F479478

General Info

Members Datasets Scaffolds Average Seq Length
759 374 744 262

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100378318|Ga0070712_1003783181
Length 311
Sequence MLAERFVAASLGSGPLHAAGMLAAGSAFPGRCSRPSLAPNAIAGISMRKDFERAYVTAHDNVAVLTLNHPEVMNAASVKMIRGLYAALDHIEKPDSGFRVVVMTGEGRGFCSGANLSEVPDEGASLGGVGSALDTAYHPFLRRLRDLRMPLVTAVNGAAAGVGMSMALMGDLVLAARSAYFLQAFARIGLVPDGGSTWLLPRLIGLARAKELSLLAEKLPSERALEWGLINRVVDDGALMDEALSLARRLAQGPTQSYALIRRLYWESPHNSYDEQLDLERQSQGKAGRTEDFIEGVTAFQQKRPAQFKGK

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
7 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
8 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
11 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
12 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
13 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
14 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
15 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
107 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
228 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
246 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
247 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
248 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
249 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
267 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
268 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
272 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
353 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
354 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
355 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
356 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
357 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
358 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
359 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
360 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
361 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
362 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
363 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
368 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
369 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.4
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 13.31
Nodule 0.26
Rhizoplane 2.37
Rhizosphere 78.92
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1005543 3300002073 Bacteria 1380
2 JGI24749J21850_1000704 3300002076 Bacteria 4809
3 JGI25150J39212_1001047 3300002774 Bacteria 8444
4 JGI25153J46596_10000007 3300003215 Bacteria 377573
5 JGI25153J46596_10000535 3300003215 Bacteria 23843
6 rootH2_10093086 3300003320 Bacteria 1498
7 Ga0055526_1001270 3300003771 Bacteria 18096
8 Ga0055526_1054591 3300003771 Bacteria 886
9 Ga0055536_1007529 3300003781 Bacteria 4851
10 Ga0055536_1031355 3300003781 Bacteria 1393
11 Ga0055534_1015751 3300003784 Bacteria 1375
12 Ga0055530_10000174 3300003791 Bacteria 58795
13 Ga0055530_10000411 3300003791 Bacteria 38127
14 Ga0055530_10011110 3300003791 Bacteria 3262
15 Ga0055540_1000884 3300003792 Bacteria 19850
16 Ga0055531_10001746 3300003794 Bacteria 15529
17 Ga0055531_10014294 3300003794 Bacteria 3584
18 Ga0065165_1008527 3300005262 Bacteria 4770
19 Ga0065707_10082179 3300005295 Bacteria 20162
20 Ga0070658_10045870 3300005327 Bacteria 3535
21 Ga0070676_10423015 3300005328 Bacteria 931
22 Ga0070690_100027745 3300005330 Bacteria 3502
23 Ga0070670_100088543 3300005331 Bacteria 2661
24 Ga0068869_100002460 3300005334 Bacteria 11170
25 Ga0070666_10001920 3300005335 Bacteria 12642
26 Ga0070666_10008011 3300005335 Bacteria 6535
27 Ga0070666_10026179 3300005335 Bacteria 3808
28 Ga0070666_10028389 3300005335 Bacteria 3671
29 Ga0070680_100000110 3300005336 Bacteria 47139
30 Ga0070680_100048217 3300005336 Bacteria 3471
31 Ga0070680_100100450 3300005336 Bacteria 2401
32 Ga0070680_100277283 3300005336 Bacteria 1420
33 Ga0070680_100556418 3300005336 Bacteria 983
34 Ga0068868_100000389 3300005338 Bacteria 29905
35 Ga0070660_100016809 3300005339 Bacteria 5321
36 Ga0070660_100455384 3300005339 Bacteria 1062
37 Ga0070689_100017445 3300005340 Bacteria 5273
38 Ga0070689_100035411 3300005340 Bacteria 3815
39 Ga0070689_100063768 3300005340 Bacteria 2867
40 Ga0070691_10001038 3300005341 Bacteria 11428
41 Ga0070691_10010668 3300005341 Bacteria 4196
42 Ga0070691_10022777 3300005341 Bacteria 2907
43 Ga0070691_10163248 3300005341 Bacteria 1150
44 Ga0070661_100000148 3300005344 Bacteria 57465
45 Ga0070668_100000089 3300005347 Bacteria 56897
46 Ga0070668_100002202 3300005347 Bacteria 14308
47 Ga0070668_100007157 3300005347 Bacteria 8272
48 Ga0070668_100073886 3300005347 Bacteria 2659
49 Ga0070669_100003790 3300005353 Bacteria 10920
50 Ga0070669_100513250 3300005353 Unclassified 995
51 Ga0070671_100001555 3300005355 Bacteria 17272
52 Ga0070674_100000125 3300005356 Bacteria 35199
53 Ga0070674_100027141 3300005356 Bacteria 3749
54 Ga0070688_100005716 3300005365 Bacteria 6574
55 Ga0070659_100037928 3300005366 Bacteria 3757
56 Ga0070659_100258406 3300005366 Bacteria 1445
57 Ga0070659_100480189 3300005366 Bacteria 1057
58 Ga0070667_100000081 3300005367 Bacteria 118819
59 Ga0070667_100002070 3300005367 Bacteria 17750
60 Ga0070667_100040279 3300005367 Bacteria 3917
61 Ga0070667_100114032 3300005367 Bacteria 2346
62 Ga0070667_100234157 3300005367 Bacteria 1638
63 Ga0070667_100327458 3300005367 Unclassified 1383
64 Ga0070667_100593947 3300005367 Bacteria 1020
65 Ga0070709_10001050 3300005434 Bacteria 15238
66 Ga0070709_10112514 3300005434 Bacteria 1832
67 Ga0070714_100019518 3300005435 Bacteria 5525
68 Ga0070714_100087620 3300005435 Bacteria 2723
69 Ga0070714_100331190 3300005435 Bacteria 1426
70 Ga0070714_100345800 3300005435 Bacteria 1396
71 Ga0070713_100000004 3300005436 Bacteria 220768
72 Ga0070713_100090194 3300005436 Bacteria 2635
73 Ga0070713_100144620 3300005436 Bacteria 2109
74 Ga0070710_10000998 3300005437 Bacteria 13476
75 Ga0070710_10094523 3300005437 Bacteria 1769
76 Ga0070710_10313797 3300005437 Bacteria 1027
77 Ga0070711_100000244 3300005439 Bacteria 27954
78 Ga0070711_100006293 3300005439 Bacteria 7148
79 Ga0070711_100051210 3300005439 Bacteria 2834
80 Ga0070711_100061692 3300005439 Bacteria 2611
81 Ga0070700_100000508 3300005441 Bacteria 19367
82 Ga0070700_100333272 3300005441 Bacteria 1119
83 Ga0070694_100044937 3300005444 Bacteria 2958
84 Ga0070663_100046764 3300005455 Bacteria 3063
85 Ga0070663_100061540 3300005455 Bacteria 2704
86 Ga0070678_100001179 3300005456 Bacteria 13874
87 Ga0070662_100057950 3300005457 Bacteria 2816
88 Ga0070681_10000001 3300005458 Bacteria 946857
89 Ga0070681_10220409 3300005458 Bacteria 1812
90 Ga0068867_100000535 3300005459 Bacteria 25035
91 Ga0070685_10041332 3300005466 Bacteria 2626
92 Ga0070707_100313669 3300005468 Unclassified 1524
93 Ga0070707_100549924 3300005468 Bacteria 1117
94 Ga0070698_100096571 3300005471 Bacteria 2932
95 Ga0070679_100000032 3300005530 Bacteria 105384
96 Ga0070679_100018143 3300005530 Bacteria 6823
97 Ga0070684_100206949 3300005535 Bacteria 1788
98 Ga0068853_100001204 3300005539 Bacteria 18449
99 Ga0068853_100001519 3300005539 Bacteria 16875
100 Ga0068853_100044850 3300005539 Bacteria 3786
101 Ga0068853_100426163 3300005539 Bacteria 1245
102 Ga0070686_100145603 3300005544 Bacteria 1654
103 Ga0070695_100056560 3300005545 Bacteria 2532
104 Ga0070695_100116187 3300005545 Bacteria 1824
105 Ga0070695_100138448 3300005545 Bacteria 1685
106 Ga0070695_100143869 3300005545 Bacteria 1657
107 Ga0070695_100456704 3300005545 Bacteria 980
108 Ga0070696_100001935 3300005546 Bacteria 13647
109 Ga0070696_100048911 3300005546 Bacteria 2936
110 Ga0070696_100121391 3300005546 Bacteria 1892
111 Ga0070696_100132184 3300005546 Bacteria 1817
112 Ga0070693_100030645 3300005547 Bacteria 2942
113 Ga0070693_100152422 3300005547 Bacteria 1465
114 Ga0070665_100081373 3300005548 Bacteria 3244
115 Ga0070704_100000174 3300005549 Bacteria 25726
116 Ga0070704_100130674 3300005549 Bacteria 1946
117 Ga0068855_100012015 3300005563 Bacteria 10468
118 Ga0068855_100018471 3300005563 Bacteria 8380
119 Ga0068855_100080830 3300005563 Bacteria 3769
120 Ga0068855_100174079 3300005563 Bacteria 2436
121 Ga0068855_100326846 3300005563 Bacteria 1694
122 Ga0068854_100021666 3300005578 Bacteria 4363
123 Ga0068854_100051117 3300005578 Bacteria 2960
124 Ga0068854_100111245 3300005578 Bacteria 2066
125 Ga0068856_100000144 3300005614 Bacteria 72020
126 Ga0068856_100036083 3300005614 Bacteria 4847
127 Ga0068856_100386733 3300005614 Unclassified 1419
128 Ga0068852_100005341 3300005616 Bacteria 9173
129 Ga0068852_100006688 3300005616 Bacteria 8356
130 Ga0068859_100000801 3300005617 Bacteria 31888
131 Ga0068859_100039771 3300005617 Plasmid 4719
132 Ga0068864_100003647 3300005618 Bacteria 12727
133 Ga0068864_100020321 3300005618 Bacteria 5555
134 Ga0068864_100160901 3300005618 Unclassified 2041
135 Ga0068866_10007585 3300005718 Bacteria 4548
136 Ga0068866_10246645 3300005718 Bacteria 1090
137 Ga0068861_100001120 3300005719 Bacteria 16617
138 Ga0068861_100001216 3300005719 Bacteria 16031
139 Ga0068863_100000099 3300005841 Bacteria 94076
140 Ga0068863_100031803 3300005841 Bacteria 5034
141 Ga0068858_100000432 3300005842 Bacteria 43614
142 Ga0068858_100001869 3300005842 Bacteria 21484
143 Ga0068858_100025449 3300005842 Bacteria 5506
144 Ga0068858_100139765 3300005842 Bacteria 2273
145 Ga0068860_100000743 3300005843 Bacteria 37175
146 Ga0068860_100002902 3300005843 Bacteria 17750
147 Ga0068860_100009295 3300005843 Bacteria 9767
148 Ga0068860_100391869 3300005843 Bacteria 1373
149 Ga0068862_100001026 3300005844 Bacteria 26891
150 Ga0068862_100002243 3300005844 Bacteria 17318
151 Ga0068862_100031511 3300005844 Bacteria 4477
152 Ga0068862_100092132 3300005844 Bacteria 2641
153 Ga0068862_100170500 3300005844 Bacteria 1948
154 Ga0068862_100562130 3300005844 Bacteria 1091
155 Ga0081455_10001531 3300005937 Bacteria 28476
156 Ga0081455_10071738 3300005937 Bacteria 2869
157 Ga0081538_10072604 3300005981 Bacteria 1885
158 Ga0070717_10000965 3300006028 Bacteria 19195
159 Ga0075368_10000095 3300006042 Bacteria 22249
160 Ga0075363_100000751 3300006048 Bacteria 11082
161 Ga0075363_100002626 3300006048 Bacteria 7403
162 Ga0075363_100004933 3300006048 Bacteria 5900
163 Ga0075364_10003024 3300006051 Bacteria 9499
164 Ga0075364_10045967 3300006051 Bacteria 2842
165 Ga0070715_10018541 3300006163 Bacteria 2653
166 Ga0070715_10103781 3300006163 Bacteria 1330
167 Ga0070715_10145784 3300006163 Bacteria 1155
168 Ga0070716_100004418 3300006173 Bacteria 6723
169 Ga0070716_100012336 3300006173 Bacteria 4329
170 Ga0070716_100013940 3300006173 Bacteria 4109
171 Ga0070712_100000293 3300006175 Bacteria 28103
172 Ga0070712_100000567 3300006175 Bacteria 21500
173 Ga0070712_100001412 3300006175 Bacteria 14596
