F479478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 374 | 744 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_100378318|Ga0070712_1003783181 |
| Length | 311 |
| Sequence | MLAERFVAASLGSGPLHAAGMLAAGSAFPGRCSRPSLAPNAIAGISMRKDFERAYVTAHDNVAVLTLNHPEVMNAASVKMIRGLYAALDHIEKPDSGFRVVVMTGEGRGFCSGANLSEVPDEGASLGGVGSALDTAYHPFLRRLRDLRMPLVTAVNGAAAGVGMSMALMGDLVLAARSAYFLQAFARIGLVPDGGSTWLLPRLIGLARAKELSLLAEKLPSERALEWGLINRVVDDGALMDEALSLARRLAQGPTQSYALIRRLYWESPHNSYDEQLDLERQSQGKAGRTEDFIEGVTAFQQKRPAQFKGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 7 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 8 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 9 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 10 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 11 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 12 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 13 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 14 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 15 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 247 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 248 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 249 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 354 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 357 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 358 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 359 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 360 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 362 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 363 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 368 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 370 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 371 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 373 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.63 |
| Metatranscriptomes | 0.4 |
| Isolates | 1.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 13.31 |
| Nodule | 0.26 |
| Rhizoplane | 2.37 |
| Rhizosphere | 78.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24745J21846_1005543 | 3300002073 | Bacteria | 1380 |
| 2 | JGI24749J21850_1000704 | 3300002076 | Bacteria | 4809 |
| 3 | JGI25150J39212_1001047 | 3300002774 | Bacteria | 8444 |
| 4 | JGI25153J46596_10000007 | 3300003215 | Bacteria | 377573 |
| 5 | JGI25153J46596_10000535 | 3300003215 | Bacteria | 23843 |
| 6 | rootH2_10093086 | 3300003320 | Bacteria | 1498 |
| 7 | Ga0055526_1001270 | 3300003771 | Bacteria | 18096 |
| 8 | Ga0055526_1054591 | 3300003771 | Bacteria | 886 |
| 9 | Ga0055536_1007529 | 3300003781 | Bacteria | 4851 |
| 10 | Ga0055536_1031355 | 3300003781 | Bacteria | 1393 |
| 11 | Ga0055534_1015751 | 3300003784 | Bacteria | 1375 |
| 12 | Ga0055530_10000174 | 3300003791 | Bacteria | 58795 |
| 13 | Ga0055530_10000411 | 3300003791 | Bacteria | 38127 |
