F479500

General Info

Members Datasets Scaffolds Average Seq Length
759 421 1518 81

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0727771|Ga0496100_0727771_176_466
Length 96
Sequence MNGDSWSDAQEGSMFTFETADQKEVRRFRIAQFYGRAATVESGGSVVTGHVRAVREKDQSVPPCWTITIVPNPPKPVRVPGRPAPRFSVFEDEGSY

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
180 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
181 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
182 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
191 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
238 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
241 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
255 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
308 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
334 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
339 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
371 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
382 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
385 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
386 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
387 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
388 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
389 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
390 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
391 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
392 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
393 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
394 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
395 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
396 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
397 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
398 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
399 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
400 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
401 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
402 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
403 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
407 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
408 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
409 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
410 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
411 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
412 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
413 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
414 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
415 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
416 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
417 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
418 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
419 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
420 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
421 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.46
Nodule 0
Rhizoplane 4.08
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 4.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0727771 3300048903 Bacteria 775
2 rootH1_10118508 3300003323 Bacteria 2375
3 JGI25161J50226_1022908 3300003374 Bacteria 619
4 JGI25404J52841_10001219 3300003659 Bacteria 4427
5 JGI25404J52841_10028440 3300003659 Bacteria 1200
6 Ga0055543_1003365 3300004625 Bacteria 4761
7 Ga0065165_1001246 3300005262 Bacteria 29017
8 Ga0065165_1005270 3300005262 Bacteria 7374
9 Ga0070676_10087817 3300005328 Bacteria 1899
10 Ga0070690_100247345 3300005330 Bacteria 1260
11 Ga0068869_100452159 3300005334 Bacteria 1065
12 Ga0070680_100019755 3300005336 Bacteria 5342
13 Ga0070680_100154146 3300005336 Bacteria 1929
14 Ga0070680_100157713 3300005336 Bacteria 1907
15 Ga0070682_100661730 3300005337 Bacteria 833
16 Ga0070660_100604708 3300005339 Bacteria 917
17 Ga0070689_100117778 3300005340 Bacteria 2119
18 Ga0070687_100064512 3300005343 Bacteria 1946
19 Ga0070668_100723069 3300005347 Bacteria 879
20 Ga0070669_100356463 3300005353 Bacteria 1188
21 Ga0070673_100700830 3300005364 Bacteria 930
22 Ga0070688_100771857 3300005365 Bacteria 750
23 Ga0070659_100260163 3300005366 Bacteria 1440
24 Ga0070659_100903050 3300005366 Bacteria 772
25 Ga0070709_10010781 3300005434 Bacteria 5071
26 Ga0070709_10046677 3300005434 Bacteria 2694
27 Ga0070714_100124794 3300005435 Bacteria 2294
28 Ga0070714_101230179 3300005435 Bacteria 731
29 Ga0070713_100562493 3300005436 Bacteria 1081
30 Ga0070710_10096867 3300005437 Bacteria 1749
31 Ga0070710_10420143 3300005437 Bacteria 900
32 Ga0070710_10710720 3300005437 Unclassified 710
33 Ga0070701_10380991 3300005438 Bacteria 889
34 Ga0070711_100002422 3300005439 Bacteria 10632
35 Ga0070711_101999591 3300005439 Bacteria 510
36 Ga0070705_100309995 3300005440 Bacteria 1135
37 Ga0070663_100006269 3300005455 Bacteria 7134
38 Ga0070663_100101608 3300005455 Bacteria 2146
39 Ga0070663_100497776 3300005455 Bacteria 1011
40 Ga0070663_101301090 3300005455 Bacteria 641
41 Ga0070663_102131380 3300005455 Bacteria 505
42 Ga0070678_100646210 3300005456 Bacteria 948
43 Ga0070678_101796542 3300005456 Unclassified 578
44 Ga0070678_101982019 3300005456 Bacteria 551
45 Ga0070662_100141848 3300005457 Bacteria 1863
46 Ga0070681_10047013 3300005458 Bacteria 4314
47 Ga0070681_10052433 3300005458 Bacteria 4068
48 Ga0070681_10346938 3300005458 Bacteria 1395
49 Ga0068867_100016234 3300005459 Bacteria 5288
50 Ga0070679_100126998 3300005530 Bacteria 2532
51 Ga0070679_100211430 3300005530 Bacteria 1903
52 Ga0070679_100252190 3300005530 Bacteria 1721
53 Ga0070679_100360816 3300005530 Bacteria 1400
54 Ga0070684_100036719 3300005535 Bacteria 4199
55 Ga0070684_100819427 3300005535 Bacteria 870
56 Ga0070684_101327779 3300005535 Bacteria 677
57 Ga0070697_101470189 3300005536 Bacteria 609
58 Ga0068853_100160297 3300005539 Bacteria 2030
59 Ga0068853_100862866 3300005539 Bacteria 869
60 Ga0070672_100258375 3300005543 Bacteria 1468
61 Ga0070686_100108169 3300005544 Bacteria 1889
62 Ga0070695_100687050 3300005545 Bacteria 811
63 Ga0070696_101268765 3300005546 Bacteria 624
64 Ga0070693_100836509 3300005547 Bacteria 685
65 Ga0070665_100091209 3300005548 Bacteria 3052
66 Ga0070665_100469448 3300005548 Bacteria 1269
67 Ga0070665_101211651 3300005548 Bacteria 766
68 Ga0070704_100137955 3300005549 Bacteria 1900
69 Ga0068855_100612969 3300005563 Bacteria 1172
70 Ga0068855_101172366 3300005563 Bacteria 800
71 Ga0068855_101922383 3300005563 Bacteria 599
72 Ga0068857_100125351 3300005577 Bacteria 2314
73 Ga0068857_100716557 3300005577 Bacteria 951
74 Ga0068857_100813726 3300005577 Bacteria 893
75 Ga0068857_101013376 3300005577 Bacteria 800
76 Ga0068854_100202615 3300005578 Bacteria 1561
77 Ga0068854_100405868 3300005578 Bacteria 1128
78 Ga0068854_101298994 3300005578 Bacteria 655
79 Ga0068854_101816566 3300005578 Bacteria 559
80 Ga0068856_100135579 3300005614 Bacteria 2467
81 Ga0068856_100618770 3300005614 Bacteria 1104
82 Ga0070702_100104694 3300005615 Bacteria 1742
83 Ga0070702_100329830 3300005615 Bacteria 1067
84 Ga0068852_101468760 3300005616 Bacteria 704
85 Ga0068852_101501993 3300005616 Bacteria 696
86 Ga0068859_100352394 3300005617 Bacteria 1567
87 Ga0068859_100386192 3300005617 Bacteria 1496
