 Ga0439463_004382
1290 Ga0439458_0066030
1291 Ga0439464_0032028
1292 Ga0439464_0048678
1293 Ga0439460_0017691
1294 Ga0451577_0023820
1295 Ga0451577_0218534
1296 Ga0453684_0081096
1297 Ga0453684_0508603
1298 Ga0451576_0273258
1299 Ga0495617_013746
1300 Ga0495592_0051693
1301 Ga0495603_0025211
1302 Ga0495629_0022749
1303 Ga0495651_0135284
1304 Ga0495653_0093205
1305 Ga0495580_0041240
1306 Ga0495580_0318147
1307 Ga0495582_0284242
1308 Ga0495639_0034157
1309 Ga0495662_0017442
1310 Ga0495664_0002978
1311 Ga0495584_0108689
1312 Ga0495585_0076555
1313 Ga0495585_0116632
1314 Ga0495594_0037632
1315 Ga0495594_0105994
1316 Ga0495616_0260988
1317 Ga0495618_0026228
1318 Ga0495628_0113876
1319 Ga0495628_0291381
1320 Ga0495630_0013994
1321 Ga0495632_0047087
1322 Ga0495643_0124857
1323 Ga0495648_0089533
1324 Ga0495648_0112762
1325 Ga0495663_0008698
1326 Ga0495666_0048834
1327 Ga0495666_0083705
1328 Ga0495652_0023805
1329 Ga0495665_0015133
1330 Ga0495587_0066280
1331 Ga0495598_0021348
1332 Ga0495621_0030286
1333 Ga0495645_0041121
1334 Ga0495645_0393852
1335 Ga0495622_0092720
1336 Ga0495656_0078089
1337 Ga0495656_0125161
1338 Ga0495668_0101132
1339 Ga0495668_0202042
1340 Ga0495634_0265565
1341 Ga0495611_0126058
1342 Ga0495625_0162660
1343 Ga0495635_0188549
1344 Ga0495588_0101347
1345 Ga0495657_0069441
1346 Ga0495623_0037848
1347 Ga0495646_0077646
1348 Ga0495658_0023831
1349 Ga0495658_0287558
1350 Ga0495669_0073387
1351 Ga0495670_0127274
1352 Ga0495671_0184717
1353 Ga0495649_0091613
1354 Ga0495649_0204756
1355 Ga0495600_0051858
1356 Ga0495581_0053369
1357 Ga0495674_0081337
1358 Ga0495676_0074783
1359 Ga0495676_0148083
1360 Ga0495680_0064248
1361 Ga0495683_0074249
1362 Ga0495677_0025251
1363 Ga0495602_0005122
1364 Ga0495602_0170290
1365 Ga0495626_0114772
1366 Ga0496100_0070201
1367 Ga0496101_0085349
1368 Ga0496101_0203685
1369 Ga0496102_0006299
1370 Ga0496102_0021460
1371 Ga0496102_0088374
1372 Ga0496102_0397584
1373 Ga0496102_0448147
1374 Ga0496102_0669809
1375 Ga0496102_0793913
1376 Ga0496103_0388367
1377 Ga0496104_0019812
1378 Ga0496105_0262050
1379 Ga0496106_0017342
1380 Ga0496106_0058920
1381 Ga0496106_0144473
1382 Ga0496106_0196502
1383 Ga0496107_0005487
1384 Ga0496107_0075599
1385 Ga0496108_0012653
1386 Ga0496108_0049030
1387 Ga0496108_0162433
1388 Ga0496109_0001436
1389 Ga0496109_0231389
1390 Ga0496110_0077235
1391 Ga0496111_0021668
1392 Ga0496112_0010554
1393 Ga0496112_0075133
1394 Ga0496113_0223065
1395 Ga0496114_0233289
1396 Ga0496114_0282838
1397 Ga0496114_0427262
1398 Ga0496116_0005852
1399 Ga0496117_0023599
1400 Ga0496118_0014340
1401 Ga0496119_0148096
1402 Ga0496121_0016471
1403 Ga0496121_0094615
1404 Ga0496121_0180043
1405 Ga0496121_0443213
1406 Ga0496122_0044632
1407 Ga0496124_0240630
1408 Ga0496125_0014796
1409 Ga0496125_0148867
1410 Ga0496125_0341841
1411 Ga0496126_0016840
1412 Ga0496126_0024234
1413 Ga0496126_0145400
1414 Ga0496126_0273149
1415 Ga0496126_0409327
1416 Ga0496126_0591454
1417 Ga0501033_0362666
1418 Ga0501034_0241890
1419 Ga0501038_0392249
1420 Ga0501039_0373021
1421 Ga0501041_0422059
1422 Ga0501042_0241666
1423 Ga0501042_0413470
1424 Ga0501047_0134946
1425 Ga0501068_0131861
1426 Ga0501071_0094964
1427 Ga0501071_0148155
1428 Ga0501071_0256282
1429 Ga0501071_0747589
1430 Ga0501072_0053280
1431 Ga0501074_0026535
1432 Ga0501075_0004864
1433 Ga0501076_0006139
1434 Ga0501076_0181933
1435 Ga0501076_0403974
1436 Ga0501077_0079770
1437 Ga0501077_0174863
1438 Ga0501081_0014098
1439 Ga0501044_0053163
1440 Ga0501045_0000352
1441 nmdc:mga00v17_401491_c1
1442 nmdc:mga00v17_5666_c1
1443 nmdc:mga0yw44_5859_c1
1444 nmdc:mga0k408_207542_c1
1445 nmdc:mga06z11_198794_c1
1446 nmdc:mga06z11_28913_c1
1447 nmdc:mga06z11_46274_c1
1448 nmdc:mga04h51_30598_c1
1449 nmdc:mga07m45_219846_c1
1450 nmdc:mga07m45_36267_c1
1451 nmdc:mga05p37_1011_c1
1452 nmdc:mga09592_341147_c1
1453 nmdc:mga0qj67_10025_c1
1454 nmdc:mga0qj67_165003_c1
1455 nmdc:mga06r32_163529_c1
1456 nmdc:mga06r32_408_c1
1457 nmdc:mga08y16_122980_c1
1458 nmdc:mga08y16_156863_c1
1459 nmdc:mga08y16_1987_c1
1460 nmdc:mga08y16_781_c1
1461 nmdc:mga0n895_166674_c1
1462 nmdc:mga0n895_250258_c1
1463 nmdc:mga0n895_295815_c1
1464 nmdc:mga0n895_93324_c1
1465 nmdc:mga0rr50_256943_c1
1466 nmdc:mga08x19_213961_c1
1467 nmdc:mga0a205_17275_c1
1468 nmdc:mga0a205_72149_c1
1469 nmdc:mga0sz30_100506_c1
1470 nmdc:mga0sz30_1038_c1
1471 nmdc:mga0sz30_52989_c1
1472 Ga0495601_0001238
1473 Ga0495601_0204991
1474 Ga0495612_0000681
1475 Ga0495595_0002694
1476 Ga0495619_0000429
1477 Ga0495619_0004651
1478 Ga0500644_0007346
1479 Ga0500644_0055279
1480 Ga0500646_0040651
1481 Ga0500647_0055808
1482 Ga0500566_0127876
1483 Ga0500641_0084842
1484 Ga0500556_0002198
1485 Ga0500562_039975
1486 Ga0500595_004192
1487 Ga0500595_030339
1488 Ga0500655_013727
1489 Ga0500568_0103846
1490 Ga0500603_011245
1491 Ga0500604_0056681
1492 Ga0500622_0005527
1493 Ga0500633_0060550
1494 Ga0500633_0221243
1495 Ga0500638_056006
1496 Ga0500599_002626
1497 Ga0501084_0005041
1498 Ga0501084_0061850
1499 Ga0501082_0050781
1500 Ga0501082_0105164
1501 Ga0501082_0277148
1502 Ga0501082_0557503
1503 Ga0530510_0001421
1504 Ga0530510_0556596
1505 2509074382
1506 2513641176
1507 2513703568
1508 2603860681
1509 2824618774
1510 2824628880
1511 2824638391
1512 2824647591
1513 2824717693
1514 2824725982
1515 2824761546
1516 2824766919
1517 2904712447
1518 2920113962
1519 8006985310
1520 8019656880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02814