| 14 | Ga0055530_10011110 | 3300003791 | Bacteria | 3262 |
| 15 | Ga0055540_1000884 | 3300003792 | Bacteria | 19850 |
| 16 | Ga0055531_10001746 | 3300003794 | Bacteria | 15529 |
| 17 | Ga0055531_10014294 | 3300003794 | Bacteria | 3584 |
| 18 | Ga0065165_1008527 | 3300005262 | Bacteria | 4770 |
| 19 | Ga0065707_10082179 | 3300005295 | Bacteria | 20162 |
| 20 | Ga0070658_10045870 | 3300005327 | Bacteria | 3535 |
| 21 | Ga0070676_10423015 | 3300005328 | Bacteria | 931 |
| 22 | Ga0070690_100027745 | 3300005330 | Bacteria | 3502 |
| 23 | Ga0070670_100088543 | 3300005331 | Bacteria | 2661 |
| 24 | Ga0068869_100002460 | 3300005334 | Bacteria | 11170 |
| 25 | Ga0070666_10001920 | 3300005335 | Bacteria | 12642 |
| 26 | Ga0070666_10008011 | 3300005335 | Bacteria | 6535 |
| 27 | Ga0070666_10026179 | 3300005335 | Bacteria | 3808 |
| 28 | Ga0070666_10028389 | 3300005335 | Bacteria | 3671 |
| 29 | Ga0070680_100000110 | 3300005336 | Bacteria | 47139 |
| 30 | Ga0070680_100048217 | 3300005336 | Bacteria | 3471 |
| 31 | Ga0070680_100100450 | 3300005336 | Bacteria | 2401 |
| 32 | Ga0070680_100277283 | 3300005336 | Bacteria | 1420 |
| 33 | Ga0070680_100556418 | 3300005336 | Bacteria | 983 |
| 34 | Ga0068868_100000389 | 3300005338 | Bacteria | 29905 |
| 35 | Ga0070660_100016809 | 3300005339 | Bacteria | 5321 |
| 36 | Ga0070660_100455384 | 3300005339 | Bacteria | 1062 |
| 37 | Ga0070689_100017445 | 3300005340 | Bacteria | 5273 |
| 38 | Ga0070689_100035411 | 3300005340 | Bacteria | 3815 |
| 39 | Ga0070689_100063768 | 3300005340 | Bacteria | 2867 |
| 40 | Ga0070691_10001038 | 3300005341 | Bacteria | 11428 |
| 41 | Ga0070691_10010668 | 3300005341 | Bacteria | 4196 |
| 42 | Ga0070691_10022777 | 3300005341 | Bacteria | 2907 |
| 43 | Ga0070691_10163248 | 3300005341 | Bacteria | 1150 |
| 44 | Ga0070661_100000148 | 3300005344 | Bacteria | 57465 |
| 45 | Ga0070668_100000089 | 3300005347 | Bacteria | 56897 |
| 46 | Ga0070668_100002202 | 3300005347 | Bacteria | 14308 |
| 47 | Ga0070668_100007157 | 3300005347 | Bacteria | 8272 |
| 48 | Ga0070668_100073886 | 3300005347 | Bacteria | 2659 |
| 49 | Ga0070669_100003790 | 3300005353 | Bacteria | 10920 |
| 50 | Ga0070669_100513250 | 3300005353 | Unclassified | 995 |
| 51 | Ga0070671_100001555 | 3300005355 | Bacteria | 17272 |
| 52 | Ga0070674_100000125 | 3300005356 | Bacteria | 35199 |
| 53 | Ga0070674_100027141 | 3300005356 | Bacteria | 3749 |
| 54 | Ga0070688_100005716 | 3300005365 | Bacteria | 6574 |
| 55 | Ga0070659_100037928 | 3300005366 | Bacteria | 3757 |
| 56 | Ga0070659_100258406 | 3300005366 | Bacteria | 1445 |
| 57 | Ga0070659_100480189 | 3300005366 | Bacteria | 1057 |
| 58 | Ga0070667_100000081 | 3300005367 | Bacteria | 118819 |
| 59 | Ga0070667_100002070 | 3300005367 | Bacteria | 17750 |
| 60 | Ga0070667_100040279 | 3300005367 | Bacteria | 3917 |
| 61 | Ga0070667_100114032 | 3300005367 | Bacteria | 2346 |