88 Ga0068866_10016546 3300005718 Bacteria 3299
89 Ga0068861_100120440 3300005719 Bacteria 2116
90 Ga0068851_10595898 3300005834 Bacteria 672
91 Ga0068870_10185282 3300005840 Bacteria 1253
92 Ga0068863_102583121 3300005841 Bacteria 517
93 Ga0068858_100057085 3300005842 Bacteria 3608
94 Ga0068858_100275785 3300005842 Bacteria 1601
95 Ga0068858_100538826 3300005842 Bacteria 1130
96 Ga0068858_100547095 3300005842 Unclassified 1121
97 Ga0068858_101282850 3300005842 Bacteria 721
98 Ga0068860_100004484 3300005843 Bacteria 14240
99 Ga0068860_100209678 3300005843 Bacteria 1890
100 Ga0068862_100365636 3300005844 Bacteria 1342
101 Ga0068862_100385378 3300005844 Unclassified 1308
102 Ga0068862_101618823 3300005844 Bacteria 655
103 Ga0081455_10025237 3300005937 Bacteria 5491
104 Ga0081540_1005771 3300005983 Bacteria 9165
105 Ga0081540_1017880 3300005983 Bacteria 4371
106 Ga0081540_1066140 3300005983 Bacteria 1696
107 Ga0081540_1078001 3300005983 Bacteria 1503
108 Ga0081540_1350833 3300005983 Bacteria 505
109 Ga0070717_11871741 3300006028 Bacteria 542
110 Ga0075365_10024421 3300006038 Bacteria 3813
111 Ga0075365_10236955 3300006038 Bacteria 1281
112 Ga0075368_10413934 3300006042 Bacteria 593
113 Ga0075363_100484721 3300006048 Bacteria 733
114 Ga0075363_100643676 3300006048 Bacteria 637
115 Ga0075363_100859831 3300006048 Bacteria 554
116 Ga0075432_10124356 3300006058 Bacteria 972
117 Ga0070715_10045033 3300006163 Bacteria 1869
118 Ga0070716_100188972 3300006173 Bacteria 1359
119 Ga0070716_100782827 3300006173 Bacteria 737
120 Ga0070712_100012301 3300006175 Bacteria 5438
121 Ga0070712_101175379 3300006175 Bacteria 667
122 Ga0075367_10184646 3300006178 Bacteria 1300
123 Ga0075367_10602776 3300006178 Bacteria 698
124 Ga0075369_10558226 3300006186 Bacteria 546
125 Ga0075366_10454327 3300006195 Bacteria 790
126 Ga0075366_10859173 3300006195 Bacteria 565
127 Ga0097621_100341523 3300006237 Bacteria 1330
128 Ga0097621_100491424 3300006237 Unclassified 1111
129 Ga0075370_10295398 3300006353 Bacteria 963
130 Ga0068871_100097830 3300006358 Bacteria 2454
131 Ga0068871_101974604 3300006358 Unclassified 555
132 Ga0075434_100191078 3300006871 Bacteria 2068
133 Ga0075434_101970561 3300006871 Bacteria 589
134 Ga0068865_100381663 3300006881 Bacteria 1149
135 Ga0097620_100352368 3300006931 Bacteria 1567
136 Ga0097620_100386227 3300006931 Bacteria 1496
137 Ga0099794_10063628 3300007265 Bacteria 1796
138 Ga0099795_10032211 3300007788 Bacteria 1811
139 Ga0099795_10082499 3300007788 Bacteria 1233
140 Ga0099795_10435486 3300007788 Bacteria 601
141 Ga0105250_10151856 3300009092 Unclassified 964
142 Ga0105240_10014678 3300009093 Bacteria 10689
143 Ga0105240_10088393 3300009093 Bacteria 3791
144 Ga0105240_10167610 3300009093 Bacteria 2604
145 Ga0105240_10537437 3300009093 Bacteria 1295
146 Ga0105240_11133817 3300009093 Bacteria 831
147 Ga0111539_10098642 3300009094 Bacteria 3431
148 Ga0105245_10298711 3300009098 Bacteria 1579
149 Ga0105247_10005821 3300009101 Bacteria 7710
150 Ga0105247_10057132 3300009101 Bacteria 2412
151 Ga0105247_10095751 3300009101 Bacteria 1891
152 Ga0105247_11247407 3300009101 Bacteria 594
153 Ga0105243_10045957 3300009148 Bacteria 3433
154 Ga0105241_10604359 3300009174 Bacteria 991
155 Ga0105241_11943749 3300009174 Bacteria 578
156 Ga0105242_10301326 3300009176 Bacteria 1463
157 Ga0105248_10183392 3300009177 Bacteria 2358
158 Ga0105248_10889913 3300009177 Bacteria 1005
159 Ga0105237_10013759 3300009545 Bacteria 8472
160 Ga0105237_10072896 3300009545 Bacteria 3427
161 Ga0105237_10133259 3300009545 Bacteria 2479
162 Ga0105237_10218505 3300009545 Bacteria 1906
163 Ga0105237_10381884 3300009545 Bacteria 1414
164 Ga0105237_12104226 3300009545 Unclassified 573
165 Ga0105237_12688675 3300009545 Unclassified 509
166 Ga0105238_10103344 3300009551 Bacteria 2830
167 Ga0105238_10809543 3300009551 Bacteria 953
168 Ga0105249_10110649 3300009553 Bacteria 2596
169 Ga0105249_10433548 3300009553 Bacteria 1350
170 Ga0099796_10014472 3300010159 Bacteria 2280
171 Ga0099796_10036705 3300010159 Bacteria 1633
172 Ga0105239_10082187 3300010375 Bacteria 3547
173 Ga0105239_10412395 3300010375 Bacteria 1529
174 Ga0157342_1062604 3300012507 Bacteria 549
175 Ga0157327_1061328 3300012512 Bacteria 561
176 Ga0157370_10269079 3300013104 Bacteria 1574
177 Ga0157370_10298933 3300013104 Bacteria 1486
178 Ga0157370_10648825 3300013104 Bacteria 965
179 Ga0157370_10894723 3300013104 Bacteria 806
180 Ga0157370_11688068 3300013104 Bacteria 569
181 Ga0157369_10008602 3300013105 Bacteria 11708
182 Ga0157369_10014694 3300013105 Bacteria 8833
183 Ga0157369_10019848 3300013105 Bacteria 7520
184 Ga0157369_11807540 3300013105 Bacteria 621
185 Ga0157374_10483795 3300013296 Bacteria 1241
186 Ga0157378_10220155 3300013297 Bacteria 1804
187 Ga0163162_10053853 3300013306 Bacteria 4045
188 Ga0157372_10023670 3300013307 Bacteria 6663
189 Ga0157372_10131560 3300013307 Bacteria 2879
190 Ga0157372_10254644 3300013307 Bacteria 2038
191 Ga0157375_10170119 3300013308 Bacteria 2326
192 Ga0157375_10937614 3300013308 Bacteria 1008
193 Ga0157375_12138388 3300013308 Bacteria 666
194 Ga0157380_10434120 3300014326 Bacteria 1256
195 Ga0157380_10453246 3300014326 Bacteria 1233
196 Ga0157380_11419626 3300014326 Bacteria 745
197 Ga0182008_10182475 3300014497 Bacteria 1062
198 Ga0157379_10031372 3300014968 Bacteria 4733
199 Ga0157379_10547398 3300014968 Bacteria 1076
200 Ga0157379_11084706 3300014968 Bacteria 766
201 Ga0157379_12031325 3300014968 Unclassified 568
202 Ga0157376_10807703 3300014969 Bacteria 951
203 Ga0163161_10042414 3300017792 Bacteria 3272
204 Ga0206355_1450230 3300020076 Bacteria 884
205 Ga0206354_10102221 3300020081 Bacteria 1204
206 Ga0206353_11453605 3300020082 Bacteria 892
207 Ga0206353_11955534 3300020082 Bacteria 654
208 Ga0213872_10229735 3300021361 Bacteria 787
209 Ga0213874_10186309 3300021377 Bacteria 740
210 Ga0213876_10080991 3300021384 Bacteria 1717
211 Ga0213876_10200779 3300021384 Bacteria 1060
212 Ga0213876_10268145 3300021384 Bacteria 907
213 Ga0213876_10426588 3300021384 Bacteria 705
214 Ga0213875_10019022 3300021388 Bacteria 3306
215 Ga0213875_10279175 3300021388 Bacteria 789
216 Ga0213871_10002781 3300021441 Bacteria 3271
217 Ga0209677_108298 3300025253 Bacteria 2036
218 Ga0209233_1000721 3300025261 Bacteria 15291
219 Ga0209233_1014721 3300025261 Bacteria 2196
220 Ga0209455_1015897 3300025272 Bacteria 1635
221 Ga0209758_1034174 3300025297 Bacteria 2028
222 Ga0207426_1000704 3300025302 Bacteria 39583
223 Ga0207692_10097612 3300025898 Bacteria 1606
224 Ga0207692_10359248 3300025898 Bacteria 900
225 Ga0207692_10438243 3300025898 Bacteria 820
226 Ga0207642_10025256 3300025899 Bacteria 2400
227 Ga0207710_10016828 3300025900 Bacteria 3096
228 Ga0207710_10090253 3300025900 Bacteria 1433
229 Ga0207710_10422543 3300025900 Bacteria 686
230 Ga0207688_10230279 3300025901 Bacteria 1118
231 Ga0207680_10748807 3300025903 Bacteria 700
232 Ga0207647_10460004 3300025904 Bacteria 712
233 Ga0207685_10308601 3300025905 Bacteria 785
234 Ga0207699_10188434 3300025906 Bacteria 1391
235 Ga0207699_10496458 3300025906 Bacteria 881
236 Ga0207699_11133408 3300025906 Unclassified 579
237 Ga0207645_10091515 3300025907 Bacteria 1956
238 Ga0207643_11075393 3300025908 Bacteria 519
239 Ga0207684_10141438 3300025910 Bacteria 2069