174 Ga0070712_100034871 3300006175 Bacteria 3412
175 Ga0070712_100378318 3300006175 Bacteria 1165
176 Ga0075362_10000114 3300006177 Bacteria 22522
177 Ga0075362_10000265 3300006177 Bacteria 14605
178 Ga0075362_10029599 3300006177 Bacteria 2361
179 Ga0075367_10003384 3300006178 Bacteria 7594
180 Ga0075369_10001348 3300006186 Bacteria 8343
181 Ga0075369_10003423 3300006186 Bacteria 5776
182 Ga0075366_10000415 3300006195 Bacteria 19942
183 Ga0075370_10000048 3300006353 Bacteria 36696
184 Ga0075370_10001563 3300006353 Bacteria 10048
185 Ga0075370_10017171 3300006353 Bacteria 3906
186 Ga0075370_10037022 3300006353 Bacteria 2743
187 Ga0075428_100021051 3300006844 Bacteria 7222
188 Ga0075430_100010789 3300006846 Bacteria 7741
189 Ga0075431_100071733 3300006847 Bacteria 3574
190 Ga0075433_10002091 3300006852 Bacteria 15112
191 Ga0075433_10147527 3300006852 Bacteria 2091
192 Ga0075434_100014637 3300006871 Bacteria 7503
193 Ga0075434_100029766 3300006871 Bacteria 5374
194 Ga0075434_100466078 3300006871 Bacteria 1285
195 Ga0075434_100560615 3300006871 Bacteria 1162
196 Ga0068865_100000524 3300006881 Bacteria 21450
197 Ga0068865_100033278 3300006881 Bacteria 3450
198 Ga0075436_100000574 3300006914 Bacteria 24043
199 Ga0075436_100018816 3300006914 Bacteria 4730
200 Ga0097620_100000801 3300006931 Bacteria 31888
201 Ga0097620_100039774 3300006931 Plasmid 4719
202 Ga0079104_1021103 3300006946 Bacteria 1779
203 Ga0075435_100143759 3300007076 Bacteria 2003
204 Ga0075435_100229506 3300007076 Bacteria 1577
205 Ga0105240_10006228 3300009093 Bacteria 17548
206 Ga0105240_10013961 3300009093 Bacteria 10996
207 Ga0105240_10036213 3300009093 Bacteria 6350
208 Ga0105240_10174368 3300009093 Bacteria 2543
209 Ga0105240_10828420 3300009093 Bacteria 1000
210 Ga0111539_10004799 3300009094 Bacteria 17631
211 Ga0111539_10159233 3300009094 Bacteria 2641
212 Ga0111539_10653894 3300009094 Bacteria 1224
213 Ga0105245_10000805 3300009098 Bacteria 28521
214 Ga0105247_10000806 3300009101 Bacteria 23917
215 Ga0105247_10032949 3300009101 Bacteria 3149
216 Ga0114129_10024084 3300009147 Bacteria 8626
217 Ga0114129_10177528 3300009147 Bacteria 2900
218 Ga0114129_11227502 3300009147 Bacteria 932
219 Ga0105243_10000892 3300009148 Bacteria 28107
220 Ga0105243_10158865 3300009148 Bacteria 1947
221 Ga0105241_10035178 3300009174 Bacteria 3768
222 Ga0105241_10048218 3300009174 Bacteria 3241
223 Ga0105241_10057050 3300009174 Bacteria 2995
224 Ga0105242_10000906 3300009176 Bacteria 23034
225 Ga0105248_10000005 3300009177 Bacteria 673111
226 Ga0105248_10003309 3300009177 Bacteria 17885
227 Ga0105248_10062045 3300009177 Bacteria 4198
228 Ga0105248_10238795 3300009177 Unclassified 2046
229 Ga0105248_10607108 3300009177 Bacteria 1234
230 Ga0105248_10773013 3300009177 Bacteria 1084
231 Ga0105237_10017309 3300009545 Bacteria 7473
232 Ga0105237_10033645 3300009545 Bacteria 5194
233 Ga0105237_10161873 3300009545 Bacteria 2236
234 Ga0105237_10454853 3300009545 Bacteria 1286
235 Ga0105238_10000847 3300009551 Bacteria 31513
236 Ga0105238_10006764 3300009551 Bacteria 11456
237 Ga0105238_10013382 3300009551 Bacteria 8281
238 Ga0105238_10228957 3300009551 Bacteria 1836
239 Ga0105238_10372514 3300009551 Bacteria 1418
240 Ga0105238_10521210 3300009551 Bacteria 1191
241 Ga0105238_10525531 3300009551 Bacteria 1186
242 Ga0105249_10002484 3300009553 Bacteria 15975
243 Ga0105249_10011618 3300009553 Bacteria 7740
244 Ga0105249_10016052 3300009553 Bacteria 6637
245 Ga0105249_10189334 3300009553 Bacteria 2007
246 Ga0105239_10005268 3300010375 Bacteria 15205
247 Ga0105239_10006709 3300010375 Bacteria 13295
248 Ga0105239_10157411 3300010375 Bacteria 2538
249 Ga0105239_10196186 3300010375 Bacteria 2261
250 Ga0105246_10142649 3300011119 Bacteria 1803
251 Ga0157371_10001910 3300013102 Bacteria 20840
252 Ga0157371_10059879 3300013102 Bacteria 2700
253 Ga0157370_10006919 3300013104 Bacteria 12398
254 Ga0157370_10013933 3300013104 Bacteria 8256
255 Ga0157370_10022363 3300013104 Bacteria 6291
256 Ga0157369_10010560 3300013105 Bacteria 10508
257 Ga0157374_10149026 3300013296 Bacteria 2274
258 Ga0157378_10002708 3300013297 Bacteria 15786
259 Ga0157378_10130928 3300013297 Bacteria 2322
260 Ga0163162_10001291 3300013306 Bacteria 23417
261 Ga0163162_10088265 3300013306 Bacteria 3181
262 Ga0163162_10432924 3300013306 Bacteria 1447
263 Ga0157372_10004635 3300013307 Bacteria 14606
264 Ga0157372_10011558 3300013307 Bacteria 9392
265 Ga0157372_10044607 3300013307 Bacteria 4914
266 Ga0157372_10095779 3300013307 Bacteria 3382
267 Ga0157372_10283496 3300013307 Bacteria 1926
268 Ga0157375_10000618 3300013308 Bacteria 31552
269 Ga0157375_10495819 3300013308 Bacteria 1386
270 Ga0157380_10000346 3300014326 Bacteria 27776
271 Ga0157380_10001643 3300014326 Bacteria 14727
272 Ga0157380_10204038 3300014326 Bacteria 1756
273 Ga0157379_10004376 3300014968 Bacteria 12087
274 Ga0157379_10004513 3300014968 Bacteria 11942
275 Ga0157379_10020130 3300014968 Bacteria 5898
276 Ga0157379_10022857 3300014968 Bacteria 5542
277 Ga0157379_10053671 3300014968 Bacteria 3601
278 Ga0157379_10737004 3300014968 Bacteria 927
279 Ga0157376_10129405 3300014969 Bacteria 2250
280 Ga0163161_10000599 3300017792 Bacteria 28842
281 Ga0197907_10260788 3300020069 Bacteria 925
282 Ga0206350_11054501 3300020080 Bacteria 868
283 Ga0213876_10000201 3300021384 Bacteria 61091
284 Ga0213876_10026630 3300021384 Bacteria 3050
285 Ga0213876_10038055 3300021384 Bacteria 2538
286 Ga0213875_10000228 3300021388 Bacteria 56927
287 Ga0224712_10002545 3300022467 Bacteria 4525
288 Ga0207425_1000094 3300025245 Bacteria 85629
289 Ga0209026_1003810 3300025250 Bacteria 4765
290 Ga0209129_1017796 3300025258 Bacteria 1383
291 Ga0209565_1000386 3300025263 Bacteria 37364
292 Ga0209675_1000025 3300025291 Bacteria 294102
293 Ga0209676_1000084 3300025292 Bacteria 274330
294 Ga0209676_1000259 3300025292 Bacteria 111746
295 Ga0209676_1000678 3300025292 Bacteria 48300
296 Ga0209676_1011926 3300025292 Bacteria 3460
297 Ga0209025_1000727 3300025294 Bacteria 55857
298 Ga0209025_1010159 3300025294 Bacteria 6422
299 Ga0209025_1090805 3300025294 Bacteria 999
300 Ga0209564_1002114 3300025295 Bacteria 16891
301 Ga0209564_1015689 3300025295 Bacteria 3064
302 Ga0209758_1000002 3300025297 Bacteria 1400310
303 Ga0209758_1000017 3300025297 Bacteria 754393
304 Ga0209758_1000108 3300025297 Bacteria 216541
305 Ga0209050_1000104 3300025298 Bacteria 228921
306 Ga0209050_1000342 3300025298 Bacteria 92644
307 Ga0209050_1001308 3300025298 Bacteria 27984
308 Ga0209050_1017052 3300025298 Bacteria 2925
309 Ga0207426_1023307 3300025302 Bacteria 2113
310 Ga0209051_1000226 3300025303 Bacteria 94990
311 Ga0209257_1000120 3300025304 Bacteria 223025
312 Ga0209257_1000174 3300025304 Bacteria 165255
313 Ga0209257_1007904 3300025304 Bacteria 6251
314 Ga0209257_1011412 3300025304 Bacteria 4280
315 Ga0207692_10017950 3300025898 Bacteria 3166
316 Ga0207692_10091624 3300025898 Bacteria 1650
317 Ga0207692_10103439 3300025898 Bacteria 1568
318 Ga0207642_10003369 3300025899 Bacteria 5036
319 Ga0207710_10002182 3300025900 Bacteria 9199
320 Ga0207688_10000382 3300025901 Bacteria 20691
321 Ga0207680_10005625 3300025903 Bacteria 5999
322 Ga0207680_10008005 3300025903 Bacteria 5175
323 Ga0207685_10165699 3300025905 Bacteria 1013
324 Ga0207699_10000181 3300025906 Bacteria 38302
325 Ga0207645_10317893 3300025907 Bacteria 1038
326 Ga0207705_10000391 3300025909 Bacteria 38775
327 Ga0207654_10031910 3300025911 Bacteria 2905
328 Ga0207654_10041310 3300025911 Bacteria 2603
329 Ga0207654_10275834 3300025911 Bacteria 1136
330 Ga0207707_10000001 3300025912 Bacteria 1212482
331 Ga0207707_10008623 3300025912 Bacteria 8843
332 Ga0207695_10010920 3300025913 Bacteria 11046
333 Ga0207695_10106753 3300025913 Bacteria 2786
334 Ga0207695_10140690 3300025913 Bacteria 2362
335 Ga0207671_10034656 3300025914 Bacteria 3750
336 Ga0207671_10115634 3300025914 Bacteria 2045
337 Ga0207693_10000163 3300025915 Bacteria 59871
338 Ga0207693_10001225 3300025915 Bacteria 22880
339 Ga0207693_10001655 3300025915 Bacteria 19649
340 Ga0207693_10001708 3300025915 Bacteria 19323
341 Ga0207693_10295073 3300025915 Bacteria 1270
342 Ga0207663_10002421 3300025916 Bacteria 8959
343 Ga0207663_10011131 3300025916 Bacteria 4818
344 Ga0207663_10023145 3300025916 Bacteria 3561
345 Ga0207660_10001819 3300025917 Bacteria 14214
346 Ga0207660_10008613 3300025917 Bacteria 6598
347 Ga0207660_10041404 3300025917 Bacteria 3228
348 Ga0207657_10001337 3300025919 Bacteria 26203
349 Ga0207657_10380975 3300025919 Bacteria 1111
350 Ga0207649_10000153 3300025920 Bacteria 56646
351 Ga0207652_10000419 3300025921 Bacteria 44102
352 Ga0207652_10019708 3300025921 Bacteria 5549
353 Ga0207652_10021313 3300025921 Bacteria 5349
354 Ga0207652_10024819 3300025921 Bacteria 4975
355 Ga0207646_10113189 3300025922 Bacteria 2436
356 Ga0207646_10275399 3300025922 Unclassified 1521
357 Ga0207681_10005139 3300025923 Bacteria 8039
358 Ga0207681_10032420 3300025923 Bacteria 3420
359 Ga0207681_10054823 3300025923 Bacteria 2712
360 Ga0207694_10025854 3300025924 Bacteria 4464
361 Ga0207694_10055978 3300025924 Bacteria 3063
362 Ga0207694_10217882 3300025924 Bacteria 1556
363 Ga0207694_10255815 3300025924 Bacteria 1434
364 Ga0207694_10258647 3300025924 Bacteria 1426
365 Ga0207650_10004495 3300025925 Bacteria 9536
366 Ga0207687_10001234 3300025927 Bacteria 17530
367 Ga0207687_10423169 3300025927 Bacteria 1099
368 Ga0207700_10000011 3300025928 Bacteria 266323
369 Ga0207700_10011148 3300025928 Bacteria 5718
370 Ga0207700_10092102 3300025928 Unclassified 2396
371 Ga0207664_10033147 3300025929 Bacteria 3966
372 Ga0207664_10037985 3300025929 Bacteria 3731
373 Ga0207664_10592225 3300025929 Unclassified 996
374 Ga0207644_10001453 3300025931 Bacteria 15277
375 Ga0207690_10032885 3300025932 Bacteria 3331
376 Ga0207690_10125202 3300025932 Bacteria 1873
377 Ga0207706_10007698 3300025933 Bacteria 9945
378 Ga0207709_10003516 3300025935 Bacteria 9272
379 Ga0207670_10263526 3300025936 Bacteria 1337
380 Ga0207669_10002869 3300025937 Bacteria 7392
381 Ga0207669_10381462 3300025937 Bacteria 1098
382 Ga0207704_10001123 3300025938 Bacteria 11913
383 Ga0207704_10500972 3300025938 Bacteria 979
384 Ga0207665_10001338 3300025939 Bacteria 16617
385 Ga0207665_10017396 3300025939 Bacteria 4724
386 Ga0207665_10020902 3300025939 Bacteria 4302
387 Ga0207665_10270744 3300025939 Bacteria 1261
388 Ga0207711_10000002 3300025941 Bacteria 1228676
389 Ga0207711_10029196 3300025941 Bacteria 4648
390 Ga0207711_10184860 3300025941 Bacteria 1897
391 Ga0207711_10649117 3300025941 Bacteria 984
392 Ga0207689_10006263 3300025942 Bacteria 10546
393 Ga0207667_10011191 3300025949 Bacteria 10442
394 Ga0207667_10076783 3300025949 Bacteria 3466
395 Ga0207667_10167552 3300025949 Bacteria 2258