| 62 | Ga0070667_100234157 | 3300005367 | Bacteria | 1638 |
| 63 | Ga0070667_100327458 | 3300005367 | Unclassified | 1383 |
| 64 | Ga0070667_100593947 | 3300005367 | Bacteria | 1020 |
| 65 | Ga0070709_10001050 | 3300005434 | Bacteria | 15238 |
| 66 | Ga0070709_10112514 | 3300005434 | Bacteria | 1832 |
| 67 | Ga0070714_100019518 | 3300005435 | Bacteria | 5525 |
| 68 | Ga0070714_100087620 | 3300005435 | Bacteria | 2723 |
| 69 | Ga0070714_100331190 | 3300005435 | Bacteria | 1426 |
| 70 | Ga0070714_100345800 | 3300005435 | Bacteria | 1396 |
| 71 | Ga0070713_100000004 | 3300005436 | Bacteria | 220768 |
| 72 | Ga0070713_100090194 | 3300005436 | Bacteria | 2635 |
| 73 | Ga0070713_100144620 | 3300005436 | Bacteria | 2109 |
| 74 | Ga0070710_10000998 | 3300005437 | Bacteria | 13476 |
| 75 | Ga0070710_10094523 | 3300005437 | Bacteria | 1769 |
| 76 | Ga0070710_10313797 | 3300005437 | Bacteria | 1027 |
| 77 | Ga0070711_100000244 | 3300005439 | Bacteria | 27954 |
| 78 | Ga0070711_100006293 | 3300005439 | Bacteria | 7148 |
| 79 | Ga0070711_100051210 | 3300005439 | Bacteria | 2834 |
| 80 | Ga0070711_100061692 | 3300005439 | Bacteria | 2611 |
| 81 | Ga0070700_100000508 | 3300005441 | Bacteria | 19367 |
| 82 | Ga0070700_100333272 | 3300005441 | Bacteria | 1119 |
| 83 | Ga0070694_100044937 | 3300005444 | Bacteria | 2958 |
| 84 | Ga0070663_100046764 | 3300005455 | Bacteria | 3063 |
| 85 | Ga0070663_100061540 | 3300005455 | Bacteria | 2704 |
| 86 | Ga0070678_100001179 | 3300005456 | Bacteria | 13874 |
| 87 | Ga0070662_100057950 | 3300005457 | Bacteria | 2816 |
| 88 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 89 | Ga0070681_10220409 | 3300005458 | Bacteria | 1812 |
| 90 | Ga0068867_100000535 | 3300005459 | Bacteria | 25035 |
| 91 | Ga0070685_10041332 | 3300005466 | Bacteria | 2626 |
| 92 | Ga0070707_100313669 | 3300005468 | Unclassified | 1524 |
| 93 | Ga0070707_100549924 | 3300005468 | Bacteria | 1117 |
| 94 | Ga0070698_100096571 | 3300005471 | Bacteria | 2932 |
| 95 | Ga0070679_100000032 | 3300005530 | Bacteria | 105384 |
| 96 | Ga0070679_100018143 | 3300005530 | Bacteria | 6823 |
| 97 | Ga0070684_100206949 | 3300005535 | Bacteria | 1788 |
| 98 | Ga0068853_100001204 | 3300005539 | Bacteria | 18449 |
| 99 | Ga0068853_100001519 | 3300005539 | Bacteria | 16875 |
| 100 | Ga0068853_100044850 | 3300005539 | Bacteria | 3786 |
| 101 | Ga0068853_100426163 | 3300005539 | Bacteria | 1245 |
| 102 | Ga0070686_100145603 | 3300005544 | Bacteria | 1654 |
| 103 | Ga0070695_100056560 | 3300005545 | Bacteria | 2532 |
| 104 | Ga0070695_100116187 | 3300005545 | Bacteria | 1824 |
| 105 | Ga0070695_100138448 | 3300005545 | Bacteria | 1685 |
| 106 | Ga0070695_100143869 | 3300005545 | Bacteria | 1657 |
| 107 | Ga0070695_100456704 | 3300005545 | Bacteria | 980 |
| 108 | Ga0070696_100001935 | 3300005546 | Bacteria | 13647 |
| 109 | Ga0070696_100048911 | 3300005546 | Bacteria | 2936 |