240 Ga0207684_10265339 3300025910 Bacteria 1482
241 Ga0207707_10003515 3300025912 Bacteria 13870
242 Ga0207707_10382790 3300025912 Bacteria 1209
243 Ga0207707_10571603 3300025912 Bacteria 959
244 Ga0207695_10018858 3300025913 Bacteria 7961
245 Ga0207695_10090969 3300025913 Bacteria 3066
246 Ga0207695_10150416 3300025913 Bacteria 2267
247 Ga0207695_10162914 3300025913 Bacteria 2160
248 Ga0207695_10165533 3300025913 Bacteria 2140
249 Ga0207695_11580583 3300025913 Bacteria 536
250 Ga0207671_10110752 3300025914 Bacteria 2089
251 Ga0207671_10249652 3300025914 Unclassified 1395
252 Ga0207671_10425198 3300025914 Bacteria 1057
253 Ga0207671_10464291 3300025914 Bacteria 1009
254 Ga0207671_10802720 3300025914 Bacteria 746
255 Ga0207693_10005063 3300025915 Bacteria 11062
256 Ga0207663_10465320 3300025916 Bacteria 977
257 Ga0207660_10084028 3300025917 Bacteria 2346
258 Ga0207660_10092065 3300025917 Bacteria 2250
259 Ga0207660_11568248 3300025917 Bacteria 531
260 Ga0207662_10151861 3300025918 Bacteria 1474
261 Ga0207657_10331558 3300025919 Bacteria 1202
262 Ga0207649_10809574 3300025920 Bacteria 731
263 Ga0207649_11052568 3300025920 Bacteria 641
264 Ga0207652_10036673 3300025921 Bacteria 4146
265 Ga0207652_10121022 3300025921 Bacteria 2328
266 Ga0207652_10200432 3300025921 Bacteria 1796
267 Ga0207652_11006797 3300025921 Bacteria 732
268 Ga0207646_10199533 3300025922 Bacteria 1807
269 Ga0207681_10661932 3300025923 Bacteria 866
270 Ga0207694_10457021 3300025924 Bacteria 1066
271 Ga0207694_11051057 3300025924 Bacteria 689
272 Ga0207687_10046904 3300025927 Bacteria 2993
273 Ga0207700_11426434 3300025928 Bacteria 615
274 Ga0207664_10539623 3300025929 Bacteria 1046
275 Ga0207690_10278045 3300025932 Bacteria 1303
276 Ga0207690_10781404 3300025932 Bacteria 788
277 Ga0207706_10030998 3300025933 Bacteria 4765
278 Ga0207686_10079143 3300025934 Bacteria 2139
279 Ga0207669_10062945 3300025937 Bacteria 2287
280 Ga0207704_10067872 3300025938 Bacteria 2246
281 Ga0207665_10233677 3300025939 Bacteria 1352
282 Ga0207665_10265214 3300025939 Bacteria 1273
283 Ga0207691_10100013 3300025940 Bacteria 2589
284 Ga0207711_11012771 3300025941 Bacteria 770
285 Ga0207711_11409201 3300025941 Bacteria 639
286 Ga0207661_10009090 3300025944 Bacteria 7121
287 Ga0207661_10205475 3300025944 Bacteria 1733
288 Ga0207667_11345284 3300025949 Bacteria 689
289 Ga0207667_11939502 3300025949 Bacteria 550
290 Ga0207651_10549714 3300025960 Bacteria 1004
291 Ga0207712_10514807 3300025961 Bacteria 1025
292 Ga0207712_11109410 3300025961 Bacteria 704
293 Ga0207668_10222861 3300025972 Bacteria 1515
294 Ga0207640_10130089 3300025981 Bacteria 1818
295 Ga0207640_10234404 3300025981 Bacteria 1414
296 Ga0207640_11595431 3300025981 Bacteria 588
297 Ga0207658_10705576 3300025986 Bacteria 912
298 Ga0207703_10201963 3300026035 Bacteria 1767
299 Ga0207703_10997835 3300026035 Bacteria 803
300 Ga0207639_10095611 3300026041 Bacteria 2388
301 Ga0207639_10364827 3300026041 Bacteria 1293
302 Ga0207678_10021511 3300026067 Bacteria 5656
303 Ga0207678_10086117 3300026067 Bacteria 2685
304 Ga0207678_10165386 3300026067 Bacteria 1889
305 Ga0207678_10638719 3300026067 Bacteria 935
306 Ga0207708_10136428 3300026075 Bacteria 1922
307 Ga0207708_10362230 3300026075 Bacteria 1192
308 Ga0207702_10552820 3300026078 Bacteria 1126
309 Ga0207702_10640425 3300026078 Bacteria 1045
310 Ga0207641_10889823 3300026088 Bacteria 884
311 Ga0207641_11767444 3300026088 Unclassified 620
312 Ga0207641_11780747 3300026088 Bacteria 618
313 Ga0207648_10017435 3300026089 Bacteria 6534
314 Ga0207674_10062523 3300026116 Bacteria 3761
315 Ga0207674_10250802 3300026116 Bacteria 1717
316 Ga0207674_11365079 3300026116 Bacteria 678
317 Ga0207674_11760811 3300026116 Bacteria 587
318 Ga0207675_100119127 3300026118 Bacteria 2497
319 Ga0207675_101118542 3300026118 Bacteria 808
320 Ga0207683_10054583 3300026121 Bacteria 3503
321 Ga0207698_11763355 3300026142 Bacteria 634
322 Ga0209179_1001824 3300027512 Bacteria 2725
323 Ga0209588_1027908 3300027671 Bacteria 1797
324 Ga0209588_1124993 3300027671 Bacteria 822
325 Ga0207428_10334670 3300027907 Bacteria 1116
326 Ga0268266_10145100 3300028379 Bacteria 2133
327 Ga0268266_10677850 3300028379 Bacteria 993
328 Ga0268266_11075503 3300028379 Bacteria 778
329 Ga0268265_10024481 3300028380 Bacteria 4272
330 Ga0268265_10656090 3300028380 Unclassified 1009
331 Ga0268265_11724512 3300028380 Bacteria 632
332 Ga0268264_10003164 3300028381 Bacteria 14255
333 Ga0268264_10159675 3300028381 Bacteria 2029
334 Ga0265337_1036764 3300028556 Bacteria 1427
335 Ga0265326_10015606 3300028558 Bacteria 2201
336 Ga0265319_1003993 3300028563 Bacteria 7481
337 Ga0265334_10005962 3300028573 Bacteria 5301
338 Ga0265318_10234234 3300028577 Bacteria 670
339 Ga0265323_10001188 3300028653 Bacteria 13258
340 Ga0265322_10009292 3300028654 Bacteria 2855
341 Ga0265336_10001614 3300028666 Bacteria 10057
342 Ga0307515_10104978 3300028794 Bacteria 3369
343 Ga0265338_10001385 3300028800 Bacteria 39441
344 Ga0265338_10438758 3300028800 Bacteria 926
345 Ga0265324_10002403 3300029957 Bacteria 9631
346 Ga0307511_10208961 3300030521 Unclassified 1000
347 Ga0307511_10262274 3300030521 Bacteria 818
348 Ga0265332_10306051 3300031238 Bacteria 656
349 Ga0265340_10046709 3300031247 Bacteria 2111
350 Ga0265339_10004557 3300031249 Bacteria 9436
351 Ga0265316_10115930 3300031344 Bacteria 2025
352 Ga0307509_10274717 3300031507 Bacteria 1450
353 Ga0307509_10518236 3300031507 Bacteria 874
354 Ga0307509_10526402 3300031507 Bacteria 863
355 Ga0307509_10862318 3300031507 Bacteria 570
356 Ga0307408_101586619 3300031548 Bacteria 621
357 Ga0307408_101663621 3300031548 Bacteria 607
358 Ga0307508_10000045 3300031616 Bacteria 142824
359 Ga0307516_10330158 3300031730 Bacteria 1194
360 Ga0307405_11902002 3300031731 Bacteria 531
361 Ga0307412_10421560 3300031911 Bacteria 1092
362 Ga0307416_100776067 3300032002 Bacteria 1053
363 Ga0307415_100014064 3300032126 Bacteria 4692
364 Ga0307507_10390889 3300033179 Bacteria 796
365 Ga0307507_10441860 3300033179 Unclassified 722
366 Ga0307510_10317448 3300033180 Bacteria 1016
367 Ga0316215_1000809 3300033544 Bacteria 3139
368 Ga0373928_0074040 3300035084 Bacteria 848
369 Ga0373934_0064140 3300035086 Bacteria 1466
370 Ga0373944_0088161 3300035089 Bacteria 1034
371 Ga0373923_0002702 3300035111 Bacteria 5524
372 Ga0373936_0003487 3300035113 Bacteria 5914
373 Ga0373936_0015380 3300035113 Bacteria 2933
374 Ga0373945_0017657 3300035116 Bacteria 2418
375 Ga0373953_0044814 3300035117 Bacteria 1770
376 Ga0373954_0007733 3300035118 Bacteria 4702
377 Ga0373954_0237893 3300035118 Bacteria 896
378 Ga0373956_0067739 3300035119 Bacteria 1625
379 Ga0373957_0080028 3300035120 Bacteria 1289
380 Ga0373943_0000777 3300035170 Bacteria 13945
381 Ga0373946_0019368 3300035171 Bacteria 2622
382 Ga0373946_0175983 3300035171 Bacteria 1013
383 Ga0373955_0132012 3300035172 Bacteria 1458
384 Ga0373924_0036249 3300035410 Bacteria 2003
385 Ga0373931_0736124 3300035691 Bacteria 654
386 Ga0373935_0000251 3300035692 Bacteria 26431
387 Ga0373927_0016017 3300035695 Bacteria 4948
388 Ga0373927_0371812 3300035695 Bacteria 942
389 Ga0373933_0071933 3300035724 Bacteria 2106
390 Ga0373933_0385974 3300035724 Bacteria 912
391 Ga0373947_0001064 3300035725 Bacteria 16792
392 Ga0373947_0036761 3300035725 Bacteria 2904