396 Ga0207712_10008147 3300025961 Bacteria 6630
397 Ga0207712_10017694 3300025961 Bacteria 4633
398 Ga0207712_10030366 3300025961 Bacteria 3633
399 Ga0207668_10000051 3300025972 Bacteria 98624
400 Ga0207668_10000287 3300025972 Bacteria 33118
401 Ga0207668_10065194 3300025972 Bacteria 2577
402 Ga0207640_10241577 3300025981 Unclassified 1396
403 Ga0207658_10000062 3300025986 Bacteria 118845
404 Ga0207658_10001520 3300025986 Bacteria 18016
405 Ga0207658_10005225 3300025986 Bacteria 8930
406 Ga0207658_10200619 3300025986 Bacteria 1665
407 Ga0207677_10003876 3300026023 Bacteria 7965
408 Ga0207703_10001408 3300026035 Bacteria 21917
409 Ga0207703_10006894 3300026035 Bacteria 9043
410 Ga0207703_10088875 3300026035 Bacteria 2594
411 Ga0207703_10446531 3300026035 Bacteria 1207
412 Ga0207639_10065428 3300026041 Bacteria 2822
413 Ga0207639_10157364 3300026041 Bacteria 1910
414 Ga0207678_10031842 3300026067 Bacteria 4598
415 Ga0207678_10047504 3300026067 Bacteria 3712
416 Ga0207708_10001666 3300026075 Bacteria 16496
417 Ga0207708_10022507 3300026075 Bacteria 4760
418 Ga0207702_10000226 3300026078 Bacteria 65919
419 Ga0207702_10025921 3300026078 Bacteria 4867
420 Ga0207641_10000014 3300026088 Bacteria 336170
421 Ga0207641_10000857 3300026088 Bacteria 32190
422 Ga0207641_10024890 3300026088 Bacteria 4934
423 Ga0207648_10000503 3300026089 Bacteria 43631
424 Ga0207648_10315454 3300026089 Bacteria 1404
425 Ga0207676_10002576 3300026095 Bacteria 12935
426 Ga0207674_10000330 3300026116 Bacteria 60515
427 Ga0207674_10032897 3300026116 Bacteria 5435
428 Ga0207675_100000419 3300026118 Bacteria 41020
429 Ga0207675_100002220 3300026118 Bacteria 19294
430 Ga0207675_100152325 3300026118 Bacteria 2201
431 Ga0207683_10000386 3300026121 Bacteria 40766
432 Ga0207683_10008028 3300026121 Bacteria 9024
433 Ga0207698_10024355 3300026142 Bacteria 4247
434 Ga0209281_1014127 3300027111 Bacteria 1698
435 Ga0209813_10000013 3300027866 Bacteria 89768
436 Ga0207428_10073233 3300027907 Bacteria 2688
437 Ga0268266_10100381 3300028379 Bacteria 2549
438 Ga0268265_10001738 3300028380 Bacteria 17521
439 Ga0268265_10002139 3300028380 Bacteria 15330
440 Ga0268265_10095239 3300028380 Unclassified 2390
441 Ga0268265_10148374 3300028380 Bacteria 1974
442 Ga0268265_10280687 3300028380 Bacteria 1490
443 Ga0268265_10544287 3300028380 Bacteria 1101
444 Ga0268264_10001483 3300028381 Bacteria 21901
445 Ga0268264_10002766 3300028381 Bacteria 15302
446 Ga0268264_10012308 3300028381 Bacteria 7041
447 Ga0268264_10295208 3300028381 Bacteria 1523
448 Ga0265338_10000005 3300028800 Bacteria 571137
449 Ga0265338_10008211 3300028800 Bacteria 12716
450 Ga0265338_10018931 3300028800 Bacteria 7340
451 Ga0265338_10143061 3300028800 Bacteria 1870
452 Ga0265332_10075042 3300031238 Bacteria 1438
453 Ga0265332_10105667 3300031238 Unclassified 1187
454 Ga0265320_10004251 3300031240 Bacteria 9407
455 Ga0265325_10000005 3300031241 Bacteria 321343
456 Ga0265325_10000098 3300031241 Bacteria 61384
457 Ga0265325_10003316 3300031241 Bacteria 10584
458 Ga0265325_10005575 3300031241 Bacteria 7764
459 Ga0265340_10005438 3300031247 Bacteria 7073
460 Ga0265340_10034886 3300031247 Bacteria 2500
461 Ga0265340_10112087 3300031247 Bacteria 1260
462 Ga0265339_10001877 3300031249 Bacteria 15427
463 Ga0265339_10002558 3300031249 Bacteria 12972
464 Ga0265339_10002598 3300031249 Bacteria 12887
465 Ga0265339_10006756 3300031249 Bacteria 7488
466 Ga0265339_10012302 3300031249 Bacteria 5228
467 Ga0265339_10023687 3300031249 Bacteria 3547
468 Ga0265339_10038996 3300031249 Bacteria 2647
469 Ga0265339_10164828 3300031249 Bacteria 1113
470 Ga0265331_10000003 3300031250 Bacteria 499358
471 Ga0265331_10000793 3300031250 Bacteria 26281
472 Ga0265331_10012945 3300031250 Bacteria 4497
473 Ga0265327_10000187 3300031251 Bacteria 131135
474 Ga0265316_10197283 3300031344 Bacteria 1493
475 Ga0265313_10010486 3300031595 Bacteria 5850
476 Ga0265313_10014393 3300031595 Bacteria 4676
477 Ga0265313_10033370 3300031595 Bacteria 2616
478 Ga0265314_10000125 3300031711 Bacteria 118671
479 Ga0265314_10000835 3300031711 Bacteria 36433
480 Ga0265314_10012124 3300031711 Bacteria 7060
481 Ga0265314_10047873 3300031711 Bacteria 3005
482 Ga0265314_10117820 3300031711 Bacteria 1677
483 Ga0265314_10118251 3300031711 Bacteria 1673
484 Ga0265314_10169539 3300031711 Bacteria 1319
485 Ga0265342_10012164 3300031712 Bacteria 5838
486 Ga0265342_10076101 3300031712 Bacteria 1946
487 Ga0307412_10055008 3300031911 Bacteria 2645
488 Ga0307412_10075526 3300031911 Bacteria 2312
489 Ga0307414_10003389 3300032004 Bacteria 8514
490 Ga0307414_10013889 3300032004 Bacteria 4809
491 Ga0307414_10062012 3300032004 Bacteria 2651
492 Ga0373944_0091004 3300035089 Bacteria 1020
493 Ga0373939_0085129 3300035114 Bacteria 1058
494 Ga0373941_0064335 3300035115 Bacteria 1202
495 Ga0373946_0022552 3300035171 Bacteria 2452
496 Ga0373955_0022124 3300035172 Bacteria 3221
497 Ga0373955_0069437 3300035172 Bacteria 1966
498 Ga0316574_0003926 3300035398 Bacteria 7731
499 Ga0373931_0105078 3300035691 Bacteria 1594
500 Ga0373935_0069528 3300035692 Bacteria 2268
501 Ga0373927_0053577 3300035695 Bacteria 2610
502 Ga0373947_0008391 3300035725 Bacteria 5952
503 Ga0373947_0130056 3300035725 Bacteria 1607
504 Ga0373937_0098051 3300036401 Bacteria 2718
505 Ga0373937_0258748 3300036401 Bacteria 1641
506 Ga0373937_0568685 3300036401 Unclassified 1077
507 Ga0316584_0212852 3300036712 Bacteria 1422
508 Ga0373925_0025017 3300037068 Bacteria 4360
509 Ga0373925_0037097 3300037068 Bacteria 3597
510 Ga0395898_0079034 3300037466 Bacteria 3173
511 Ga0395898_0306029 3300037466 Bacteria 1516
512 Ga0436364_1065372 3300037853 Bacteria 196587
513 Ga0395901_0060755 3300038443 Bacteria 3933
514 Ga0395901_0226672 3300038443 Bacteria 1952
515 Ga0395901_0227683 3300038443 Bacteria 1947
516 Ga0400483_101908 3300039062 Unclassified 2819
517 Ga0436365_1053930 3300039437 Bacteria 3063
518 Ga0436365_1073490 3300039437 Bacteria 73987
519 Ga0436365_1469416 3300039437 Bacteria 2064
520 Ga0436365_1818233 3300039437 Bacteria 4064
521 Ga0436360_0153630 3300039438 Bacteria 863
522 Ga0436360_1001166 3300039438 Bacteria 1844
523 Ga0436363_0399751 3300039450 Bacteria 20052
524 Ga0436363_1233328 3300039450 Bacteria 1990
525 Ga0436363_1240126 3300039450 Bacteria 22314
526 Ga0439465_0031624 3300041413 Bacteria 1686
527 Ga0439442_008156 3300042002 Bacteria 2115
528 Ga0439445_0007199 3300042004 Bacteria 2576
529 Ga0450911_000116 3300042115 Bacteria 31956
530 Ga0439434_0043739 3300042435 Bacteria 1379
531 Ga0453684_0293163 3300044712 Bacteria 1852
532 Ga0451576_0054726 3300045051 Bacteria 4177
533 Ga0495592_0122821 3300046454 Bacteria 1825
534 Ga0495629_0144770 3300046459 Bacteria 1653
535 Ga0495638_0340360 3300046460 Bacteria 795
536 Ga0495650_0001660 3300046471 Bacteria 20561
537 Ga0495580_0012332 3300046472 Bacteria 6557
538 Ga0495596_0000486 3300046500 Bacteria 25196
539 Ga0495596_0004299 3300046500 Bacteria 6973
540 Ga0495607_0004616 3300046501 Bacteria 10082
541 Ga0495583_0039818 3300046506 Bacteria 2211
542 Ga0495606_0000078 3300046507 Bacteria 164950
543 Ga0495606_0012143 3300046507 Bacteria 6945
544 Ga0495610_0002681 3300046512 Bacteria 14677
545 Ga0495610_0004187 3300046512 Bacteria 10774
546 Ga0495632_0013411 3300046519 Bacteria 4678
547 Ga0495643_0000945 3300046522 Bacteria 30097
548 Ga0495643_0004994 3300046522 Bacteria 9093
549 Ga0495643_0011590 3300046522 Bacteria 5360
550 Ga0495643_0045127 3300046522 Bacteria 2393
551 Ga0495644_0063969 3300046523 Bacteria 1383
552 Ga0495648_0000748 3300046524 Bacteria 34717
553 Ga0495648_0033936 3300046524 Bacteria 3328
554 Ga0495654_0178714 3300046530 Bacteria 920
555 Ga0495598_0019749 3300046537 Bacteria 1771
556 Ga0495609_0002362 3300046538 Bacteria 11646
557 Ga0495621_0015587 3300046539 Bacteria 2426
558 Ga0495645_0080018 3300046543 Bacteria 2346
559 Ga0495633_0085839 3300046558 Bacteria 1464
560 Ga0495668_0000001 3300046616 Bacteria 1013420
561 Ga0495625_0001920 3300046660 Bacteria 23504
562 Ga0495625_0008059 3300046660 Bacteria 9034
563 Ga0495625_0055036 3300046660 Bacteria 2839
564 Ga0495659_0002623 3300046664 Bacteria 5800
565 Ga0495658_0010226 3300046683 Bacteria 4691
566 Ga0495613_0243307 3300046689 Bacteria 1257
567 Ga0495604_0243972 3300047317 Bacteria 1227
568 Ga0495604_0295417 3300047317 Bacteria 1090
569 Ga0495674_0164662 3300047319 Bacteria 1854
570 Ga0495672_0000462 3300047320 Bacteria 48028
571 Ga0495673_0000270 3300047469 Bacteria 71793
572 Ga0495684_0226731 3300047471 Bacteria 1368
573 Ga0495686_0263994 3300047472 Bacteria 963
574 Ga0495626_0004324 3300048091 Bacteria 8754
575 Ga0496100_0191174 3300048903 Bacteria 1486
576 Ga0496100_0310387 3300048903 Unclassified 1182
577 Ga0496101_0000975 3300048904 Bacteria 16910
578 Ga0496102_0008220 3300048905 Bacteria 8931
579 Ga0496102_0138570 3300048905 Bacteria 2280
580 Ga0496103_0001134 3300048906 Bacteria 18514
581 Ga0496103_0078443 3300048906 Bacteria 2074
582 Ga0496106_0000769 3300048909 Bacteria 23204
583 Ga0496107_0000672 3300048910 Bacteria 19397
584 Ga0496107_0188925 3300048910 Bacteria 1530
585 Ga0496108_0017612 3300048911 Bacteria 5845
586 Ga0496109_0077119 3300048912 Bacteria 3066
587 Ga0496112_0005828 3300048915 Bacteria 10724
588 Ga0496113_0097261 3300048916 Bacteria 2277
589 Ga0496114_0000486 3300048917 Bacteria 29134
590 Ga0496114_0052904 3300048917 Bacteria 3384
591 Ga0496115_0000286 3300048918 Bacteria 43642
592 Ga0496115_0003434 3300048918 Bacteria 11382
593 Ga0496116_0000039 3300048919 Bacteria 349134
594 Ga0496117_0075369 3300048920 Bacteria 2242
595 Ga0496118_0048034 3300048921 Bacteria 3302
596 Ga0496121_0000733 3300048924 Bacteria 60446
597 Ga0496121_0208333 3300048924 Bacteria 1387
598 Ga0496122_0001526 3300048925 Bacteria 36870
599 Ga0496123_0002207 3300048926 Bacteria 24751
600 Ga0496124_0004725 3300048927 Bacteria 15729
601 Ga0496124_0019477 3300048927 Bacteria 6314
602 Ga0496124_0021030 3300048927 Bacteria 6016
603 Ga0496124_0080489 3300048927 Bacteria 2680
604 Ga0496125_0004368 3300048928 Bacteria 16377
605 Ga0496126_0000041 3300048929 Bacteria 340389
606 Ga0496126_0000498 3300048929 Bacteria 77619
607 Ga0501032_0153860 3300049569 Bacteria 1511
608 Ga0501033_0098754 3300049570 Bacteria 2132
609 Ga0501033_0172391 3300049570 Bacteria 1553
610 Ga0501034_0079948 3300049571 Bacteria 3273
611 Ga0501034_0108480 3300049571 Bacteria 2767
612 Ga0501034_0147813 3300049571 Bacteria 2326
613 Ga0501034_0192076 3300049571 Bacteria 2004
614 Ga0501034_0271308 3300049571 Bacteria 1637
615 Ga0501036_0009156 3300049572 Bacteria 8141
616 Ga0501036_0077432 3300049572 Bacteria 2814
617 Ga0501036_0136834 3300049572 Bacteria 2067
618 Ga0501036_0261477 3300049572 Bacteria 1450
619 Ga0501037_0026713 3300049573 Bacteria 4266
620 Ga0501038_0029433 3300049574 Bacteria 4867