| 110 | Ga0070696_100121391 | 3300005546 | Bacteria | 1892 |
| 111 | Ga0070696_100132184 | 3300005546 | Bacteria | 1817 |
| 112 | Ga0070693_100030645 | 3300005547 | Bacteria | 2942 |
| 113 | Ga0070693_100152422 | 3300005547 | Bacteria | 1465 |
| 114 | Ga0070665_100081373 | 3300005548 | Bacteria | 3244 |
| 115 | Ga0070704_100000174 | 3300005549 | Bacteria | 25726 |
| 116 | Ga0070704_100130674 | 3300005549 | Bacteria | 1946 |
| 117 | Ga0068855_100012015 | 3300005563 | Bacteria | 10468 |
| 118 | Ga0068855_100018471 | 3300005563 | Bacteria | 8380 |
| 119 | Ga0068855_100080830 | 3300005563 | Bacteria | 3769 |
| 120 | Ga0068855_100174079 | 3300005563 | Bacteria | 2436 |
| 121 | Ga0068855_100326846 | 3300005563 | Bacteria | 1694 |
| 122 | Ga0068854_100021666 | 3300005578 | Bacteria | 4363 |
| 123 | Ga0068854_100051117 | 3300005578 | Bacteria | 2960 |
| 124 | Ga0068854_100111245 | 3300005578 | Bacteria | 2066 |
| 125 | Ga0068856_100000144 | 3300005614 | Bacteria | 72020 |
| 126 | Ga0068856_100036083 | 3300005614 | Bacteria | 4847 |
| 127 | Ga0068856_100386733 | 3300005614 | Unclassified | 1419 |
| 128 | Ga0068852_100005341 | 3300005616 | Bacteria | 9173 |
| 129 | Ga0068852_100006688 | 3300005616 | Bacteria | 8356 |
| 130 | Ga0068859_100000801 | 3300005617 | Bacteria | 31888 |
| 131 | Ga0068859_100039771 | 3300005617 | Plasmid | 4719 |
| 132 | Ga0068864_100003647 | 3300005618 | Bacteria | 12727 |
| 133 | Ga0068864_100020321 | 3300005618 | Bacteria | 5555 |
| 134 | Ga0068864_100160901 | 3300005618 | Unclassified | 2041 |
| 135 | Ga0068866_10007585 | 3300005718 | Bacteria | 4548 |
| 136 | Ga0068866_10246645 | 3300005718 | Bacteria | 1090 |
| 137 | Ga0068861_100001120 | 3300005719 | Bacteria | 16617 |
| 138 | Ga0068861_100001216 | 3300005719 | Bacteria | 16031 |
| 139 | Ga0068863_100000099 | 3300005841 | Bacteria | 94076 |
| 140 | Ga0068863_100031803 | 3300005841 | Bacteria | 5034 |
| 141 | Ga0068858_100000432 | 3300005842 | Bacteria | 43614 |
| 142 | Ga0068858_100001869 | 3300005842 | Bacteria | 21484 |
| 143 | Ga0068858_100025449 | 3300005842 | Bacteria | 5506 |
| 144 | Ga0068858_100139765 | 3300005842 | Bacteria | 2273 |
| 145 | Ga0068860_100000743 | 3300005843 | Bacteria | 37175 |
| 146 | Ga0068860_100002902 | 3300005843 | Bacteria | 17750 |
| 147 | Ga0068860_100009295 | 3300005843 | Bacteria | 9767 |
| 148 | Ga0068860_100391869 | 3300005843 | Bacteria | 1373 |
| 149 | Ga0068862_100001026 | 3300005844 | Bacteria | 26891 |
| 150 | Ga0068862_100002243 | 3300005844 | Bacteria | 17318 |
| 151 | Ga0068862_100031511 | 3300005844 | Bacteria | 4477 |
| 152 | Ga0068862_100092132 | 3300005844 | Bacteria | 2641 |
| 153 | Ga0068862_100170500 | 3300005844 | Bacteria | 1948 |
| 154 | Ga0068862_100562130 | 3300005844 | Bacteria | 1091 |
| 155 | Ga0081455_10001531 | 3300005937 | Bacteria | 28476 |
| 156 | Ga0081455_10071738 | 3300005937 | Bacteria | 2869 |