393 Ga0373937_0024219 3300036401 Bacteria 5472
394 Ga0373937_0099439 3300036401 Bacteria 2698
395 Ga0373925_0017451 3300037068 Bacteria 5203
396 Ga0373925_0099338 3300037068 Bacteria 2235
397 Ga0373925_0378563 3300037068 Bacteria 1152
398 Ga0373925_0676596 3300037068 Bacteria 851
399 Ga0395899_0216040 3300037312 Bacteria 1330
400 Ga0395900_0014168 3300037418 Bacteria 8142
401 Ga0395900_0053627 3300037418 Bacteria 4150
402 Ga0395900_0139732 3300037418 Bacteria 2481
403 Ga0395900_0289225 3300037418 Bacteria 1628
404 Ga0395898_0010728 3300037466 Bacteria 9571
405 Ga0395898_0040548 3300037466 Bacteria 4604
406 Ga0395898_0445874 3300037466 Bacteria 1233
407 Ga0436364_0104458 3300037853 Bacteria 998
408 Ga0436364_0106660 3300037853 Bacteria 3697
409 Ga0395901_0013276 3300038443 Bacteria 8367
410 Ga0395901_0215830 3300038443 Bacteria 2007
411 Ga0436365_0379190 3300039437 Bacteria 1001
412 Ga0436365_1063195 3300039437 Bacteria 4701
413 Ga0436365_1275870 3300039437 Bacteria 725
414 Ga0436365_1282324 3300039437 Bacteria 3143
415 Ga0436365_1300568 3300039437 Bacteria 720
416 Ga0436365_1301706 3300039437 Bacteria 1157
417 Ga0436365_1502295 3300039437 Bacteria 1990
418 Ga0436365_1736230 3300039437 Bacteria 1893
419 Ga0436360_0621178 3300039438 Bacteria 3181
420 Ga0436360_0876912 3300039438 Bacteria 1886
421 Ga0436361_0132309 3300039447 Bacteria 1179
422 Ga0436361_0561305 3300039447 Bacteria 2091
423 Ga0436363_0292064 3300039450 Bacteria 2114
424 Ga0436363_0697524 3300039450 Bacteria 560
425 Ga0436363_0888890 3300039450 Bacteria 1191
426 Ga0436362_0209959 3300039453 Bacteria 3905
427 Ga0451795_0245446 3300041456 Unclassified 1004
428 Ga0451798_0406431 3300041458 Unclassified 570
429 Ga0451807_0038421 3300041486 Bacteria 500
430 Ga0451835_0316067 3300041492 Unclassified 605
431 Ga0451835_0898454 3300041492 Bacteria 728
432 Ga0451843_0287902 3300041509 Bacteria 751
433 Ga0466966_0930215 3300044684 Bacteria 524
434 Ga0466961_0953807 3300044693 Bacteria 510
435 Ga0466963_0049865 3300044694 Bacteria 2770
436 Ga0466964_0044669 3300044706 Bacteria 1801
437 Ga0466971_0023290 3300044719 Bacteria 2760
438 Ga0466968_0126931 3300044735 Bacteria 1158
439 Ga0466970_0202215 3300044765 Bacteria 1105
440 Ga0466970_0390873 3300044765 Bacteria 793
441 Ga0466970_0577535 3300044765 Bacteria 651
442 Ga0466957_0014799 3300044842 Bacteria 4546
443 Ga0466957_0077629 3300044842 Bacteria 2064
444 Ga0466957_0111752 3300044842 Bacteria 1733
445 Ga0466957_0688358 3300044842 Bacteria 721
446 Ga0466960_0079279 3300044901 Bacteria 1651
447 Ga0466959_0007007 3300045049 Bacteria 7878
448 Ga0466959_0087099 3300045049 Bacteria 2247
449 Ga0466959_0130260 3300045049 Bacteria 1783
450 Ga0466958_0067977 3300045836 Bacteria 2178
451 Ga0466967_0042113 3300045976 Bacteria 3944
452 Ga0466967_0208739 3300045976 Bacteria 1852
453 Ga0466967_0824411 3300045976 Bacteria 921
454 Ga0466967_2257570 3300045976 Unclassified 540
455 Ga0495617_139834 3300046452 Bacteria 773
456 Ga0495617_188665 3300046452 Bacteria 647
457 Ga0495592_0012453 3300046454 Bacteria 6460
458 Ga0495592_0032116 3300046454 Bacteria 3965
459 Ga0495603_0000208 3300046455 Bacteria 30287
460 Ga0495603_0018490 3300046455 Bacteria 4216
461 Ga0495603_0034607 3300046455 Bacteria 3037
462 Ga0495603_0069852 3300046455 Bacteria 2065
463 Ga0495603_0142584 3300046455 Bacteria 1393
464 Ga0495603_0259005 3300046455 Bacteria 1001
465 Ga0495590_0044795 3300046457 Bacteria 1542
466 Ga0495629_0047749 3300046459 Bacteria 3002
467 Ga0495629_0303389 3300046459 Bacteria 1093
468 Ga0495638_0145404 3300046460 Bacteria 1379
469 Ga0495641_0001151 3300046461 Bacteria 22739
470 Ga0495651_0678675 3300046462 Bacteria 644
471 Ga0495653_0331617 3300046463 Bacteria 983
472 Ga0495580_0003553 3300046472 Bacteria 13243
473 Ga0495580_0011112 3300046472 Bacteria 6977
474 Ga0495580_0565004 3300046472 Bacteria 754
475 Ga0495582_0000311 3300046473 Bacteria 26740
476 Ga0495582_0046181 3300046473 Bacteria 2399
477 Ga0495582_0251823 3300046473 Bacteria 1013
478 Ga0495605_0035595 3300046474 Bacteria 2515
479 Ga0495605_0166729 3300046474 Bacteria 975
480 Ga0495639_0011186 3300046475 Bacteria 3866
481 Ga0495639_0034493 3300046475 Bacteria 2264
482 Ga0495639_0123582 3300046475 Bacteria 1235
483 Ga0495639_0190801 3300046475 Bacteria 1000
484 Ga0495662_0000259 3300046476 Bacteria 22394
485 Ga0495664_0014045 3300046477 Bacteria 4537
486 Ga0495664_0076715 3300046477 Bacteria 2000
487 Ga0495664_0269175 3300046477 Bacteria 1030
488 Ga0495664_0946136 3300046477 Unclassified 503
489 Ga0495584_0486293 3300046491 Bacteria 628
490 Ga0495584_0528052 3300046491 Bacteria 601
491 Ga0495585_0023670 3300046492 Bacteria 3524
492 Ga0495585_0037287 3300046492 Bacteria 2738
493 Ga0495585_0205779 3300046492 Bacteria 1000
494 Ga0495594_0000272 3300046499 Bacteria 25431
495 Ga0495594_0633719 3300046499 Bacteria 605
496 Ga0495596_0016393 3300046500 Bacteria 3079
497 Ga0495596_0040268 3300046500 Bacteria 1845
498 Ga0495596_0213235 3300046500 Bacteria 750
499 Ga0495607_0505659 3300046501 Bacteria 535
500 Ga0495583_0037600 3300046506 Bacteria 2293
501 Ga0495583_0249600 3300046506 Bacteria 712
502 Ga0495606_0079854 3300046507 Bacteria 2036
503 Ga0495606_0266306 3300046507 Unclassified 943
504 Ga0495606_0656236 3300046507 Bacteria 507
505 Ga0495608_0434224 3300046511 Bacteria 800
506 Ga0495610_0028007 3300046512 Bacteria 2986
507 Ga0495616_0022343 3300046513 Bacteria 3416
508 Ga0495616_0435785 3300046513 Bacteria 533
509 Ga0495618_0038832 3300046514 Bacteria 2993
510 Ga0495620_0124066 3300046515 Bacteria 1016
511 Ga0495628_0015355 3300046516 Bacteria 6396
512 Ga0495630_0000820 3300046517 Bacteria 21887
513 Ga0495630_0426183 3300046517 Bacteria 1016
514 Ga0495631_0091008 3300046518 Bacteria 1313
515 Ga0495631_0172380 3300046518 Bacteria 927
516 Ga0495631_0194520 3300046518 Bacteria 868
517 Ga0495632_0136121 3300046519 Bacteria 1141
518 Ga0495632_0268608 3300046519 Bacteria 761
519 Ga0495643_0026084 3300046522 Bacteria 3301
520 Ga0495644_0135805 3300046523 Bacteria 938
521 Ga0495644_0179464 3300046523 Bacteria 814
522 Ga0495648_0016237 3300046524 Bacteria 5372
523 Ga0495663_0117724 3300046525 Bacteria 887
524 Ga0495663_0153432 3300046525 Bacteria 787
525 Ga0495666_0020413 3300046526 Bacteria 3283
526 Ga0495666_0064479 3300046526 Bacteria 1748
527 Ga0495666_0411766 3300046526 Bacteria 607
528 Ga0495666_0498051 3300046526 Unclassified 544
529 Ga0495642_0208921 3300046528 Bacteria 851
530 Ga0495652_0151944 3300046529 Bacteria 1808
531 Ga0495652_0289985 3300046529 Bacteria 1194
532 Ga0495654_0057570 3300046530 Bacteria 1877
533 Ga0495665_0006478 3300046531 Bacteria 6321
534 Ga0495665_0144912 3300046531 Bacteria 1240
535 Ga0495640_0029803 3300046533 Bacteria 3912
536 Ga0495640_0036324 3300046533 Bacteria 3481
537 Ga0495586_0192215 3300046535 Bacteria 1156
538 Ga0495586_0673207 3300046535 Bacteria 598
539 Ga0495598_0009326 3300046537 Bacteria 2317
540 Ga0495598_0042167 3300046537 Bacteria 1338
541 Ga0495609_0313607 3300046538 Bacteria 637
542 Ga0495621_0021073 3300046539 Bacteria 2145
543 Ga0495597_0083017 3300046542 Bacteria 1368
544 Ga0495645_0009962 3300046543 Bacteria 6654
545 Ga0495622_0003774 3300046557 Bacteria 7085
546 Ga0495622_0367736 3300046557 Bacteria 621
547 Ga0495633_0023664 3300046558 Bacteria 3041