621 Ga0501038_0073917 3300049574 Bacteria 2885
622 Ga0501038_0181272 3300049574 Bacteria 1699
623 Ga0501038_0392377 3300049574 Bacteria 1075
624 Ga0501039_0005227 3300049575 Bacteria 9832
625 Ga0501039_0043147 3300049575 Bacteria 3484
626 Ga0501041_0031462 3300049577 Bacteria 3206
627 Ga0501041_0397138 3300049577 Bacteria 873
628 Ga0501042_0098487 3300049578 Bacteria 2102
629 Ga0501043_0010112 3300049579 Bacteria 7395
630 Ga0501043_0046386 3300049579 Bacteria 3417
631 Ga0501046_0287352 3300049580 Unclassified 1203
632 Ga0501046_0302524 3300049580 Bacteria 1168
633 Ga0501046_0356427 3300049580 Bacteria 1061
634 Ga0501047_0013767 3300049581 Bacteria 7682
635 Ga0501047_0166381 3300049581 Bacteria 2075
636 Ga0501047_0253401 3300049581 Bacteria 1608
637 Ga0501047_0268809 3300049581 Bacteria 1551
638 Ga0501047_0372523 3300049581 Bacteria 1263
639 Ga0501047_0492531 3300049581 Bacteria 1053
640 Ga0501048_0084229 3300049582 Bacteria 2242
641 Ga0501067_0000980 3300049583 Bacteria 15317
642 Ga0501067_0034861 3300049583 Bacteria 2793
643 Ga0501068_0059171 3300049584 Bacteria 2326
644 Ga0501068_0265698 3300049584 Bacteria 1095
645 Ga0501069_0005058 3300049585 Bacteria 6838
646 Ga0501069_0175942 3300049585 Bacteria 1236
647 Ga0501070_0000002 3300049586 Bacteria 347524
648 Ga0501070_0021858 3300049586 Bacteria 5360
649 Ga0501070_0038373 3300049586 Bacteria 3996
650 Ga0501070_0257677 3300049586 Bacteria 1426
651 Ga0501070_0267903 3300049586 Unclassified 1395
652 Ga0501072_0050053 3300049588 Bacteria 3289
653 Ga0501073_0400485 3300049589 Bacteria 948
654 Ga0501074_0082600 3300049590 Bacteria 2303
655 Ga0501074_0450056 3300049590 Bacteria 913
656 Ga0501075_0009709 3300049591 Bacteria 6744
657 Ga0501076_0009741 3300049592 Bacteria 7098
658 Ga0501077_0074383 3300049593 Bacteria 2152
659 Ga0501079_0016537 3300049741 Bacteria 5635
660 Ga0501079_0022801 3300049741 Bacteria 4805
661 Ga0501080_0003580 3300049742 Bacteria 13678
662 Ga0501080_0011904 3300049742 Bacteria 7968
663 Ga0501080_0052166 3300049742 Bacteria 3806
664 Ga0501080_0225354 3300049742 Bacteria 1714
665 Ga0501080_0907748 3300049742 Bacteria 767
666 Ga0501081_0000375 3300049743 Bacteria 24480
667 Ga0501083_0168217 3300049744 Bacteria 1433
668 Ga0501035_0010190 3300049822 Bacteria 8724
669 Ga0501035_0018850 3300049822 Bacteria 6358
670 Ga0501035_0076744 3300049822 Bacteria 2954
671 Ga0501035_0127922 3300049822 Bacteria 2216
672 Ga0501044_0000378 3300049823 Bacteria 55508
673 Ga0501044_0001291 3300049823 Bacteria 29606
674 Ga0501044_0014944 3300049823 Bacteria 8370
675 Ga0501044_0015636 3300049823 Bacteria 8173
676 Ga0501044_0029141 3300049823 Bacteria 5822
677 Ga0501044_0029793 3300049823 Bacteria 5754
678 Ga0501044_0099883 3300049823 Bacteria 2920
679 Ga0501044_0110803 3300049823 Bacteria 2753
680 Ga0501044_0254324 3300049823 Bacteria 1696
681 Ga0501045_0084013 3300049824 Bacteria 2349
682 nmdc:mga03683_17_c1 3300050489 Bacteria 91111
683 nmdc:mga03683_41_c1 3300050489 Bacteria 60927
684 nmdc:mga03n38_973_c1 3300050490 Bacteria 7791
685 nmdc:mga00v17_1323_c1 3300050491 Bacteria 12971
686 nmdc:mga00v17_37643_c1 3300050491 Bacteria 2890
687 nmdc:mga0yw44_23100_c1 3300050492 Bacteria 3500
688 nmdc:mga0yw44_66231_c1 3300050492 Bacteria 2229
689 nmdc:mga0k408_12_c1 3300050493 Bacteria 125427
690 nmdc:mga06z11_545_c1 3300050494 Bacteria 13835
691 nmdc:mga04h51_354_c1 3300050495 Bacteria 11356
692 nmdc:mga07m45_11_c1 3300050496 Bacteria 163532
693 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
694 nmdc:mga07m45_42597_c1 3300050496 Bacteria 2545
695 nmdc:mga07m45_6452_c1 3300050496 Bacteria 5929
696 nmdc:mga07m45_8999_c1 3300050496 Bacteria 5158
697 nmdc:mga05p37_14495_c2 3300050507 Bacteria 8751
698 nmdc:mga05p37_166992_c2 3300050507 Bacteria 1799
699 nmdc:mga0qj67_32207_c1 3300050509 Bacteria 4087
700 nmdc:mga06r32_93354_c1 3300050510 Bacteria 2943
701 nmdc:mga08y16_2749_c1 3300050511 Bacteria 18030
702 nmdc:mga08y16_524234_c1 3300050511 Bacteria 1201
703 nmdc:mga0n895_20772_c1 3300050512 Bacteria 6131
704 nmdc:mga0n895_377112_c1 3300050512 Bacteria 1435
705 nmdc:mga0n895_563969_c1 3300050512 Bacteria 1144
706 nmdc:mga0n895_700712_c1 3300050512 Bacteria 1009
707 nmdc:mga0n895_84254_c1 3300050512 Bacteria 3172
708 nmdc:mga0rr50_125378_c1 3300050513 Bacteria 2050
709 nmdc:mga0rr50_210970_c1 3300050513 Bacteria 1600
710 nmdc:mga08x19_129_c1 3300050514 Bacteria 66982
711 nmdc:mga0a205_82685_c1 3300050515 Bacteria 3102
712 nmdc:mga0sz30_188_c1 3300050516 Bacteria 22800
713 nmdc:mga0sz30_666_c2 3300050516 Bacteria 11850
714 Ga0500643_012667 3300053087 Bacteria 3012
715 Ga0500643_014174 3300053087 Bacteria 2782
716 Ga0500644_0000142 3300053088 Bacteria 44270
717 Ga0500555_031592 3300053103 Bacteria 1500
718 Ga0500562_000281 3300053108 Bacteria 12523
719 Ga0500592_005174 3300053116 Bacteria 2072
720 Ga0500593_045534 3300053117 Bacteria 1956
721 Ga0500595_001333 3300053119 Bacteria 13348
722 Ga0500595_038324 3300053119 Bacteria 1559
723 Ga0500597_004368 3300053120 Bacteria 4370
724 Ga0500607_000140 3300053121 Bacteria 60736
725 Ga0500607_000188 3300053121 Bacteria 55367
726 Ga0500559_0000722 3300053136 Bacteria 21736
727 Ga0500559_0000883 3300053136 Bacteria 19195
728 Ga0500564_000219 3300053138 Bacteria 15901
729 Ga0500568_0016977 3300053139 Bacteria 3222
730 Ga0500619_020944 3300053154 Bacteria 1876
731 Ga0500622_0002589 3300053156 Bacteria 12887
732 Ga0500624_000041 3300053157 Bacteria 90321
733 Ga0500627_0000149 3300053158 Bacteria 20586
734 Ga0500637_0000206 3300053178 Bacteria 21961
735 Ga0500637_0003008 3300053178 Bacteria 7651
736 Ga0500645_001749 3300053730 Bacteria 10535
737 Ga0500645_002540 3300053730 Bacteria 8057
738 Ga0501084_0000017 3300054114 Bacteria 148659
739 Ga0501084_0048106 3300054114 Bacteria 3571
740 Ga0501084_0067831 3300054114 Bacteria 2986
741 Ga0501084_0110200 3300054114 Bacteria 2313
742 Ga0500661_029894 3300055283 Bacteria 961
743 Ga0501082_0025498 3300060353 Bacteria 5094
744 Ga0466962_0230650 3300061719 Bacteria 908

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100170500 Ga0068862_1001705002 191
2 3300028380 Ga0268265_10148374 Ga0268265_101483742 191
3 3300028380 Ga0268265_10544287 Ga0268265_105442872 193
4 3300006051 Ga0075364_10003024 Ga0075364_100030244 194
5 3300006177 Ga0075362_10029599 Ga0075362_100295993 194
6 3300050491 nmdc:mga00v17_1323_c1 nmdc:mga00v17_1323_c1_6214_6996 194
7 3300050496 nmdc:mga07m45_42597_c1 nmdc:mga07m45_42597_c1_1219_2001 194
8 3300053117 Ga0500593_045534 Ga0500593_045534_600_1382 195
9 3300036712 Ga0316584_0212852 Ga0316584_0212852_707_1402 207
10 3300047317 Ga0495604_0243972 Ga0495604_0243972_14_712 209
11 3300049742 Ga0501080_0907748 Ga0501080_0907748_46_744 209
12 3300046530 Ga0495654_0178714 Ga0495654_0178714_21_731 213
13 3300039438 Ga0436360_0153630 Ga0436360_0153630_109_831 217
14 3300049577 Ga0501041_0397138 Ga0501041_0397138_141_860 217
15 3300006163 Ga0070715_10103781 Ga0070715_101037813 218
16 3300025905 Ga0207685_10165699 Ga0207685_101656991 218
17 3300025927 Ga0207687_10423169 Ga0207687_104231691 220
18 3300046460 Ga0495638_0340360 Ga0495638_0340360_49_777 220
19 3300025250 Ga0209026_1003810 Ga0209026_10038105 225
20 iso_pu_bacteria 2984555340 2984557168 226
21 iso_pu_bacteria 2993356040 2993359516 226
22 3300046523 Ga0495644_0063969 Ga0495644_0063969_187_987 227
23 3300046664 Ga0495659_0002623 Ga0495659_0002623_712_1512 227
24 3300005328 Ga0070676_10423015 Ga0070676_104230151 228
25 3300009177 Ga0105248_10607108 Ga0105248_106071081 228
26 3300009551 Ga0105238_10228957 Ga0105238_102289571 228
27 3300025924 Ga0207694_10258647 Ga0207694_102586473 228
28 3300026116 Ga0207674_10032897 Ga0207674_100328973 228
29 3300037466 Ga0395898_0079034 Ga0395898_0079034_1246_2001 228
30 3300038443 Ga0395901_0227683 Ga0395901_0227683_36_791 228
31 3300049572 Ga0501036_0261477 Ga0501036_0261477_12_767 228
32 3300042115 Ga0450911_000116 Ga0450911_000116_10067_11005 230
33 3300048927 Ga0496124_0019477 Ga0496124_0019477_3366_4142 230
34 iso_pu_bacteria 2928027323 2928031103 230
35 iso_pu_bacteria 2984564862 2984568465 230
36 3300013102 Ga0157371_10001910 Ga0157371_1000191010 231
37 3300003781 Ga0055536_1007529 Ga0055536_10075292 232
38 3300003781 Ga0055536_1031355 Ga0055536_10313552 232
39 3300003784 Ga0055534_1015751 Ga0055534_10157512 232
40 3300003791 Ga0055530_10000174 Ga0055530_1000017419 232
41 3300003791 Ga0055530_10000411 Ga0055530_1000041127 232
42 3300003794 Ga0055531_10001746 Ga0055531_1000174612 232
43 3300003794 Ga0055531_10014294 Ga0055531_100142943 232
44 3300025291 Ga0209675_1000025 Ga0209675_1000025291 232
45 3300025292 Ga0209676_1000259 Ga0209676_100025982 232
46 3300025292 Ga0209676_1000678 Ga0209676_100067811 232
47 3300025294 Ga0209025_1010159 Ga0209025_10101599 232
48 3300025298 Ga0209050_1000104 Ga0209050_1000104108 232
49 3300025298 Ga0209050_1017052 Ga0209050_10170523 232
50 3300025304 Ga0209257_1000120 Ga0209257_100012088 232
51 3300025304 Ga0209257_1000174 Ga0209257_1000174147 232
52 3300031911 Ga0307412_10075526 Ga0307412_100755262 232
53 3300032004 Ga0307414_10013889 Ga0307414_100138896 232
54 3300035115 Ga0373941_0064335 Ga0373941_0064335_277_1047 232
55 3300042002 Ga0439442_008156 Ga0439442_008156_768_1595 232
56 3300042004 Ga0439445_0007199 Ga0439445_0007199_83_910 232
57 3300046616 Ga0495668_0000001 Ga0495668_0000001_68878_69684 232
58 3300046660 Ga0495625_0001920 Ga0495625_0001920_15150_15953 232
59 3300053139 Ga0500568_0016977 Ga0500568_0016977_405_1208 232
60 iso_pu_bacteria 2840878972 2840883291 232
61 3300003320 rootH2_10093086 rootH2_100930861 233
62 3300005336 Ga0070680_100048217 Ga0070680_1000482172 233
63 3300005530 Ga0070679_100018143 Ga0070679_1000181434 233
64 3300005539 Ga0068853_100426163 Ga0068853_1004261632 233
65 3300005563 Ga0068855_100018471 Ga0068855_1000184719 233
66 3300005563 Ga0068855_100326846 Ga0068855_1003268462 233
67 3300005614 Ga0068856_100386733 Ga0068856_1003867331 233
68 3300009093 Ga0105240_10013961 Ga0105240_100139613 233
69 3300009093 Ga0105240_10036213 Ga0105240_100362131 233
70 3300009093 Ga0105240_10174368 Ga0105240_101743682 233
71 3300009093 Ga0105240_10828420 Ga0105240_108284201 233
72 3300009545 Ga0105237_10017309 Ga0105237_100173093 233
73 3300009545 Ga0105237_10454853 Ga0105237_104548532 233
74 3300009551 Ga0105238_10006764 Ga0105238_100067645 233
75 3300009551 Ga0105238_10372514 Ga0105238_103725141 233
76 3300009551 Ga0105238_10521210 Ga0105238_105212102 233
77 3300010375 Ga0105239_10006709 Ga0105239_1000670914 233
78 3300010375 Ga0105239_10196186 Ga0105239_101961863 233
79 3300021384 Ga0213876_10026630 Ga0213876_100266303 233
80 3300025907 Ga0207645_10317893 Ga0207645_103178931 233
81 3300025911 Ga0207654_10275834 Ga0207654_102758342 233