UreE_N

UreE urease accessory protein, N-terminal domain

17

76

0.95

PF05194

UreE_C

UreE urease accessory protein, C-terminal domain

90

197

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kr7-assembly1.cif.gz_A crystal structure of a 4-thiouridine synthetase - rna complex with bound atp 0.6386 83 138
4l3k-assembly1.cif.gz_B crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+ 0.6195 2 155
7lmx-assembly1.cif.gz_A a highly specific inhibitor of integrin alpha-v beta-6 with a disulfide 0.6055 83 155
5zyf-assembly3.cif.gz_E crystal structure of streptococcus pyogenes type ii-a cas2 0.6017 85 166
8tcf-assembly1.cif.gz_C integrin alpha-v beta-8 in complex with minibinder b8_bp_dsulf 0.5999 83 154
ID Description Score Start End Superfamily
4l3kB01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9015 2 79 2.60.260.20
af_Q2G2K8_1_75_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.8857 2 79 2.60.260.20
4l3kB01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.879 2 79 2.60.260.20
3tjaD01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.8756 2 80 2.60.260.20
3tjaD01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.8649 2 80 2.60.260.20
ID Description Score Start End GO Terms
AF-A0A7V0YCR7-F1-model_v4 Urease accessory protein UreE 0.9913 1 69
AF-A0A382N7D4-F1-model_v4 UreE urease accessory N-terminal domain-containing protein 0.9264 1 80
AF-A0A2V6UPK4-F1-model_v4 Urease accessory protein UreE 0.9199 1 69
AF-A0A381YUN8-F1-model_v4 UreE urease accessory N-terminal domain-containing protein 0.9192 2 80
AF-A0A6G1YT85-F1-model_v4 UreE urease accessory N-terminal domain-containing protein 0.9167 1 80

Map