548 Ga0495633_0311024 3300046558 Bacteria 715
549 Ga0495633_0358387 3300046558 Bacteria 660
550 Ga0495667_0018312 3300046559 Bacteria 4732
551 Ga0495667_0513937 3300046559 Bacteria 750
552 Ga0495656_0010750 3300046615 Bacteria 3337
553 Ga0495656_0067645 3300046615 Bacteria 1577
554 Ga0495656_0083654 3300046615 Bacteria 1445
555 Ga0495656_0581425 3300046615 Bacteria 598
556 Ga0495668_0064871 3300046616 Bacteria 2010
557 Ga0495668_0275039 3300046616 Bacteria 922
558 Ga0495668_0433090 3300046616 Bacteria 723
559 Ga0495634_0001816 3300046642 Bacteria 18416
560 Ga0495611_0208585 3300046648 Bacteria 910
561 Ga0495625_0238246 3300046660 Bacteria 1185
562 Ga0495625_0675890 3300046660 Bacteria 612
563 Ga0495635_0000392 3300046663 Bacteria 27895
564 Ga0495635_0067725 3300046663 Bacteria 2448
565 Ga0495635_0242518 3300046663 Bacteria 1216
566 Ga0495659_0005588 3300046664 Bacteria 3956
567 Ga0495659_0016225 3300046664 Bacteria 2455
568 Ga0495661_0348965 3300046665 Bacteria 729
569 Ga0495588_0051562 3300046674 Bacteria 2119
570 Ga0495588_0299612 3300046674 Bacteria 846
571 Ga0495657_0217672 3300046675 Bacteria 1159
572 Ga0495657_0697029 3300046675 Bacteria 584
573 Ga0495657_0906496 3300046675 Unclassified 501
574 Ga0495599_0053300 3300046678 Bacteria 2534
575 Ga0495599_0063739 3300046678 Bacteria 2303
576 Ga0495599_0186802 3300046678 Bacteria 1276
577 Ga0495599_0403193 3300046678 Bacteria 814
578 Ga0495646_0007901 3300046680 Bacteria 6757
579 Ga0495646_0189967 3300046680 Bacteria 1123
580 Ga0495646_0491356 3300046680 Bacteria 631
581 Ga0495647_0002503 3300046681 Bacteria 5823
582 Ga0495658_0001021 3300046683 Bacteria 14800
583 Ga0495658_0035960 3300046683 Bacteria 2729
584 Ga0495658_1125962 3300046683 Bacteria 500
585 Ga0495669_0012390 3300046684 Bacteria 3629
586 Ga0495669_0015228 3300046684 Bacteria 3292
587 Ga0495669_0314401 3300046684 Bacteria 755
588 Ga0495613_0090285 3300046689 Bacteria 2219
589 Ga0495613_0140689 3300046689 Bacteria 1724
590 Ga0495624_0005116 3300046690 Bacteria 9475
591 Ga0495624_0029396 3300046690 Bacteria 3585
592 Ga0495624_0383983 3300046690 Bacteria 844
593 Ga0495670_0018072 3300046691 Bacteria 3473
594 Ga0495649_0024865 3300046694 Bacteria 3338
595 Ga0495649_0238002 3300046694 Bacteria 938
596 Ga0495589_0089557 3300046794 Bacteria 1494
597 Ga0495600_0408497 3300046809 Bacteria 844
598 Ga0495600_0824315 3300046809 Bacteria 551
599 Ga0495660_0266304 3300046810 Bacteria 789
600 Ga0495581_0009954 3300047315 Bacteria 5499
601 Ga0495581_0017134 3300047315 Bacteria 4210
602 Ga0495581_0135336 3300047315 Bacteria 1436
603 Ga0495581_0526409 3300047315 Bacteria 687
604 Ga0495604_0062069 3300047317 Bacteria 2857
605 Ga0495604_0328856 3300047317 Bacteria 1020
606 Ga0495636_0280244 3300047318 Bacteria 776
607 Ga0495674_0001216 3300047319 Bacteria 24946
608 Ga0495674_0087078 3300047319 Bacteria 2673
609 Ga0495674_0141532 3300047319 Bacteria 2022
610 Ga0495676_0013658 3300047321 Bacteria 7288
611 Ga0495676_0097574 3300047321 Bacteria 2182
612 Ga0495676_0319737 3300047321 Bacteria 1043
613 Ga0495676_0869562 3300047321 Bacteria 578
614 Ga0495683_0061750 3300047323 Bacteria 1855
615 Ga0495683_0190488 3300047323 Bacteria 931
616 Ga0495677_0059401 3300047445 Bacteria 1416
617 Ga0495677_0099508 3300047445 Bacteria 1100
618 Ga0495679_022094 3300047446 Bacteria 2184
619 Ga0495685_137772 3300047447 Bacteria 796
620 Ga0495673_0067513 3300047469 Bacteria 1513
621 Ga0495681_0188925 3300047470 Bacteria 842
622 Ga0495684_0008730 3300047471 Bacteria 7837
623 Ga0495684_0066760 3300047471 Bacteria 2735
624 Ga0495686_0124549 3300047472 Bacteria 1533
625 Ga0495593_0005423 3300047673 Bacteria 7533
626 Ga0495593_0029156 3300047673 Bacteria 3028
627 Ga0495593_0297592 3300047673 Bacteria 807
628 Ga0495593_0651421 3300047673 Bacteria 529
629 Ga0495614_0118004 3300048089 Bacteria 1168
630 Ga0495626_0069040 3300048091 Bacteria 1592
631 Ga0496100_0187533 3300048903 Bacteria 1499
632 Ga0496100_1213480 3300048903 Unclassified 595
633 Ga0496101_0248024 3300048904 Bacteria 1387
634 Ga0496101_0334505 3300048904 Bacteria 1189
635 Ga0496101_0431821 3300048904 Bacteria 1039
636 Ga0496101_0857472 3300048904 Unclassified 716
637 Ga0496102_0343818 3300048905 Bacteria 1405
638 Ga0496102_0492777 3300048905 Bacteria 1147
639 Ga0496103_0383508 3300048906 Bacteria 903
640 Ga0496103_0837420 3300048906 Unclassified 579
641 Ga0496104_0026297 3300048907 Bacteria 5371
642 Ga0496105_0300906 3300048908 Bacteria 1289
643 Ga0496106_0044168 3300048909 Bacteria 3344
644 Ga0496106_0209825 3300048909 Bacteria 1551
645 Ga0496106_0917663 3300048909 Bacteria 691
646 Ga0496107_0001484 3300048910 Bacteria 14522
647 Ga0496108_0002177 3300048911 Bacteria 15720
648 Ga0496108_1151848 3300048911 Bacteria 657
649 Ga0496109_0005018 3300048912 Bacteria 11055
650 Ga0496109_0602451 3300048912 Bacteria 1035
651 Ga0496110_0109530 3300048913 Bacteria 2480
652 Ga0496111_0255779 3300048914 Bacteria 1299
653 Ga0496112_0009102 3300048915 Bacteria 8924
654 Ga0496112_1704043 3300048915 Unclassified 543
655 Ga0496113_0599771 3300048916 Bacteria 882
656 Ga0496114_0182476 3300048917 Bacteria 1833
657 Ga0496115_1065008 3300048918 Unclassified 615
658 Ga0496116_0223012 3300048919 Bacteria 964
659 Ga0496118_0018409 3300048921 Bacteria 6305
660 Ga0496118_0400105 3300048921 Bacteria 714
661 Ga0496119_0218304 3300048922 Bacteria 977
662 Ga0496120_0179367 3300048923 Unclassified 1041
663 Ga0496121_0017290 3300048924 Bacteria 7378
664 Ga0496121_0047672 3300048924 Bacteria 3653
665 Ga0496121_0068475 3300048924 Bacteria 2871
666 Ga0496121_0068672 3300048924 Bacteria 2865
667 Ga0496121_0111407 3300048924 Bacteria 2087
668 Ga0496121_0178831 3300048924 Bacteria 1533
669 Ga0496121_0506014 3300048924 Unclassified 765
670 Ga0496121_0885532 3300048924 Bacteria 515
671 Ga0496122_0401472 3300048925 Bacteria 696
672 Ga0496124_0371590 3300048927 Bacteria 1003
673 Ga0496125_0059062 3300048928 Bacteria 3093
674 Ga0496125_0277516 3300048928 Bacteria 1040
675 Ga0496125_0554160 3300048928 Bacteria 636
676 Ga0496125_0771461 3300048928 Bacteria 501
677 Ga0496126_0021943 3300048929 Bacteria 6226
678 Ga0496126_0030092 3300048929 Bacteria 5150
679 Ga0496126_0069025 3300048929 Bacteria 3154
680 Ga0496126_0082089 3300048929 Bacteria 2849
681 Ga0496126_0092931 3300048929 Bacteria 2649
682 Ga0496126_0116265 3300048929 Bacteria 2325
683 Ga0496126_0282898 3300048929 Unclassified 1373
684 Ga0495678_025798 3300049459 Bacteria 2519
685 Ga0495682_0193137 3300049460 Bacteria 722
686 Ga0501047_0665359 3300049581 Bacteria 860
687 Ga0501047_1440840 3300049581 Bacteria 504
688 nmdc:mga03n38_900992_c1 3300050490 Bacteria 520
689 nmdc:mga0yw44_118560_c1 3300050492 Bacteria 1703
690 nmdc:mga0yw44_512267_c1 3300050492 Bacteria 814
691 nmdc:mga0k408_422235_c1 3300050493 Bacteria 793
692 nmdc:mga06z11_334393_c1 3300050494 Bacteria 905
693 nmdc:mga06z11_722357_c1 3300050494 Bacteria 607
694 nmdc:mga07m45_87084_c1 3300050496 Bacteria 1787
695 nmdc:mga08y16_707015_c1 3300050511 Bacteria 1007
696 nmdc:mga0n895_1049787_c1 3300050512 Bacteria 794
697 nmdc:mga08x19_543095_c1 3300050514 Bacteria 822
698 Ga0495601_0050709 3300053077 Bacteria 2618
699 Ga0495612_0039645 3300053078 Bacteria 1916
700 Ga0500635_0005164 3300053080 Bacteria 3405
701 Ga0500635_0158052 3300053080 Unclassified 868