82 3300025913 Ga0207695_10010920 Ga0207695_1001092011 233
83 3300025913 Ga0207695_10140690 Ga0207695_101406901 233
84 3300025914 Ga0207671_10115634 Ga0207671_101156342 233
85 3300025917 Ga0207660_10041404 Ga0207660_100414043 233
86 3300025921 Ga0207652_10024819 Ga0207652_100248193 233
87 3300025924 Ga0207694_10025854 Ga0207694_100258546 233
88 3300025924 Ga0207694_10217882 Ga0207694_102178823 233
89 3300025949 Ga0207667_10076783 Ga0207667_100767832 233
90 3300028379 Ga0268266_10100381 Ga0268266_101003812 233
91 3300037466 Ga0395898_0306029 Ga0395898_0306029_339_1148 233
92 3300038443 Ga0395901_0060755 Ga0395901_0060755_2806_3615 233
93 3300039437 Ga0436365_1053930 Ga0436365_1053930_120_896 233
94 3300047319 Ga0495674_0164662 Ga0495674_0164662_174_962 233
95 3300049574 Ga0501038_0073917 Ga0501038_0073917_523_1305 233
96 3300049581 Ga0501047_0492531 Ga0501047_0492531_88_870 233
97 3300049822 Ga0501035_0010190 Ga0501035_0010190_133_915 233
98 3300049823 Ga0501044_0110803 Ga0501044_0110803_1932_2714 233
99 iso_pu_bacteria 2510917021 2511127401 233
100 iso_pu_bacteria 2818991438 2819550672 233
101 3300005336 Ga0070680_100277283 Ga0070680_1002772831 234
102 3300005341 Ga0070691_10001038 Ga0070691_100010389 234
103 3300005434 Ga0070709_10001050 Ga0070709_100010508 234
104 3300005435 Ga0070714_100087620 Ga0070714_1000876202 234
105 3300005435 Ga0070714_100331190 Ga0070714_1003311902 234
106 3300005435 Ga0070714_100345800 Ga0070714_1003458002 234
107 3300005436 Ga0070713_100000004 Ga0070713_100000004178 234
108 3300005436 Ga0070713_100090194 Ga0070713_1000901942 234
109 3300005436 Ga0070713_100144620 Ga0070713_1001446202 234
110 3300005437 Ga0070710_10313797 Ga0070710_103137971 234
111 3300005439 Ga0070711_100006293 Ga0070711_1000062932 234
112 3300005439 Ga0070711_100061692 Ga0070711_1000616922 234
113 3300005458 Ga0070681_10220409 Ga0070681_102204092 234
114 3300005535 Ga0070684_100206949 Ga0070684_1002069492 234
115 3300005539 Ga0068853_100044850 Ga0068853_1000448502 234
116 3300005545 Ga0070695_100056560 Ga0070695_1000565602 234
117 3300005545 Ga0070695_100456704 Ga0070695_1004567041 234
118 3300005547 Ga0070693_100030645 Ga0070693_1000306453 234
119 3300005547 Ga0070693_100152422 Ga0070693_1001524222 234
120 3300005563 Ga0068855_100174079 Ga0068855_1001740792 234
121 3300005578 Ga0068854_100051117 Ga0068854_1000511172 234
122 3300005614 Ga0068856_100000144 Ga0068856_10000014430 234
123 3300005614 Ga0068856_100036083 Ga0068856_1000360832 234
124 3300005616 Ga0068852_100005341 Ga0068852_1000053419 234
125 3300005618 Ga0068864_100160901 Ga0068864_1001609012 234
126 3300005841 Ga0068863_100031803 Ga0068863_1000318037 234
127 3300005842 Ga0068858_100025449 Ga0068858_1000254492 234
128 3300005842 Ga0068858_100139765 Ga0068858_1001397652 234
129 3300006028 Ga0070717_10000965 Ga0070717_100009652 234
130 3300006163 Ga0070715_10145784 Ga0070715_101457841 234
131 3300006173 Ga0070716_100012336 Ga0070716_1000123362 234
132 3300006175 Ga0070712_100000293 Ga0070712_10000029312 234
133 3300006175 Ga0070712_100000567 Ga0070712_1000005677 234
134 3300006871 Ga0075434_100029766 Ga0075434_1000297661 234
135 3300006871 Ga0075434_100466078 Ga0075434_1004660781 234
136 3300006871 Ga0075434_100560615 Ga0075434_1005606152 234
137 3300006914 Ga0075436_100000574 Ga0075436_10000057420 234
138 3300007076 Ga0075435_100229506 Ga0075435_1002295062 234
139 3300009093 Ga0105240_10006228 Ga0105240_100062282 234
140 3300009094 Ga0111539_10653894 Ga0111539_106538942 234
141 3300009101 Ga0105247_10032949 Ga0105247_100329492 234
142 3300009174 Ga0105241_10048218 Ga0105241_100482182 234
143 3300009174 Ga0105241_10057050 Ga0105241_100570502 234
144 3300009177 Ga0105248_10238795 Ga0105248_102387951 234
145 3300009545 Ga0105237_10161873 Ga0105237_101618732 234
146 3300009551 Ga0105238_10000847 Ga0105238_1000084713 234
147 3300009553 Ga0105249_10011618 Ga0105249_100116182 234
148 3300013104 Ga0157370_10022363 Ga0157370_100223632 234
149 3300013105 Ga0157369_10010560 Ga0157369_100105603 234
150 3300013297 Ga0157378_10130928 Ga0157378_101309282 234
151 3300013307 Ga0157372_10095779 Ga0157372_100957792 234
152 3300014968 Ga0157379_10004376 Ga0157379_100043764 234
153 3300014968 Ga0157379_10020130 Ga0157379_100201305 234
154 3300014968 Ga0157379_10053671 Ga0157379_100536713 234
155 3300014968 Ga0157379_10737004 Ga0157379_107370041 234
156 3300020069 Ga0197907_10260788 Ga0197907_102607881 234
157 3300020080 Ga0206350_11054501 Ga0206350_110545011 234
158 3300022467 Ga0224712_10002545 Ga0224712_100025451 234
159 3300025898 Ga0207692_10091624 Ga0207692_100916241 234
160 3300025906 Ga0207699_10000181 Ga0207699_1000018129 234
161 3300025911 Ga0207654_10031910 Ga0207654_100319102 234
162 3300025913 Ga0207695_10106753 Ga0207695_101067532 234
163 3300025914 Ga0207671_10034656 Ga0207671_100346562 234
164 3300025915 Ga0207693_10000163 Ga0207693_100001635 234
165 3300025915 Ga0207693_10001708 Ga0207693_100017089 234
166 3300025916 Ga0207663_10023145 Ga0207663_100231452 234
167 3300025924 Ga0207694_10055978 Ga0207694_100559782 234
168 3300025928 Ga0207700_10000011 Ga0207700_10000011129 234
169 3300025928 Ga0207700_10011148 Ga0207700_100111482 234
170 3300025928 Ga0207700_10092102 Ga0207700_100921022 234
171 3300025929 Ga0207664_10033147 Ga0207664_100331472 234
172 3300025929 Ga0207664_10592225 Ga0207664_105922251 234
173 3300025939 Ga0207665_10020902 Ga0207665_100209023 234
174 3300025939 Ga0207665_10270744 Ga0207665_102707443 234
175 3300025941 Ga0207711_10649117 Ga0207711_106491172 234
176 3300025949 Ga0207667_10011191 Ga0207667_100111912 234
177 3300025961 Ga0207712_10030366 Ga0207712_100303662 234
178 3300026035 Ga0207703_10088875 Ga0207703_100888752 234
179 3300026041 Ga0207639_10065428 Ga0207639_100654282 234
180 3300026078 Ga0207702_10000226 Ga0207702_1000022630 234
181 3300026078 Ga0207702_10025921 Ga0207702_100259213 234
182 3300026116 Ga0207674_10000330 Ga0207674_1000033057 234
183 3300028800 Ga0265338_10008211 Ga0265338_1000821110 234
184 3300028800 Ga0265338_10143061 Ga0265338_101430612 234
185 3300031240 Ga0265320_10004251 Ga0265320_100042512 234
186 3300031241 Ga0265325_10000098 Ga0265325_1000009814 234
187 3300031249 Ga0265339_10006756 Ga0265339_100067562 234
188 3300031249 Ga0265339_10023687 Ga0265339_100236873 234
189 3300031595 Ga0265313_10010486 Ga0265313_100104862 234
190 3300031711 Ga0265314_10000835 Ga0265314_1000083524 234
191 3300031711 Ga0265314_10047873 Ga0265314_100478732 234
192 3300035089 Ga0373944_0091004 Ga0373944_0091004_191_1009 234
193 3300035172 Ga0373955_0022124 Ga0373955_0022124_950_1735 234
194 3300035725 Ga0373947_0130056 Ga0373947_0130056_363_1181 234
195 3300036401 Ga0373937_0098051 Ga0373937_0098051_1235_2020 234
196 3300046459 Ga0495629_0144770 Ga0495629_0144770_643_1425 234
197 3300047471 Ga0495684_0226731 Ga0495684_0226731_564_1349 234
198 3300048924 Ga0496121_0208333 Ga0496121_0208333_103_882 234
199 3300050512 nmdc:mga0n895_20772_c1 nmdc:mga0n895_20772_c1_56_841 234
200 3300050512 nmdc:mga0n895_563969_c1 nmdc:mga0n895_563969_c1_103_891 234
201 3300050512 nmdc:mga0n895_700712_c1 nmdc:mga0n895_700712_c1_165_962 234
202 3300050513 nmdc:mga0rr50_210970_c1 nmdc:mga0rr50_210970_c1_315_1112 234
203 3300050514 nmdc:mga08x19_129_c1 nmdc:mga08x19_129_c1_32696_33481 234
204 3300053119 Ga0500595_001333 Ga0500595_001333_6561_7340 234
205 3300005335 Ga0070666_10001920 Ga0070666_100019209 235
206 3300005367 Ga0070667_100327458 Ga0070667_1003274582 235
207 3300005548 Ga0070665_100081373 Ga0070665_1000813733 235
208 3300005563 Ga0068855_100080830 Ga0068855_1000808303 235
209 3300005937 Ga0081455_10001531 Ga0081455_1000153121 235
210 3300005937 Ga0081455_10071738 Ga0081455_100717382 235
211 3300006042 Ga0075368_10000095 Ga0075368_100000959 235
212 3300006048 Ga0075363_100000751 Ga0075363_1000007514 235
213 3300006048 Ga0075363_100004933 Ga0075363_1000049336 235
214 3300006051 Ga0075364_10045967 Ga0075364_100459672 235
215 3300006177 Ga0075362_10000114 Ga0075362_1000011416 235
216 3300006177 Ga0075362_10000265 Ga0075362_100002657 235
217 3300006178 Ga0075367_10003384 Ga0075367_100033848 235
218 3300006186 Ga0075369_10001348 Ga0075369_100013485 235
219 3300006186 Ga0075369_10003423 Ga0075369_100034236 235
220 3300006195 Ga0075366_10000415 Ga0075366_100004155 235
221 3300006353 Ga0075370_10000048 Ga0075370_1000004835 235
222 3300006353 Ga0075370_10001563 Ga0075370_100015637 235
223 3300006353 Ga0075370_10017171 Ga0075370_100171714 235
224 3300006353 Ga0075370_10037022 Ga0075370_100370222 235
225 3300009094 Ga0111539_10159233 Ga0111539_101592332 235
226 3300009177 Ga0105248_10062045 Ga0105248_100620453 235
227 3300021384 Ga0213876_10038055 Ga0213876_100380552 235
228 3300025298 Ga0209050_1001308 Ga0209050_100130829 235
229 3300025924 Ga0207694_10255815 Ga0207694_102558152 235
230 3300025941 Ga0207711_10184860 Ga0207711_101848601 235
231 3300025949 Ga0207667_10167552 Ga0207667_101675522 235
232 3300027866 Ga0209813_10000013 Ga0209813_1000001387 235
233 3300031238 Ga0265332_10075042 Ga0265332_100750422 235
234 3300031249 Ga0265339_10012302 Ga0265339_100123023 235
235 3300035398 Ga0316574_0003926 Ga0316574_0003926_1191_1973 235
236 3300035695 Ga0373927_0053577 Ga0373927_0053577_1425_2213 235
237 3300036401 Ga0373937_0568685 Ga0373937_0568685_207_995 235
238 3300039437 Ga0436365_1818233 Ga0436365_1818233_1996_2814 235
239 3300039450 Ga0436363_1233328 Ga0436363_1233328_1160_1948 235
240 3300039450 Ga0436363_1240126 Ga0436363_1240126_16056_16844 235
241 3300046500 Ga0495596_0000486 Ga0495596_0000486_10127_10909 235
242 3300046500 Ga0495596_0004299 Ga0495596_0004299_3085_3876 235
243 3300046501 Ga0495607_0004616 Ga0495607_0004616_409_1191 235
244 3300046506 Ga0495583_0039818 Ga0495583_0039818_863_1645 235
245 3300046507 Ga0495606_0012143 Ga0495606_0012143_6088_6870 235
246 3300046512 Ga0495610_0002681 Ga0495610_0002681_9471_10253 235
247 3300046512 Ga0495610_0004187 Ga0495610_0004187_53_835 235
248 3300046519 Ga0495632_0013411 Ga0495632_0013411_3768_4550 235
249 3300046522 Ga0495643_0000945 Ga0495643_0000945_19874_20656 235
250 3300046522 Ga0495643_0004994 Ga0495643_0004994_6135_6917 235
251 3300046522 Ga0495643_0045127 Ga0495643_0045127_564_1346 235
252 3300046538 Ga0495609_0002362 Ga0495609_0002362_9619_10401 235
253 3300046660 Ga0495625_0008059 Ga0495625_0008059_5210_5992 235
254 3300046660 Ga0495625_0055036 Ga0495625_0055036_1715_2503 235
255 3300047320 Ga0495672_0000462 Ga0495672_0000462_18115_18897 235
256 3300047472 Ga0495686_0263994 Ga0495686_0263994_164_946 235
257 3300048091 Ga0495626_0004324 Ga0495626_0004324_7449_8231 235
258 3300048919 Ga0496116_0000039 Ga0496116_0000039_304805_305596 235
259 3300048920 Ga0496117_0075369 Ga0496117_0075369_1226_2017 235
260 3300048921 Ga0496118_0048034 Ga0496118_0048034_1453_2244 235
261 3300048924 Ga0496121_0000733 Ga0496121_0000733_28309_29100 235
262 3300048925 Ga0496122_0001526 Ga0496122_0001526_30055_30846 235
263 3300048926 Ga0496123_0002207 Ga0496123_0002207_19230_20021 235
264 3300048927 Ga0496124_0004725 Ga0496124_0004725_6380_7171 235
265 3300048927 Ga0496124_0021030 Ga0496124_0021030_4424_5215 235
266 3300048927 Ga0496124_0080489 Ga0496124_0080489_801_1592 235
267 3300048928 Ga0496125_0004368 Ga0496125_0004368_4421_5212 235
268 3300048929 Ga0496126_0000041 Ga0496126_0000041_36304_37095 235
269 3300048929 Ga0496126_0000498 Ga0496126_0000498_43176_43964 235
270 3300049571 Ga0501034_0147813 Ga0501034_0147813_125_913 235
271 3300049589 Ga0501073_0400485 Ga0501073_0400485_37_819 235
272 3300049823 Ga0501044_0001291 Ga0501044_0001291_5711_6499 235
273 3300050489 nmdc:mga03683_17_c1 nmdc:mga03683_17_c1_18615_19397 235
274 3300050489 nmdc:mga03683_41_c1 nmdc:mga03683_41_c1_3085_3867 235
275 3300050490 nmdc:mga03n38_973_c1 nmdc:mga03n38_973_c1_4874_5656 235
276 3300050491 nmdc:mga00v17_37643_c1 nmdc:mga00v17_37643_c1_225_1007 235
277 3300050492 nmdc:mga0yw44_23100_c1 nmdc:mga0yw44_23100_c1_2667_3449 235
278 3300050492 nmdc:mga0yw44_66231_c1 nmdc:mga0yw44_66231_c1_1418_2200 235
279 3300050493 nmdc:mga0k408_12_c1 nmdc:mga0k408_12_c1_71247_72029 235
280 3300050494 nmdc:mga06z11_545_c1 nmdc:mga06z11_545_c1_1983_2765 235
281 3300050495 nmdc:mga04h51_354_c1 nmdc:mga04h51_354_c1_2354_3136 235
282 3300050496 nmdc:mga07m45_11_c1 nmdc:mga07m45_11_c1_91536_92318 235
283 3300050496 nmdc:mga07m45_16_c1 nmdc:mga07m45_16_c1_79456_80238 235
284 3300050496 nmdc:mga07m45_6452_c1 nmdc:mga07m45_6452_c1_1444_2226 235
285 3300050496 nmdc:mga07m45_8999_c1 nmdc:mga07m45_8999_c1_125_913 235
286 3300050511 nmdc:mga08y16_524234_c1 nmdc:mga08y16_524234_c1_90_872 235
287 3300050512 nmdc:mga0n895_377112_c1 nmdc:mga0n895_377112_c1_431_1204 235
288 3300050516 nmdc:mga0sz30_188_c1 nmdc:mga0sz30_188_c1_2558_3340 235
289 3300050516 nmdc:mga0sz30_666_c2 nmdc:mga0sz30_666_c2_4433_5215 235
290 3300053087 Ga0500643_014174 Ga0500643_014174_43_831 235
291 3300053103 Ga0500555_031592 Ga0500555_031592_306_1088 235
292 3300053119 Ga0500595_038324 Ga0500595_038324_406_1194 235
293 3300053121 Ga0500607_000140 Ga0500607_000140_47151_47939 235
294 3300053121 Ga0500607_000188 Ga0500607_000188_7551_8333 235
295 3300053136 Ga0500559_0000722 Ga0500559_0000722_8224_9012 235
296 3300053136 Ga0500559_0000883 Ga0500559_0000883_6593_7381 235
297 3300053156 Ga0500622_0002589 Ga0500622_0002589_10170_10958 235
298 3300053178 Ga0500637_0003008 Ga0500637_0003008_1677_2465 235
299 3300053730 Ga0500645_001749 Ga0500645_001749_4562_5350 235
300 3300053730 Ga0500645_002540 Ga0500645_002540_6035_6817 235
301 iso_pu_bacteria 2643221574 2643883320 235
302 iso_pu_bacteria 2643221699 2644547862 235
303 iso_pu_bacteria 2928972540 2928974012 235
304 3300002774 JGI25150J39212_1001047 JGI25150J39212_10010479 236
305 3300003215 JGI25153J46596_10000535 JGI25153J46596_100005359 236
306 3300003771 Ga0055526_1001270 Ga0055526_100127011 236
307 3300003771 Ga0055526_1054591 Ga0055526_10545911 236
308 3300003791 Ga0055530_10011110 Ga0055530_100111101 236
309 3300003792 Ga0055540_1000884 Ga0055540_10008841 236
310 3300005262 Ga0065165_1008527 Ga0065165_10085277 236
311 3300005344 Ga0070661_100000148 Ga0070661_10000014812 236
312 3300005367 Ga0070667_100234157 Ga0070667_1002341573 236
313 3300005719 Ga0068861_100001216 Ga0068861_1000012167 236
314 3300006946 Ga0079104_1021103 Ga0079104_10211032 236
315 3300013104 Ga0157370_10006919 Ga0157370_100069193 236
316 3300025245 Ga0207425_1000094 Ga0207425_100009414 236
317 3300025258 Ga0209129_1017796 Ga0209129_10177962 236
318 3300025263 Ga0209565_1000386 Ga0209565_100038636 236
319 3300025292 Ga0209676_1011926 Ga0209676_10119263 236
320 3300025294 Ga0209025_1000727 Ga0209025_100072743 236
321 3300025295 Ga0209564_1002114 Ga0209564_100211410 236
322 3300025295 Ga0209564_1015689 Ga0209564_10156893 236
323 3300025297 Ga0209758_1000002 Ga0209758_100000214 236
324 3300025297 Ga0209758_1000108 Ga0209758_1000108203 236
325 3300025298 Ga0209050_1000342 Ga0209050_100034213 236
326 3300025302 Ga0207426_1023307 Ga0207426_10233071 236
327 3300025303 Ga0209051_1000226 Ga0209051_100022610 236
328 3300025304 Ga0209257_1007904 Ga0209257_10079044 236
329 3300025304 Ga0209257_1011412 Ga0209257_10114122 236
330 3300025920 Ga0207649_10000153 Ga0207649_1000015316 236
331 3300025986 Ga0207658_10200619 Ga0207658_102006192 236
332 3300026118 Ga0207675_100002220 Ga0207675_1000022208 236
333 3300027111 Ga0209281_1014127 Ga0209281_10141272 236
334 3300031250 Ga0265331_10000003 Ga0265331_10000003141 236
335 3300031250 Ga0265331_10000793 Ga0265331_100007937 236
336 3300031251 Ga0265327_10000187 Ga0265327_1000018762 236
337 3300031711 Ga0265314_10169539 Ga0265314_101695392 236
338 3300046524 Ga0495648_0033936 Ga0495648_0033936_427_1209 236
339 3300048918 Ga0496115_0000286 Ga0496115_0000286_28914_29696 236
340 3300049572 Ga0501036_0077432 Ga0501036_0077432_1105_1896 236
341 3300049579 Ga0501043_0046386 Ga0501043_0046386_526_1317 236
342 3300049580 Ga0501046_0287352 Ga0501046_0287352_282_1073 236
343 3300049580 Ga0501046_0302524 Ga0501046_0302524_364_1155 236
344 3300049586 Ga0501070_0038373 Ga0501070_0038373_1105_1896 236
345 3300049586 Ga0501070_0267903 Ga0501070_0267903_434_1225 236
346 3300049742 Ga0501080_0225354 Ga0501080_0225354_737_1528 236
347 3300049822 Ga0501035_0076744 Ga0501035_0076744_250_1041 236
348 3300053120 Ga0500597_004368 Ga0500597_004368_1081_1863 236
349 3300053157 Ga0500624_000041 Ga0500624_000041_50153_50935 236
350 3300053178 Ga0500637_0000206 Ga0500637_0000206_20_802 236
351 3300005295 Ga0065707_10082179 Ga0065707_1008217918 237
352 3300005327 Ga0070658_10045870 Ga0070658_100458702 237
353 3300005336 Ga0070680_100100450 Ga0070680_1001004502 237
354 3300005339 Ga0070660_100016809 Ga0070660_1000168092 237
355 3300005341 Ga0070691_10022777 Ga0070691_100227773 237
356 3300005366 Ga0070659_100037928 Ga0070659_1000379283 237
357 3300005455 Ga0070663_100046764 Ga0070663_1000467642 237
358 3300005539 Ga0068853_100001204 Ga0068853_1000012043 237
359 3300005563 Ga0068855_100012015 Ga0068855_1000120158 237
360 3300005578 Ga0068854_100111245 Ga0068854_1001112452 237
361 3300009177 Ga0105248_10000005 Ga0105248_10000005529 237
362 3300009551 Ga0105238_10013382 Ga0105238_100133823 237
363 3300013102 Ga0157371_10059879 Ga0157371_100598793 237
364 3300013104 Ga0157370_10013933 Ga0157370_100139333 237
365 3300013307 Ga0157372_10004635 Ga0157372_100046356 237
366 3300013307 Ga0157372_10011558 Ga0157372_100115586 237
367 3300013307 Ga0157372_10044607 Ga0157372_100446075 237
368 3300014326 Ga0157380_10000346 Ga0157380_1000034613 237
369 3300021384 Ga0213876_10000201 Ga0213876_1000020117 237
370 3300021388 Ga0213875_10000228 Ga0213875_1000022833 237
371 3300025909 Ga0207705_10000391 Ga0207705_1000039119 237
372 3300025911 Ga0207654_10041310 Ga0207654_100413102 237
373 3300025912 Ga0207707_10008623 Ga0207707_100086233 237
374 3300025917 Ga0207660_10008613 Ga0207660_100086133 237
375 3300025919 Ga0207657_10001337 Ga0207657_100013376 237
376 3300025921 Ga0207652_10021313 Ga0207652_100213133 237
377 3300025932 Ga0207690_10032885 Ga0207690_100328852 237
378 3300025941 Ga0207711_10000002 Ga0207711_10000002526 237
379 3300025981 Ga0207640_10241577 Ga0207640_102415772 237
380 3300026067 Ga0207678_10031842 Ga0207678_100318422 237
381 3300028380 Ga0268265_10280687 Ga0268265_102806872 237
382 3300028800 Ga0265338_10000005 Ga0265338_10000005370 237
383 3300031241 Ga0265325_10000005 Ga0265325_10000005147 237
384 3300031249 Ga0265339_10002598 Ga0265339_100025983 237
385 3300031250 Ga0265331_10012945 Ga0265331_100129453 237
386 3300031595 Ga0265313_10014393 Ga0265313_100143933 237
387 3300031711 Ga0265314_10012124 Ga0265314_100121245 237
388 3300031711 Ga0265314_10118251 Ga0265314_101182512 237
389 3300032004 Ga0307414_10003389 Ga0307414_100033891 237
390 3300037853 Ga0436364_1065372 Ga0436364_1065372_133504_134325 237
391 3300039437 Ga0436365_1073490 Ga0436365_1073490_28567_29358 237
392 3300039437 Ga0436365_1469416 Ga0436365_1469416_302_1123 237
393 3300039450 Ga0436363_0399751 Ga0436363_0399751_8013_8807 237
394 3300046507 Ga0495606_0000078 Ga0495606_0000078_82399_83187 237
395 3300046522 Ga0495643_0011590 Ga0495643_0011590_3896_4684 237
396 3300046524 Ga0495648_0000748 Ga0495648_0000748_8344_9132 237
397 3300047469 Ga0495673_0000270 Ga0495673_0000270_25751_26539 237
398 3300049570 Ga0501033_0098754 Ga0501033_0098754_89_883 237
399 3300049571 Ga0501034_0079948 Ga0501034_0079948_942_1736 237
400 3300049572 Ga0501036_0136834 Ga0501036_0136834_344_1138 237
401 3300049574 Ga0501038_0392377 Ga0501038_0392377_124_918 237
402 3300049581 Ga0501047_0372523 Ga0501047_0372523_114_908 237
403 3300049582 Ga0501048_0084229 Ga0501048_0084229_816_1610 237
404 3300049583 Ga0501067_0034861 Ga0501067_0034861_1269_2063 237
405 3300049584 Ga0501068_0265698 Ga0501068_0265698_113_907 237
406 3300049585 Ga0501069_0005058 Ga0501069_0005058_872_1666 237
407 3300049586 Ga0501070_0000002 Ga0501070_0000002_226067_226861 237
408 3300049586 Ga0501070_0021858 Ga0501070_0021858_2017_2811 237
409 3300049590 Ga0501074_0082600 Ga0501074_0082600_131_925 237
410 3300049741 Ga0501079_0022801 Ga0501079_0022801_2645_3439 237
411 3300049742 Ga0501080_0003580 Ga0501080_0003580_2623_3417 237
412 3300049742 Ga0501080_0011904 Ga0501080_0011904_2312_3106 237
413 3300049742 Ga0501080_0052166 Ga0501080_0052166_1634_2428 237
414 3300049744 Ga0501083_0168217 Ga0501083_0168217_307_1101 237
415 3300049822 Ga0501035_0018850 Ga0501035_0018850_2986_3780 237
416 3300049823 Ga0501044_0000378 Ga0501044_0000378_12033_12827 237
417 3300049823 Ga0501044_0015636 Ga0501044_0015636_392_1180 237
418 3300049823 Ga0501044_0029141 Ga0501044_0029141_1774_2568 237
419 3300049823 Ga0501044_0029793 Ga0501044_0029793_4356_5150 237
420 3300049823 Ga0501044_0099883 Ga0501044_0099883_1078_1872 237
421 3300053087 Ga0500643_012667 Ga0500643_012667_64_852 237
422 3300053088 Ga0500644_0000142 Ga0500644_0000142_41857_42645 237
423 3300053138 Ga0500564_000219 Ga0500564_000219_13620_14408 237
424 3300053154 Ga0500619_020944 Ga0500619_020944_169_963 237
425 3300054114 Ga0501084_0000017 Ga0501084_0000017_98094_98888 237
426 3300054114 Ga0501084_0067831 Ga0501084_0067831_1011_1805 237
427 3300055283 Ga0500661_029894 Ga0500661_029894_60_848 237
428 iso_pu_bacteria 2643221560 2643822857 237
429 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007208 238
430 3300005331 Ga0070670_100088543 Ga0070670_1000885432 238
431 3300005335 Ga0070666_10008011 Ga0070666_100080114 238
432 3300005336 Ga0070680_100000110 Ga0070680_10000011032 238
433 3300005336 Ga0070680_100556418 Ga0070680_1005564181 238