702 Ga0495619_0409235 3300053085 Bacteria 936
703 Ga0500578_0426673 3300053086 Bacteria 759
704 Ga0500578_0767900 3300053086 Bacteria 512
705 Ga0500646_0209931 3300053090 Bacteria 671
706 Ga0500566_0002830 3300053094 Bacteria 10327
707 Ga0500640_007584 3300053095 Bacteria 4235
708 Ga0500648_294449 3300053097 Bacteria 718
709 Ga0500650_0287292 3300053098 Bacteria 730
710 Ga0500554_000457 3300053102 Bacteria 8572
711 Ga0500557_000021 3300053105 Bacteria 89662
712 Ga0500562_003788 3300053108 Bacteria 3805
713 Ga0500572_015323 3300053111 Bacteria 1932
714 Ga0500582_011759 3300053114 Bacteria 2191
715 Ga0500591_184193 3300053115 Bacteria 750
716 Ga0500592_022440 3300053116 Bacteria 1018
717 Ga0500595_006813 3300053119 Bacteria 4808
718 Ga0500597_191564 3300053120 Unclassified 863
719 Ga0500608_073190 3300053122 Bacteria 1627
720 Ga0500614_022306 3300053123 Bacteria 1477
721 Ga0500617_258952 3300053124 Bacteria 582
722 Ga0500621_306247 3300053126 Bacteria 506
723 Ga0500642_0000297 3300053130 Bacteria 17974
724 Ga0500642_0312041 3300053130 Bacteria 707
725 Ga0500658_0090302 3300053134 Bacteria 1323
726 Ga0500559_0007528 3300053136 Bacteria 4817
727 Ga0500561_0031862 3300053137 Bacteria 1335
728 Ga0500561_0239044 3300053137 Bacteria 577
729 Ga0500568_0259401 3300053139 Bacteria 632
730 Ga0500573_0048646 3300053140 Bacteria 2440
731 Ga0500577_0113337 3300053142 Bacteria 1121
732 Ga0500585_121573 3300053144 Bacteria 930
733 Ga0500589_219343 3300053147 Bacteria 717
734 Ga0500603_000474 3300053150 Bacteria 10282
735 Ga0500603_001144 3300053150 Bacteria 6207
736 Ga0500603_203559 3300053150 Bacteria 628
737 Ga0500619_168970 3300053154 Bacteria 741
738 Ga0500619_186666 3300053154 Bacteria 699
739 Ga0500627_0025734 3300053158 Bacteria 2421
740 Ga0500630_006129 3300053159 Bacteria 5881
741 Ga0500633_0203572 3300053160 Bacteria 741
742 Ga0500634_0054659 3300053161 Bacteria 2138
743 Ga0500638_094716 3300053162 Bacteria 1401
744 Ga0500638_155786 3300053162 Bacteria 1011
745 Ga0500638_166774 3300053162 Bacteria 963
746 Ga0500639_032099 3300053163 Bacteria 2777
747 Ga0500636_0066089 3300053177 Bacteria 2103
748 Ga0500636_0132742 3300053177 Bacteria 1385
749 Ga0500636_0290641 3300053177 Bacteria 810
750 Ga0500636_0297423 3300053177 Bacteria 797
751 Ga0500636_0545563 3300053177 Bacteria 503
752 Ga0500637_0003627 3300053178 Bacteria 7177
753 Ga0500637_0044483 3300053178 Bacteria 2515
754 Ga0500637_0200537 3300053178 Bacteria 1136
755 Ga0500637_0298905 3300053178 Bacteria 879
756 Ga0500625_017782 3300053729 Bacteria 3325
757 Ga0500596_002532 3300053735 Bacteria 3595
758 Ga0500596_011304 3300053735 Bacteria 1366
759 Ga0466962_0330534 3300061719 Bacteria 757
760 Ga0496100_0727771
761 rootH1_10118508
762 JGI25161J50226_1022908
763 JGI25404J52841_10001219
764 JGI25404J52841_10028440
765 Ga0055543_1003365
766 Ga0065165_1001246
767 Ga0065165_1005270
768 Ga0070676_10087817
769 Ga0070690_100247345
770 Ga0068869_100452159
771 Ga0070680_100019755
772 Ga0070680_100154146
773 Ga0070680_100157713
774 Ga0070682_100661730
775 Ga0070660_100604708
776 Ga0070689_100117778
777 Ga0070687_100064512
778 Ga0070668_100723069
779 Ga0070669_100356463
780 Ga0070673_100700830
781 Ga0070688_100771857
782 Ga0070659_100260163
783 Ga0070659_100903050
784 Ga0070709_10010781
785 Ga0070709_10046677
786 Ga0070714_100124794
787 Ga0070714_101230179
788 Ga0070713_100562493
789 Ga0070710_10096867
790 Ga0070710_10420143
791 Ga0070710_10710720
792 Ga0070701_10380991
793 Ga0070711_100002422
794 Ga0070711_101999591
795 Ga0070705_100309995
796 Ga0070663_100006269
797 Ga0070663_100101608
798 Ga0070663_100497776
799 Ga0070663_101301090
800 Ga0070663_102131380
801 Ga0070678_100646210
802 Ga0070678_101796542
803 Ga0070678_101982019
804 Ga0070662_100141848
805 Ga0070681_10047013
806 Ga0070681_10052433
807 Ga0070681_10346938
808 Ga0068867_100016234
809 Ga0070679_100126998
810 Ga0070679_100211430
811 Ga0070679_100252190
812 Ga0070679_100360816
813 Ga0070684_100036719
814 Ga0070684_100819427
815 Ga0070684_101327779
816 Ga0070697_101470189
817 Ga0068853_100160297
818 Ga0068853_100862866
819 Ga0070672_100258375
820 Ga0070686_100108169
821 Ga0070695_100687050
822 Ga0070696_101268765
823 Ga0070693_100836509
824 Ga0070665_100091209
825 Ga0070665_100469448
826 Ga0070665_101211651
827 Ga0070704_100137955
828 Ga0068855_100612969
829 Ga0068855_101172366
830 Ga0068855_101922383
831 Ga0068857_100125351
832 Ga0068857_100716557
833 Ga0068857_100813726
834 Ga0068857_101013376
835 Ga0068854_100202615
836 Ga0068854_100405868
837 Ga0068854_101298994
838 Ga0068854_101816566
839 Ga0068856_100135579
840 Ga0068856_100618770
841 Ga0070702_100104694
842 Ga0070702_100329830
843 Ga0068852_101468760
844 Ga0068852_101501993
845 Ga0068859_100352394
846 Ga0068859_100386192
847 Ga0068866_10016546
848 Ga0068861_100120440
849 Ga0068851_10595898
850 Ga0068870_10185282
851 Ga0068863_102583121
852 Ga0068858_100057085
853 Ga0068858_100275785
854 Ga0068858_100538826
855 Ga0068858_100547095
856 Ga0068858_101282850
857 Ga0068860_100004484
858 Ga0068860_100209678
859 Ga0068862_100365636
860 Ga0068862_100385378
861 Ga0068862_101618823
862 Ga0081455_10025237
863 Ga0081540_1005771
864 Ga0081540_1017880
865 Ga0081540_1066140
866 Ga0081540_1078001
867 Ga0081540_1350833
868 Ga0070717_11871741
869 Ga0075365_10024421
870 Ga0075365_10236955
871 Ga0075368_10413934
872 Ga0075363_100484721
873 Ga0075363_100643676
874 Ga0075363_100859831
875 Ga0075432_10124356
876 Ga0070715_10045033
877 Ga0070716_100188972
878 Ga0070716_100782827
879 Ga0070712_100012301
880 Ga0070712_101175379
881 Ga0075367_10184646
882 Ga0075367_10602776
883 Ga0075369_10558226
884 Ga0075366_10454327
885 Ga0075366_10859173
886 Ga0097621_100341523
887 Ga0097621_100491424
888 Ga0075370_10295398
889 Ga0068871_100097830
890 Ga0068871_101974604
891 Ga0075434_100191078
892 Ga0075434_101970561
893 Ga0068865_100381663
894 Ga0097620_100352368
895 Ga0097620_100386227
896 Ga0099794_10063628
897 Ga0099795_10032211
898 Ga0099795_10082499
899 Ga0099795_10435486
900 Ga0105250_10151856
901 Ga0105240_10014678
902 Ga0105240_10088393
903 Ga0105240_10167610
904 Ga0105240_10537437
905 Ga0105240_11133817
906 Ga0111539_10098642
907 Ga0105245_10298711
908 Ga0105247_10005821
909 Ga0105247_10057132
910 Ga0105247_10095751
911 Ga0105247_11247407
912 Ga0105243_10045957
913 Ga0105241_10604359
914 Ga0105241_11943749
915 Ga0105242_10301326
916 Ga0105248_10183392
917 Ga0105248_10889913
918 Ga0105237_10013759
919 Ga0105237_10072896
920 Ga0105237_10133259
921 Ga0105237_10218505
922 Ga0105237_10381884
923 Ga0105237_12104226
924 Ga0105237_12688675
925 Ga0105238_10103344
926 Ga0105238_10809543
927 Ga0105249_10110649
928 Ga0105249_10433548
929 Ga0099796_10014472
930 Ga0099796_10036705
931 Ga0105239_10082187
932 Ga0105239_10412395
933 Ga0157342_1062604
934 Ga0157327_1061328
935 Ga0157370_10269079
936 Ga0157370_10298933
937 Ga0157370_10648825
938 Ga0157370_10894723
939 Ga0157370_11688068
940 Ga0157369_10008602
941 Ga0157369_10014694
942 Ga0157369_10019848
943 Ga0157369_11807540
944 Ga0157374_10483795
945 Ga0157378_10220155
946 Ga0163162_10053853
947 Ga0157372_10023670
948 Ga0157372_10131560
949 Ga0157372_10254644
950 Ga0157375_10170119
951 Ga0157375_10937614
952 Ga0157375_12138388
953 Ga0157380_10434120
954 Ga0157380_10453246
955 Ga0157380_11419626
956 Ga0182008_10182475