434 3300005347 Ga0070668_100000089 Ga0070668_10000008950 238
435 3300005353 Ga0070669_100003790 Ga0070669_10000379011 238
436 3300005367 Ga0070667_100000081 Ga0070667_100000081102 238
437 3300005435 Ga0070714_100019518 Ga0070714_1000195185 238
438 3300005458 Ga0070681_10000001 Ga0070681_10000001389 238
439 3300005530 Ga0070679_100000032 Ga0070679_1000000323 238
440 3300005841 Ga0068863_100000099 Ga0068863_10000009917 238
441 3300005843 Ga0068860_100009295 Ga0068860_1000092953 238
442 3300005844 Ga0068862_100092132 Ga0068862_1000921323 238
443 3300006175 Ga0070712_100378318 Ga0070712_1003783181 238
444 3300009551 Ga0105238_10525531 Ga0105238_105255312 238
445 3300010375 Ga0105239_10005268 Ga0105239_100052687 238
446 3300013307 Ga0157372_10283496 Ga0157372_102834962 238
447 3300025292 Ga0209676_1000084 Ga0209676_1000084266 238
448 3300025297 Ga0209758_1000017 Ga0209758_1000017205 238
449 3300025903 Ga0207680_10008005 Ga0207680_100080054 238
450 3300025912 Ga0207707_10000001 Ga0207707_1000000176 238
451 3300025915 Ga0207693_10295073 Ga0207693_102950731 238
452 3300025917 Ga0207660_10001819 Ga0207660_1000181911 238
453 3300025921 Ga0207652_10000419 Ga0207652_100004194 238
454 3300025923 Ga0207681_10054823 Ga0207681_100548234 238
455 3300025929 Ga0207664_10037985 Ga0207664_100379852 238
456 3300025972 Ga0207668_10000051 Ga0207668_1000005178 238
457 3300025986 Ga0207658_10000062 Ga0207658_1000006216 238
458 3300026088 Ga0207641_10000014 Ga0207641_1000001474 238
459 3300028380 Ga0268265_10095239 Ga0268265_100952392 238
460 3300028381 Ga0268264_10012308 Ga0268264_100123083 238
461 3300028800 Ga0265338_10018931 Ga0265338_100189312 238
462 3300031238 Ga0265332_10105667 Ga0265332_101056672 238
463 3300031241 Ga0265325_10003316 Ga0265325_100033164 238
464 3300031247 Ga0265340_10034886 Ga0265340_100348862 238
465 3300031249 Ga0265339_10002558 Ga0265339_100025586 238
466 3300031595 Ga0265313_10033370 Ga0265313_100333702 238
467 3300031711 Ga0265314_10117820 Ga0265314_101178202 238
468 3300031712 Ga0265342_10076101 Ga0265342_100761012 238
469 3300031911 Ga0307412_10055008 Ga0307412_100550083 238
470 3300032004 Ga0307414_10062012 Ga0307414_100620123 238
471 3300035171 Ga0373946_0022552 Ga0373946_0022552_976_1773 238
472 3300035172 Ga0373955_0069437 Ga0373955_0069437_1065_1856 238
473 3300035692 Ga0373935_0069528 Ga0373935_0069528_127_924 238
474 3300035725 Ga0373947_0008391 Ga0373947_0008391_2927_3724 238
475 3300036401 Ga0373937_0258748 Ga0373937_0258748_25_816 238
476 3300037068 Ga0373925_0025017 Ga0373925_0025017_1146_1943 238
477 3300037068 Ga0373925_0037097 Ga0373925_0037097_857_1654 238
478 3300039062 Ga0400483_101908 Ga0400483_101908_575_1366 238
479 3300044712 Ga0453684_0293163 Ga0453684_0293163_231_1019 238
480 3300046454 Ga0495592_0122821 Ga0495592_0122821_451_1248 238
481 3300046471 Ga0495650_0001660 Ga0495650_0001660_4222_5013 238
482 3300046472 Ga0495580_0012332 Ga0495580_0012332_3833_4630 238
483 3300046543 Ga0495645_0080018 Ga0495645_0080018_1029_1826 238
484 3300046683 Ga0495658_0010226 Ga0495658_0010226_698_1495 238
485 3300046689 Ga0495613_0243307 Ga0495613_0243307_160_957 238
486 3300047317 Ga0495604_0295417 Ga0495604_0295417_32_829 238
487 3300049569 Ga0501032_0153860 Ga0501032_0153860_237_1040 238
488 3300049570 Ga0501033_0172391 Ga0501033_0172391_562_1365 238
489 3300049571 Ga0501034_0108480 Ga0501034_0108480_267_1070 238
490 3300049571 Ga0501034_0192076 Ga0501034_0192076_358_1173 238
491 3300049571 Ga0501034_0271308 Ga0501034_0271308_331_1134 238
492 3300049572 Ga0501036_0009156 Ga0501036_0009156_7028_7831 238
493 3300049573 Ga0501037_0026713 Ga0501037_0026713_1936_2721 238
494 3300049574 Ga0501038_0029433 Ga0501038_0029433_3971_4765 238
495 3300049574 Ga0501038_0181272 Ga0501038_0181272_136_921 238
496 3300049575 Ga0501039_0005227 Ga0501039_0005227_8082_8867 238
497 3300049575 Ga0501039_0043147 Ga0501039_0043147_88_891 238
498 3300049577 Ga0501041_0031462 Ga0501041_0031462_1276_2061 238
499 3300049578 Ga0501042_0098487 Ga0501042_0098487_856_1641 238
500 3300049579 Ga0501043_0010112 Ga0501043_0010112_209_994 238
501 3300049580 Ga0501046_0356427 Ga0501046_0356427_220_1005 238
502 3300049581 Ga0501047_0013767 Ga0501047_0013767_1464_2258 238
503 3300049581 Ga0501047_0166381 Ga0501047_0166381_935_1750 238
504 3300049581 Ga0501047_0253401 Ga0501047_0253401_562_1365 238
505 3300049581 Ga0501047_0268809 Ga0501047_0268809_563_1366 238
506 3300049583 Ga0501067_0000980 Ga0501067_0000980_9933_10748 238
507 3300049584 Ga0501068_0059171 Ga0501068_0059171_249_1034 238
508 3300049585 Ga0501069_0175942 Ga0501069_0175942_424_1209 238
509 3300049586 Ga0501070_0257677 Ga0501070_0257677_533_1348 238
510 3300049588 Ga0501072_0050053 Ga0501072_0050053_844_1659 238
511 3300049590 Ga0501074_0450056 Ga0501074_0450056_43_828 238
512 3300049591 Ga0501075_0009709 Ga0501075_0009709_1619_2404 238
513 3300049592 Ga0501076_0009741 Ga0501076_0009741_3317_4102 238
514 3300049593 Ga0501077_0074383 Ga0501077_0074383_1330_2115 238
515 3300049741 Ga0501079_0016537 Ga0501079_0016537_2250_3035 238
516 3300049743 Ga0501081_0000375 Ga0501081_0000375_10742_11527 238
517 3300049822 Ga0501035_0127922 Ga0501035_0127922_452_1255 238
518 3300049823 Ga0501044_0014944 Ga0501044_0014944_3906_4700 238
519 3300049823 Ga0501044_0254324 Ga0501044_0254324_331_1134 238
520 3300049824 Ga0501045_0084013 Ga0501045_0084013_471_1256 238
521 3300053116 Ga0500592_005174 Ga0500592_005174_838_1638 238
522 3300053158 Ga0500627_0000149 Ga0500627_0000149_5806_6606 238
523 3300054114 Ga0501084_0048106 Ga0501084_0048106_1319_2104 238
524 3300054114 Ga0501084_0110200 Ga0501084_0110200_288_1103 238
525 3300060353 Ga0501082_0025498 Ga0501082_0025498_3535_4320 238
526 iso_pu_bacteria 2643221563 2643832522 238
527 iso_pu_bacteria 2643221608 2644053683 238
528 iso_pu_bacteria 2852680915 2852681417 238
529 3300005335 Ga0070666_10028389 Ga0070666_100283892 239
530 3300005347 Ga0070668_100002202 Ga0070668_1000022023 239
531 3300005353 Ga0070669_100513250 Ga0070669_1005132501 239
532 3300005355 Ga0070671_100001555 Ga0070671_10000155513 239
533 3300005367 Ga0070667_100002070 Ga0070667_10000207013 239
534 3300005437 Ga0070710_10094523 Ga0070710_100945232 239
535 3300005545 Ga0070695_100116187 Ga0070695_1001161871 239
536 3300005546 Ga0070696_100121391 Ga0070696_1001213912 239
537 3300005617 Ga0068859_100039771 Ga0068859_1000397713 239
538 3300005618 Ga0068864_100003647 Ga0068864_1000036477 239
539 3300005842 Ga0068858_100000432 Ga0068858_10000043213 239
540 3300005843 Ga0068860_100002902 Ga0068860_10000290214 239
541 3300005844 Ga0068862_100002243 Ga0068862_10000224313 239
542 3300006852 Ga0075433_10147527 Ga0075433_101475272 239
543 3300006871 Ga0075434_100014637 Ga0075434_1000146373 239
544 3300006914 Ga0075436_100018816 Ga0075436_1000188162 239
545 3300006931 Ga0097620_100039774 Ga0097620_1000397743 239
546 3300009147 Ga0114129_10177528 Ga0114129_101775282 239
547 3300025294 Ga0209025_1090805 Ga0209025_10908051 239
548 3300025898 Ga0207692_10103439 Ga0207692_101034392 239
549 3300025903 Ga0207680_10005625 Ga0207680_100056253 239
550 3300025921 Ga0207652_10019708 Ga0207652_100197087 239
551 3300025923 Ga0207681_10005139 Ga0207681_100051393 239
552 3300025923 Ga0207681_10032420 Ga0207681_100324202 239
553 3300025925 Ga0207650_10004495 Ga0207650_100044956 239
554 3300025931 Ga0207644_10001453 Ga0207644_100014533 239
555 3300025972 Ga0207668_10000287 Ga0207668_1000028717 239
556 3300025986 Ga0207658_10001520 Ga0207658_100015204 239
557 3300026035 Ga0207703_10006894 Ga0207703_100068945 239
558 3300026088 Ga0207641_10000857 Ga0207641_1000085725 239
559 3300026088 Ga0207641_10024890 Ga0207641_100248903 239
560 3300026095 Ga0207676_10002576 Ga0207676_100025767 239
561 3300026118 Ga0207675_100152325 Ga0207675_1001523252 239
562 3300028380 Ga0268265_10001738 Ga0268265_1000173813 239
563 3300028381 Ga0268264_10001483 Ga0268264_1000148317 239
564 3300039438 Ga0436360_1001166 Ga0436360_1001166_707_1510 239
565 3300046539 Ga0495621_0015587 Ga0495621_0015587_1573_2367 239
566 3300050507 nmdc:mga05p37_166992_c2 nmdc:mga05p37_166992_c2_450_1253 239
567 3300050512 nmdc:mga0n895_84254_c1 nmdc:mga0n895_84254_c1_1883_2686 239
568 3300050515 nmdc:mga0a205_82685_c1 nmdc:mga0a205_82685_c1_2102_2905 239
569 3300061719 Ga0466962_0230650 Ga0466962_0230650_85_876 239
570 iso_pu_bacteria 2852653556 2852654882 239
571 3300005340 Ga0070689_100035411 Ga0070689_1000354115 240
572 3300005466 Ga0070685_10041332 Ga0070685_100413322 240
573 3300005468 Ga0070707_100313669 Ga0070707_1003136692 240
574 3300005468 Ga0070707_100549924 Ga0070707_1005499242 240
575 3300005471 Ga0070698_100096571 Ga0070698_1000965712 240
576 3300005544 Ga0070686_100145603 Ga0070686_1001456032 240
577 3300005545 Ga0070695_100138448 Ga0070695_1001384482 240
578 3300005545 Ga0070695_100143869 Ga0070695_1001438692 240
579 3300005546 Ga0070696_100132184 Ga0070696_1001321842 240
580 3300005618 Ga0068864_100020321 Ga0068864_1000203213 240
581 3300005844 Ga0068862_100031511 Ga0068862_1000315114 240
582 3300006852 Ga0075433_10002091 Ga0075433_100020915 240
583 3300007076 Ga0075435_100143759 Ga0075435_1001437592 240
584 3300009094 Ga0111539_10004799 Ga0111539_100047991 240
585 3300009147 Ga0114129_11227502 Ga0114129_112275021 240
586 3300009177 Ga0105248_10003309 Ga0105248_100033092 240
587 3300014968 Ga0157379_10022857 Ga0157379_100228574 240
588 3300025922 Ga0207646_10113189 Ga0207646_101131892 240
589 3300025922 Ga0207646_10275399 Ga0207646_102753992 240
590 3300025941 Ga0207711_10029196 Ga0207711_100291963 240
591 3300026035 Ga0207703_10001408 Ga0207703_100014087 240
592 3300026089 Ga0207648_10315454 Ga0207648_103154542 240
593 3300027907 Ga0207428_10073233 Ga0207428_100732333 240
594 3300031241 Ga0265325_10005575 Ga0265325_100055753 240
595 3300031247 Ga0265340_10005438 Ga0265340_100054383 240
596 3300031247 Ga0265340_10112087 Ga0265340_101120872 240
597 3300031249 Ga0265339_10001877 Ga0265339_100018773 240
598 3300031249 Ga0265339_10038996 Ga0265339_100389962 240
599 3300031249 Ga0265339_10164828 Ga0265339_101648281 240
600 3300031344 Ga0265316_10197283 Ga0265316_101972832 240
601 3300031711 Ga0265314_10000125 Ga0265314_1000012549 240
602 3300031712 Ga0265342_10012164 Ga0265342_100121644 240
603 3300038443 Ga0395901_0226672 Ga0395901_0226672_1079_1873 240
604 3300045051 Ga0451576_0054726 Ga0451576_0054726_470_1258 240
605 3300046537 Ga0495598_0019749 Ga0495598_0019749_431_1231 240
606 3300046558 Ga0495633_0085839 Ga0495633_0085839_536_1336 240
607 3300050511 nmdc:mga08y16_2749_c1 nmdc:mga08y16_2749_c1_15753_16541 240
608 3300050513 nmdc:mga0rr50_125378_c1 nmdc:mga0rr50_125378_c1_895_1683 240
609 3300053108 Ga0500562_000281 Ga0500562_000281_2322_3122 240
610 3300028381 Ga0268264_10295208 Ga0268264_102952082 241
611 3300005341 Ga0070691_10163248 Ga0070691_101632481 250
612 3300005347 Ga0070668_100073886 Ga0070668_1000738863 250
613 3300013306 Ga0163162_10088265 Ga0163162_100882652 250
614 3300025972 Ga0207668_10065194 Ga0207668_100651942 250
615 3300005335 Ga0070666_10026179 Ga0070666_100261793 253
616 3300005367 Ga0070667_100040279 Ga0070667_1000402793 253
617 3300006048 Ga0075363_100002626 Ga0075363_1000026268 253
618 3300009553 Ga0105249_10002484 Ga0105249_1000248413 253
619 3300010375 Ga0105239_10157411 Ga0105239_101574114 253
620 3300025961 Ga0207712_10008147 Ga0207712_100081476 253
621 3300048911 Ga0496108_0017612 Ga0496108_0017612_917_1744 253
622 3300048912 Ga0496109_0077119 Ga0496109_0077119_304_1131 253
623 3300048915 Ga0496112_0005828 Ga0496112_0005828_5617_6444 253
624 3300048916 Ga0496113_0097261 Ga0496113_0097261_1269_2096 253
625 3300002073 JGI24745J21846_1005543 JGI24745J21846_10055432 255
626 3300002076 JGI24749J21850_1000704 JGI24749J21850_10007045 255
627 3300005330 Ga0070690_100027745 Ga0070690_1000277452 255
628 3300005334 Ga0068869_100002460 Ga0068869_1000024608 255
629 3300005338 Ga0068868_100000389 Ga0068868_10000038914 255
630 3300005339 Ga0070660_100455384 Ga0070660_1004553842 255
631 3300005340 Ga0070689_100017445 Ga0070689_1000174453 255
632 3300005340 Ga0070689_100063768 Ga0070689_1000637685 255
633 3300005341 Ga0070691_10010668 Ga0070691_100106684 255
634 3300005347 Ga0070668_100007157 Ga0070668_1000071576 255
635 3300005356 Ga0070674_100000125 Ga0070674_10000012514 255
636 3300005356 Ga0070674_100027141 Ga0070674_1000271411 255
637 3300005365 Ga0070688_100005716 Ga0070688_1000057166 255
638 3300005366 Ga0070659_100258406 Ga0070659_1002584062 255
639 3300005366 Ga0070659_100480189 Ga0070659_1004801891 255
640 3300005367 Ga0070667_100114032 Ga0070667_1001140323 255
641 3300005367 Ga0070667_100593947 Ga0070667_1005939471 255
642 3300005434 Ga0070709_10112514 Ga0070709_101125142 255
643 3300005437 Ga0070710_10000998 Ga0070710_1000099814 255
644 3300005439 Ga0070711_100000244 Ga0070711_10000024426 255
645 3300005439 Ga0070711_100051210 Ga0070711_1000512102 255
646 3300005441 Ga0070700_100000508 Ga0070700_1000005088 255
647 3300005441 Ga0070700_100333272 Ga0070700_1003332722 255
648 3300005444 Ga0070694_100044937 Ga0070694_1000449374 255
649 3300005455 Ga0070663_100061540 Ga0070663_1000615402 255
650 3300005456 Ga0070678_100001179 Ga0070678_10000117914 255
651 3300005457 Ga0070662_100057950 Ga0070662_1000579504 255
652 3300005459 Ga0068867_100000535 Ga0068867_10000053514 255
653 3300005539 Ga0068853_100001519 Ga0068853_1000015194 255
654 3300005546 Ga0070696_100001935 Ga0070696_10000193514 255
655 3300005546 Ga0070696_100048911 Ga0070696_1000489112 255
656 3300005549 Ga0070704_100000174 Ga0070704_10000017414 255
657 3300005549 Ga0070704_100130674 Ga0070704_1001306742 255
658 3300005578 Ga0068854_100021666 Ga0068854_1000216663 255
659 3300005616 Ga0068852_100006688 Ga0068852_1000066886 255
660 3300005617 Ga0068859_100000801 Ga0068859_1000008019 255
661 3300005718 Ga0068866_10007585 Ga0068866_100075856 255
662 3300005718 Ga0068866_10246645 Ga0068866_102466452 255
663 3300005719 Ga0068861_100001120 Ga0068861_10000112014 255
664 3300005842 Ga0068858_100001869 Ga0068858_1000018694 255
665 3300005843 Ga0068860_100000743 Ga0068860_10000074314 255
666 3300005843 Ga0068860_100391869 Ga0068860_1003918692 255
667 3300005844 Ga0068862_100001026 Ga0068862_10000102625 255
668 3300005844 Ga0068862_100562130 Ga0068862_1005621302 255
669 3300005981 Ga0081538_10072604 Ga0081538_100726042 255
670 3300006163 Ga0070715_10018541 Ga0070715_100185413 255
671 3300006173 Ga0070716_100004418 Ga0070716_1000044183 255
672 3300006173 Ga0070716_100013940 Ga0070716_1000139402 255
673 3300006175 Ga0070712_100001412 Ga0070712_1000014125 255
674 3300006175 Ga0070712_100034871 Ga0070712_1000348712 255
675 3300006844 Ga0075428_100021051 Ga0075428_1000210518 255
676 3300006846 Ga0075430_100010789 Ga0075430_1000107893 255
677 3300006847 Ga0075431_100071733 Ga0075431_1000717333 255
678 3300006881 Ga0068865_100000524 Ga0068865_10000052410 255
679 3300006881 Ga0068865_100033278 Ga0068865_1000332782 255
680 3300006931 Ga0097620_100000801 Ga0097620_1000008019 255
681 3300009098 Ga0105245_10000805 Ga0105245_1000080518 255
682 3300009101 Ga0105247_10000806 Ga0105247_100008062 255
683 3300009147 Ga0114129_10024084 Ga0114129_100240843 255
684 3300009148 Ga0105243_10000892 Ga0105243_1000089220 255
685 3300009148 Ga0105243_10158865 Ga0105243_101588652 255
686 3300009174 Ga0105241_10035178 Ga0105241_100351781 255
687 3300009176 Ga0105242_10000906 Ga0105242_1000090622 255
688 3300009177 Ga0105248_10773013 Ga0105248_107730131 255
689 3300009545 Ga0105237_10033645 Ga0105237_100336455 255
690 3300009553 Ga0105249_10016052 Ga0105249_100160524 255
691 3300009553 Ga0105249_10189334 Ga0105249_101893342 255
692 3300011119 Ga0105246_10142649 Ga0105246_101426492 255
693 3300013296 Ga0157374_10149026 Ga0157374_101490262 255
694 3300013297 Ga0157378_10002708 Ga0157378_100027086 255
695 3300013306 Ga0163162_10001291 Ga0163162_100012915 255
696 3300013306 Ga0163162_10432924 Ga0163162_104329242 255
697 3300013308 Ga0157375_10000618 Ga0157375_1000061829 255
698 3300013308 Ga0157375_10495819 Ga0157375_104958192 255
699 3300014326 Ga0157380_10001643 Ga0157380_1000164315 255
700 3300014326 Ga0157380_10204038 Ga0157380_102040382 255
701 3300014968 Ga0157379_10004513 Ga0157379_100045133 255
702 3300014969 Ga0157376_10129405 Ga0157376_101294052 255
703 3300017792 Ga0163161_10000599 Ga0163161_1000059914 255
704 3300025898 Ga0207692_10017950 Ga0207692_100179502 255
705 3300025899 Ga0207642_10003369 Ga0207642_100033694 255
706 3300025900 Ga0207710_10002182 Ga0207710_100021828 255
707 3300025901 Ga0207688_10000382 Ga0207688_1000038218 255
708 3300025915 Ga0207693_10001225 Ga0207693_1000122516 255
709 3300025915 Ga0207693_10001655 Ga0207693_100016553 255
710 3300025916 Ga0207663_10002421 Ga0207663_100024215 255
711 3300025916 Ga0207663_10011131 Ga0207663_100111315 255
712 3300025919 Ga0207657_10380975 Ga0207657_103809752 255
713 3300025927 Ga0207687_10001234 Ga0207687_100012347 255
714 3300025932 Ga0207690_10125202 Ga0207690_101252022 255
715 3300025933 Ga0207706_10007698 Ga0207706_100076982 255
716 3300025935 Ga0207709_10003516 Ga0207709_100035167 255
717 3300025936 Ga0207670_10263526 Ga0207670_102635262 255
718 3300025937 Ga0207669_10002869 Ga0207669_100028694 255
719 3300025937 Ga0207669_10381462 Ga0207669_103814621 255
720 3300025938 Ga0207704_10001123 Ga0207704_100011238 255
721 3300025938 Ga0207704_10500972 Ga0207704_105009722 255
722 3300025939 Ga0207665_10001338 Ga0207665_1000133814 255
723 3300025939 Ga0207665_10017396 Ga0207665_100173961 255
724 3300025942 Ga0207689_10006263 Ga0207689_100062632 255
725 3300025961 Ga0207712_10017694 Ga0207712_100176943 255
726 3300025986 Ga0207658_10005225 Ga0207658_100052258 255
727 3300026023 Ga0207677_10003876 Ga0207677_100038765 255
728 3300026035 Ga0207703_10446531 Ga0207703_104465312 255
729 3300026041 Ga0207639_10157364 Ga0207639_101573642 255
730 3300026067 Ga0207678_10047504 Ga0207678_100475045 255
731 3300026075 Ga0207708_10001666 Ga0207708_100016665 255
732 3300026075 Ga0207708_10022507 Ga0207708_100225072 255
733 3300026089 Ga0207648_10000503 Ga0207648_1000050312 255
734 3300026118 Ga0207675_100000419 Ga0207675_10000041930 255
735 3300026121 Ga0207683_10000386 Ga0207683_1000038630 255
736 3300026121 Ga0207683_10008028 Ga0207683_100080287 255
737 3300026142 Ga0207698_10024355 Ga0207698_100243555 255
738 3300028380 Ga0268265_10002139 Ga0268265_1000213914 255
739 3300028381 Ga0268264_10002766 Ga0268264_100027665 255
740 3300035114 Ga0373939_0085129 Ga0373939_0085129_176_1009 255
741 3300035691 Ga0373931_0105078 Ga0373931_0105078_490_1323 255
742 3300041413 Ga0439465_0031624 Ga0439465_0031624_299_1132 255
743 3300042435 Ga0439434_0043739 Ga0439434_0043739_238_1071 255
744 3300048903 Ga0496100_0191174 Ga0496100_0191174_451_1284 255
745 3300048903 Ga0496100_0310387 Ga0496100_0310387_309_1142 255
746 3300048904 Ga0496101_0000975 Ga0496101_0000975_1587_2420 255
747 3300048905 Ga0496102_0008220 Ga0496102_0008220_3402_4235 255
748 3300048905 Ga0496102_0138570 Ga0496102_0138570_1028_1861 255
749 3300048906 Ga0496103_0001134 Ga0496103_0001134_2576_3409 255
750 3300048906 Ga0496103_0078443 Ga0496103_0078443_898_1731 255
751 3300048909 Ga0496106_0000769 Ga0496106_0000769_11370_12203 255
752 3300048910 Ga0496107_0000672 Ga0496107_0000672_5850_6683 255
753 3300048910 Ga0496107_0188925 Ga0496107_0188925_647_1480 255
754 3300048917 Ga0496114_0000486 Ga0496114_0000486_2858_3691 255
755 3300048917 Ga0496114_0052904 Ga0496114_0052904_250_1083 255
756 3300048918 Ga0496115_0003434 Ga0496115_0003434_8607_9440 255
757 3300050507 nmdc:mga05p37_14495_c2 nmdc:mga05p37_14495_c2_2543_3376 255
758 3300050509 nmdc:mga0qj67_32207_c1 nmdc:mga0qj67_32207_c1_954_1787 255
759 3300050510 nmdc:mga06r32_93354_c1 nmdc:mga06r32_93354_c1_774_1607 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

57

311

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

62

254

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iun-assembly2.cif.gz_A crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with nad 0.9125 4 179
1hno-assembly1.cif.gz_A crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae 0.8928 3 177
3fdu-assembly1.cif.gz_B crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.8925 1 181
8ahz-assembly1.cif.gz_A native vird of streptomyces virginiae 0.8913 1 183
3r6h-assembly1.cif.gz_A crystal structure of an enoyl-coa hydratase (echa3) from mycobacterium marinum 0.8893 3 179
ID Description Score Start End Superfamily
2pbpA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9727 199 254 1.10.12.10
3hrxC02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9727 200 255 1.10.12.10
3gowE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9697 200 255 1.10.12.10
3hrxE02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9696 200 255 1.10.12.10
2qq3D02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9692 199 254 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2S2QXW3-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3 0.9191 2 147 GO:0005739
GO:0006631
GO:0016020
GO:0016836
AF-A0A3M0ZPQ4-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9156 2 181 GO:0006635
GO:0016836
GO:0016853
AF-A0A3D2FZ80-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9154 4 179 GO:0016829
GO:0016853
GO:0046395
AF-A0A2E4W181-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9118 3 182 GO:0004300
GO:0006631
AF-A0A519YCW7-F1-model_v4 deleted 0.9095 2 182

Feature Viewer

pLDDT pTM Quality
78.14 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map