957 Ga0157379_10031372
958 Ga0157379_10547398
959 Ga0157379_11084706
960 Ga0157379_12031325
961 Ga0157376_10807703
962 Ga0163161_10042414
963 Ga0206355_1450230
964 Ga0206354_10102221
965 Ga0206353_11453605
966 Ga0206353_11955534
967 Ga0213872_10229735
968 Ga0213874_10186309
969 Ga0213876_10080991
970 Ga0213876_10200779
971 Ga0213876_10268145
972 Ga0213876_10426588
973 Ga0213875_10019022
974 Ga0213875_10279175
975 Ga0213871_10002781
976 Ga0209677_108298
977 Ga0209233_1000721
978 Ga0209233_1014721
979 Ga0209455_1015897
980 Ga0209758_1034174
981 Ga0207426_1000704
982 Ga0207692_10097612
983 Ga0207692_10359248
984 Ga0207692_10438243
985 Ga0207642_10025256
986 Ga0207710_10016828
987 Ga0207710_10090253
988 Ga0207710_10422543
989 Ga0207688_10230279
990 Ga0207680_10748807
991 Ga0207647_10460004
992 Ga0207685_10308601
993 Ga0207699_10188434
994 Ga0207699_10496458
995 Ga0207699_11133408
996 Ga0207645_10091515
997 Ga0207643_11075393
998 Ga0207684_10141438
999 Ga0207684_10265339
1000 Ga0207707_10003515
1001 Ga0207707_10382790
1002 Ga0207707_10571603
1003 Ga0207695_10018858
1004 Ga0207695_10090969
1005 Ga0207695_10150416
1006 Ga0207695_10162914
1007 Ga0207695_10165533
1008 Ga0207695_11580583
1009 Ga0207671_10110752
1010 Ga0207671_10249652
1011 Ga0207671_10425198
1012 Ga0207671_10464291
1013 Ga0207671_10802720
1014 Ga0207693_10005063
1015 Ga0207663_10465320
1016 Ga0207660_10084028
1017 Ga0207660_10092065
1018 Ga0207660_11568248
1019 Ga0207662_10151861
1020 Ga0207657_10331558
1021 Ga0207649_10809574
1022 Ga0207649_11052568
1023 Ga0207652_10036673
1024 Ga0207652_10121022
1025 Ga0207652_10200432
1026 Ga0207652_11006797
1027 Ga0207646_10199533
1028 Ga0207681_10661932
1029 Ga0207694_10457021
1030 Ga0207694_11051057
1031 Ga0207687_10046904
1032 Ga0207700_11426434
1033 Ga0207664_10539623
1034 Ga0207690_10278045
1035 Ga0207690_10781404
1036 Ga0207706_10030998
1037 Ga0207686_10079143
1038 Ga0207669_10062945
1039 Ga0207704_10067872
1040 Ga0207665_10233677
1041 Ga0207665_10265214
1042 Ga0207691_10100013
1043 Ga0207711_11012771
1044 Ga0207711_11409201
1045 Ga0207661_10009090
1046 Ga0207661_10205475
1047 Ga0207667_11345284
1048 Ga0207667_11939502
1049 Ga0207651_10549714
1050 Ga0207712_10514807
1051 Ga0207712_11109410
1052 Ga0207668_10222861
1053 Ga0207640_10130089
1054 Ga0207640_10234404
1055 Ga0207640_11595431
1056 Ga0207658_10705576
1057 Ga0207703_10201963
1058 Ga0207703_10997835
1059 Ga0207639_10095611
1060 Ga0207639_10364827
1061 Ga0207678_10021511
1062 Ga0207678_10086117
1063 Ga0207678_10165386
1064 Ga0207678_10638719
1065 Ga0207708_10136428
1066 Ga0207708_10362230
1067 Ga0207702_10552820
1068 Ga0207702_10640425
1069 Ga0207641_10889823
1070 Ga0207641_11767444
1071 Ga0207641_11780747
1072 Ga0207648_10017435
1073 Ga0207674_10062523
1074 Ga0207674_10250802
1075 Ga0207674_11365079
1076 Ga0207674_11760811
1077 Ga0207675_100119127
1078 Ga0207675_101118542
1079 Ga0207683_10054583
1080 Ga0207698_11763355
1081 Ga0209179_1001824
1082 Ga0209588_1027908
1083 Ga0209588_1124993
1084 Ga0207428_10334670
1085 Ga0268266_10145100
1086 Ga0268266_10677850
1087 Ga0268266_11075503
1088 Ga0268265_10024481
1089 Ga0268265_10656090
1090 Ga0268265_11724512
1091 Ga0268264_10003164
1092 Ga0268264_10159675
1093 Ga0265337_1036764
1094 Ga0265326_10015606
1095 Ga0265319_1003993
1096 Ga0265334_10005962
1097 Ga0265318_10234234
1098 Ga0265323_10001188
1099 Ga0265322_10009292
1100 Ga0265336_10001614
1101 Ga0307515_10104978
1102 Ga0265338_10001385
1103 Ga0265338_10438758
1104 Ga0265324_10002403
1105 Ga0307511_10208961
1106 Ga0307511_10262274
1107 Ga0265332_10306051
1108 Ga0265340_10046709
1109 Ga0265339_10004557
1110 Ga0265316_10115930
1111 Ga0307509_10274717
1112 Ga0307509_10518236
1113 Ga0307509_10526402
1114 Ga0307509_10862318
1115 Ga0307408_101586619
1116 Ga0307408_101663621
1117 Ga0307508_10000045
1118 Ga0307516_10330158
1119 Ga0307405_11902002
1120 Ga0307412_10421560
1121 Ga0307416_100776067
1122 Ga0307415_100014064
1123 Ga0307507_10390889
1124 Ga0307507_10441860
1125 Ga0307510_10317448
1126 Ga0316215_1000809
1127 Ga0373928_0074040
1128 Ga0373934_0064140
1129 Ga0373944_0088161
1130 Ga0373923_0002702
1131 Ga0373936_0003487
1132 Ga0373936_0015380
1133 Ga0373945_0017657
1134 Ga0373953_0044814
1135 Ga0373954_0007733
1136 Ga0373954_0237893
1137 Ga0373956_0067739
1138 Ga0373957_0080028
1139 Ga0373943_0000777
1140 Ga0373946_0019368
1141 Ga0373946_0175983
1142 Ga0373955_0132012
1143 Ga0373924_0036249
1144 Ga0373931_0736124
1145 Ga0373935_0000251
1146 Ga0373927_0016017
1147 Ga0373927_0371812
1148 Ga0373933_0071933
1149 Ga0373933_0385974
1150 Ga0373947_0001064
1151 Ga0373947_0036761
1152 Ga0373937_0024219
1153 Ga0373937_0099439
1154 Ga0373925_0017451
1155 Ga0373925_0099338
1156 Ga0373925_0378563
1157 Ga0373925_0676596
1158 Ga0395899_0216040
1159 Ga0395900_0014168
1160 Ga0395900_0053627
1161 Ga0395900_0139732
1162 Ga0395900_0289225
1163 Ga0395898_0010728
1164 Ga0395898_0040548
1165 Ga0395898_0445874
1166 Ga0436364_0104458
1167 Ga0436364_0106660
1168 Ga0395901_0013276
1169 Ga0395901_0215830
1170 Ga0436365_0379190
1171 Ga0436365_1063195
1172 Ga0436365_1275870
1173 Ga0436365_1282324
1174 Ga0436365_1300568
1175 Ga0436365_1301706
1176 Ga0436365_1502295
1177 Ga0436365_1736230
1178 Ga0436360_0621178
1179 Ga0436360_0876912
1180 Ga0436361_0132309
1181 Ga0436361_0561305
1182 Ga0436363_0292064
1183 Ga0436363_0697524
1184 Ga0436363_0888890
1185 Ga0436362_0209959
1186 Ga0451795_0245446
1187 Ga0451798_0406431
1188 Ga0451807_0038421
1189 Ga0451835_0316067
1190 Ga0451835_0898454
1191 Ga0451843_0287902
1192 Ga0466966_0930215
1193 Ga0466961_0953807
1194 Ga0466963_0049865
1195 Ga0466964_0044669
1196 Ga0466971_0023290
1197 Ga0466968_0126931
1198 Ga0466970_0202215
1199 Ga0466970_0390873
1200 Ga0466970_0577535
1201 Ga0466957_0014799
1202 Ga0466957_0077629
1203 Ga0466957_0111752
1204 Ga0466957_0688358
1205 Ga0466960_0079279
1206 Ga0466959_0007007
1207 Ga0466959_0087099
1208 Ga0466959_0130260
1209 Ga0466958_0067977
1210 Ga0466967_0042113
1211 Ga0466967_0208739
1212 Ga0466967_0824411
1213 Ga0466967_2257570
1214 Ga0495617_139834
1215 Ga0495617_188665
1216 Ga0495592_0012453
1217 Ga0495592_0032116
1218 Ga0495603_0000208
1219 Ga0495603_0018490
1220 Ga0495603_0034607
1221 Ga0495603_0069852
1222 Ga0495603_0142584
1223 Ga0495603_0259005
1224 Ga0495590_0044795
1225 Ga0495629_0047749
1226 Ga0495629_0303389
1227 Ga0495638_0145404
1228 Ga0495641_0001151
1229 Ga0495651_0678675
1230 Ga0495653_0331617
1231 Ga0495580_0003553
1232 Ga0495580_0011112
1233 Ga0495580_0565004
1234 Ga0495582_0000311
1235 Ga0495582_0046181
1236 Ga0495582_0251823
1237 Ga0495605_0035595
1238 Ga0495605_0166729
1239 Ga0495639_0011186
1240 Ga0495639_0034493
1241 Ga0495639_0123582
1242 Ga0495639_0190801
1243 Ga0495662_0000259
1244 Ga0495664_0014045
1245 Ga0495664_0076715
1246 Ga0495664_0269175
1247 Ga0495664_0946136
1248 Ga0495584_0486293
1249 Ga0495584_0528052
1250 Ga0495585_0023670
1251 Ga0495585_0037287
1252 Ga0495585_0205779
1253 Ga0495594_0000272
1254 Ga0495594_0633719
1255 Ga0495596_0016393
1256 Ga0495596_0040268
1257 Ga0495596_0213235
1258 Ga0495607_0505659
1259 Ga0495583_0037600
1260 Ga0495583_0249600
1261 Ga0495606_0079854
1262 Ga0495606_0266306
1263 Ga0495606_0656236
1264 Ga0495608_0434224
1265 Ga0495610_0028007
1266 Ga0495616_0022343
1267 Ga0495616_0435785
1268 Ga0495618_0038832
1269 Ga0495620_0124066
1270 Ga0495628_0015355
1271 Ga0495630_0000820
1272 Ga0495630_0426183
1273 Ga0495631_0091008
1274 Ga0495631_0172380
1275 Ga0495631_0194520
1276 Ga0495632_0136121
1277 Ga0495632_0268608
1278 Ga0495643_0026084
1279 Ga0495644_0135805
1280 Ga0495644_0179464
1281 Ga0495648_0016237
1282 Ga0495663_0117724
1283 Ga0495663_0153432
1284 Ga0495666_0020413
1285 Ga0495666_0064479
1286 Ga0495666_0411766
1287 Ga0495666_0498051
1288 Ga0495642_0208921
1289 Ga0495652_0151944
1290 Ga0495652_0289985
1291 Ga0495654_0057570
1292 Ga0495665_0006478
1293 Ga0495665_0144912
1294 Ga0495640_0029803
1295 Ga0495640_0036324
1296 Ga0495586_0192215
1297 Ga0495586_0673207
1298 Ga0495598_0009326
1299 Ga0495598_0042167
1300 Ga0495609_0313607
1301 Ga0495621_0021073
1302 Ga0495597_0083017
1303 Ga0495645_0009962
1304 Ga0495622_0003774
1305 Ga0495622_0367736
1306 Ga0495633_0023664
1307 Ga0495633_0311024
1308 Ga0495633_0358387
1309 Ga0495667_0018312
1310 Ga0495667_0513937
1311 Ga0495656_0010750
1312 Ga0495656_0067645
1313 Ga0495656_0083654
1314 Ga0495656_0581425
1315 Ga0495668_0064871
1316 Ga0495668_0275039
1317 Ga0495668_0433090
1318 Ga0495634_0001816
1319 Ga0495611_0208585
1320 Ga0495625_0238246
1321 Ga0495625_0675890
1322 Ga0495635_0000392
1323 Ga0495635_0067725
1324 Ga0495635_0242518
1325 Ga0495659_0005588
1326 Ga0495659_0016225
1327 Ga0495661_0348965
1328 Ga0495588_0051562
1329 Ga0495588_0299612
1330 Ga0495657_0217672
1331 Ga0495657_0697029
1332 Ga0495657_0906496
1333 Ga0495599_0053300
1334 Ga0495599_0063739
1335 Ga0495599_0186802
1336 Ga0495599_0403193
1337 Ga0495646_0007901
1338 Ga0495646_0189967
1339 Ga0495646_0491356
1340 Ga0495647_0002503
1341 Ga0495658_0001021
1342 Ga0495658_0035960
1343 Ga0495658_1125962
1344 Ga0495669_0012390
1345 Ga0495669_0015228
1346 Ga0495669_0314401
1347 Ga0495613_0090285
1348 Ga0495613_0140689
1349 Ga0495624_0005116
1350 Ga0495624_0029396
1351 Ga0495624_0383983
1352 Ga0495670_0018072
1353 Ga0495649_0024865
1354 Ga0495649_0238002
1355 Ga0495589_0089557
1356 Ga0495600_0408497
1357 Ga0495600_0824315
1358 Ga0495660_0266304
1359 Ga0495581_0009954
1360 Ga0495581_0017134
1361 Ga0495581_0135336
1362 Ga0495581_0526409
1363 Ga0495604_0062069
1364 Ga0495604_0328856
1365 Ga0495636_0280244
1366 Ga0495674_0001216
1367 Ga0495674_0087078
1368 Ga0495674_0141532
1369 Ga0495676_0013658
1370 Ga0495676_0097574
1371 Ga0495676_0319737
1372 Ga0495676_0869562
1373 Ga0495683_0061750
1374 Ga0495683_0190488
1375 Ga0495677_0059401
1376 Ga0495677_0099508
1377 Ga0495679_022094
1378 Ga0495685_137772
1379 Ga0495673_0067513
1380 Ga0495681_0188925
1381 Ga0495684_0008730
1382 Ga0495684_0066760
1383 Ga0495686_0124549
1384 Ga0495593_0005423
1385 Ga0495593_0029156
1386 Ga0495593_0297592
1387 Ga0495593_0651421
1388 Ga0495614_0118004
1389 Ga0495626_0069040
1390 Ga0496100_0187533
1391 Ga0496100_1213480
1392 Ga0496101_0248024
1393 Ga0496101_0334505
1394 Ga0496101_0431821
1395 Ga0496101_0857472
1396 Ga0496102_0343818
1397 Ga0496102_0492777
1398 Ga0496103_0383508
1399 Ga0496103_0837420
1400 Ga0496104_0026297
1401 Ga0496105_0300906
1402 Ga0496106_0044168
1403 Ga0496106_0209825
1404 Ga0496106_0917663
1405 Ga0496107_0001484
1406 Ga0496108_0002177
1407 Ga0496108_1151848
1408 Ga0496109_0005018
1409 Ga0496109_0602451
1410 Ga0496110_0109530
1411 Ga0496111_0255779
1412 Ga0496112_0009102
1413 Ga0496112_1704043
1414 Ga0496113_0599771
1415 Ga0496114_0182476
1416 Ga0496115_1065008
1417 Ga0496116_0223012
1418 Ga0496118_0018409
1419 Ga0496118_0400105
1420 Ga0496119_0218304
1421 Ga0496120_0179367
1422 Ga0496121_0017290
1423 Ga0496121_0047672
1424 Ga0496121_0068475
1425 Ga0496121_0068672
1426 Ga0496121_0111407
1427 Ga0496121_0178831
1428 Ga0496121_0506014
1429 Ga0496121_0885532
1430 Ga0496122_0401472
1431 Ga0496124_0371590
1432 Ga0496125_0059062
1433 Ga0496125_0277516
1434 Ga0496125_0554160
1435 Ga0496125_0771461
1436 Ga0496126_0021943
1437 Ga0496126_0030092
1438 Ga0496126_0069025
1439 Ga0496126_0082089
1440 Ga0496126_0092931
1441 Ga0496126_0116265
1442 Ga0496126_0282898
1443 Ga0495678_025798
1444 Ga0495682_0193137
1445 Ga0501047_0665359
1446 Ga0501047_1440840
1447 nmdc:mga03n38_900992_c1
1448 nmdc:mga0yw44_118560_c1
1449 nmdc:mga0yw44_512267_c1
1450 nmdc:mga0k408_422235_c1
1451 nmdc:mga06z11_334393_c1
1452 nmdc:mga06z11_722357_c1
1453 nmdc:mga07m45_87084_c1
1454 nmdc:mga08y16_707015_c1
1455 nmdc:mga0n895_1049787_c1
1456 nmdc:mga08x19_543095_c1
1457 Ga0495601_0050709
1458 Ga0495612_0039645
1459 Ga0500635_0005164
1460 Ga0500635_0158052
1461 Ga0495619_0409235
1462 Ga0500578_0426673
1463 Ga0500578_0767900
1464 Ga0500646_0209931
1465 Ga0500566_0002830
1466 Ga0500640_007584
1467 Ga0500648_294449
1468 Ga0500650_0287292
1469 Ga0500554_000457
1470 Ga0500557_000021
1471 Ga0500562_003788
1472 Ga0500572_015323
1473 Ga0500582_011759
1474 Ga0500591_184193
1475 Ga0500592_022440
1476 Ga0500595_006813
1477 Ga0500597_191564
1478 Ga0500608_073190
1479 Ga0500614_022306
1480 Ga0500617_258952
1481 Ga0500621_306247
1482 Ga0500642_0000297
1483 Ga0500642_0312041
1484 Ga0500658_0090302
1485 Ga0500559_0007528
1486 Ga0500561_0031862
1487 Ga0500561_0239044
1488 Ga0500568_0259401
1489 Ga0500573_0048646
1490 Ga0500577_0113337
1491 Ga0500585_121573
1492 Ga0500589_219343
1493 Ga0500603_000474
1494 Ga0500603_001144
1495 Ga0500603_203559
1496 Ga0500619_168970
1497 Ga0500619_186666
1498 Ga0500627_0025734
1499 Ga0500630_006129
1500 Ga0500633_0203572
1501 Ga0500634_0054659
1502 Ga0500638_094716
1503 Ga0500638_155786
1504 Ga0500638_166774
1505 Ga0500639_032099
1506 Ga0500636_0066089
1507 Ga0500636_0132742
1508 Ga0500636_0290641
1509 Ga0500636_0297423
1510 Ga0500636_0545563
1511 Ga0500637_0003627
1512 Ga0500637_0044483
1513 Ga0500637_0200537
1514 Ga0500637_0298905
1515 Ga0500625_017782
1516 Ga0500596_002532
1517 Ga0500596_011304
1518 Ga0466962_0330534

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7u8f-assembly1.cif.gz_A ternary complex structure of cereblon-ddb1 bound to ikzf2(zf2) and the molecular glue dky709 0.7329 2 58
8u17-assembly2.cif.gz_D the ternary complex structure of ddb1-crbn-sall4(zf1,2)-long bound to pomalidomide 0.7317 2 54
8u15-assembly1.cif.gz_A the ternary complex structure of ddb1-crbn-sall4(zf1,2)-short bound to cc-220 0.7232 2 54
8u17-assembly1.cif.gz_A the ternary complex structure of ddb1-crbn-sall4(zf1,2)-long bound to pomalidomide 0.7225 2 54
8u15-assembly2.cif.gz_D the ternary complex structure of ddb1-crbn-sall4(zf1,2)-short bound to cc-220 0.7209 2 54
ID Description Score Start End Superfamily
4uk6001 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.6992 1 60 3.30.1370.30
af_Q09769_157_269_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.6945 2 60 2.30.130.40
1i6uB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.6404 3 57 3.30.1370.30
af_Q57681_367_434_3.30.720.200 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.6353 8 35 3.30.720.200
af_A0A2R8QU21_218_302_2.30.30.190 Mainly Beta;Roll;SH3 type barrels.;CAP Gly-rich-like domain 0.5991 22 47 2.30.30.190
ID Description Score Start End GO Terms
AF-H5Y8R2-F1-model_v4 Uncharacterized protein 0.9183 2 59
AF-A0A382MYD8-F1-model_v4 Uncharacterized protein 0.907 10 46
AF-A0A1H2AF39-F1-model_v4 Transposase 0.9063 1 63
AF-A0A1H2AF39-F1-model_v4 Transposase 0.8801 1 63
AF-Q13D35-F1-model_v4 Uncharacterized protein 0.8512 2 63

Map