| 157 | Ga0081538_10072604 | 3300005981 | Bacteria | 1885 |
| 158 | Ga0070717_10000965 | 3300006028 | Bacteria | 19195 |
| 159 | Ga0075368_10000095 | 3300006042 | Bacteria | 22249 |
| 160 | Ga0075363_100000751 | 3300006048 | Bacteria | 11082 |
| 161 | Ga0075363_100002626 | 3300006048 | Bacteria | 7403 |
| 162 | Ga0075363_100004933 | 3300006048 | Bacteria | 5900 |
| 163 | Ga0075364_10003024 | 3300006051 | Bacteria | 9499 |
| 164 | Ga0075364_10045967 | 3300006051 | Bacteria | 2842 |
| 165 | Ga0070715_10018541 | 3300006163 | Bacteria | 2653 |
| 166 | Ga0070715_10103781 | 3300006163 | Bacteria | 1330 |
| 167 | Ga0070715_10145784 | 3300006163 | Bacteria | 1155 |
| 168 | Ga0070716_100004418 | 3300006173 | Bacteria | 6723 |
| 169 | Ga0070716_100012336 | 3300006173 | Bacteria | 4329 |
| 170 | Ga0070716_100013940 | 3300006173 | Bacteria | 4109 |
| 171 | Ga0070712_100000293 | 3300006175 | Bacteria | 28103 |
| 172 | Ga0070712_100000567 | 3300006175 | Bacteria | 21500 |
| 173 | Ga0070712_100001412 | 3300006175 | Bacteria | 14596 |
| 174 | Ga0070712_100034871 | 3300006175 | Bacteria | 3412 |
| 175 | Ga0070712_100378318 | 3300006175 | Bacteria | 1165 |
| 176 | Ga0075362_10000114 | 3300006177 | Bacteria | 22522 |
| 177 | Ga0075362_10000265 | 3300006177 | Bacteria | 14605 |
| 178 | Ga0075362_10029599 | 3300006177 | Bacteria | 2361 |
| 179 | Ga0075367_10003384 | 3300006178 | Bacteria | 7594 |
| 180 | Ga0075369_10001348 | 3300006186 | Bacteria | 8343 |
| 181 | Ga0075369_10003423 | 3300006186 | Bacteria | 5776 |
| 182 | Ga0075366_10000415 | 3300006195 | Bacteria | 19942 |
| 183 | Ga0075370_10000048 | 3300006353 | Bacteria | 36696 |
| 184 | Ga0075370_10001563 | 3300006353 | Bacteria | 10048 |
| 185 | Ga0075370_10017171 | 3300006353 | Bacteria | 3906 |
| 186 | Ga0075370_10037022 | 3300006353 | Bacteria | 2743 |
| 187 | Ga0075428_100021051 | 3300006844 | Bacteria | 7222 |
| 188 | Ga0075430_100010789 | 3300006846 | Bacteria | 7741 |
| 189 | Ga0075431_100071733 | 3300006847 | Bacteria | 3574 |
| 190 | Ga0075433_10002091 | 3300006852 | Bacteria | 15112 |
| 191 | Ga0075433_10147527 | 3300006852 | Bacteria | 2091 |
| 192 | Ga0075434_100014637 | 3300006871 | Bacteria | 7503 |
| 193 | Ga0075434_100029766 | 3300006871 | Bacteria | 5374 |
| 194 | Ga0075434_100466078 | 3300006871 | Bacteria | 1285 |
| 195 | Ga0075434_100560615 | 3300006871 | Bacteria | 1162 |
| 196 | Ga0068865_100000524 | 3300006881 | Bacteria | 21450 |
| 197 | Ga0068865_100033278 | 3300006881 | Bacteria | 3450 |
| 198 | Ga0075436_100000574 | 3300006914 | Bacteria | 24043 |
| 199 | Ga0075436_100018816 | 3300006914 | Bacteria | 4730 |
| 200 | Ga0097620_100000801 | 3300006931 | Bacteria | 31888 |
| 201 | Ga0097620_100039774 | 3300006931 | Plasmid | 4719 |
| 202 | Ga0079104_1021103 | 3300006946 | Bacteria | 1779 |
| 203 | Ga0075435_100143759 | 3300007076 | Bacteria | 2003 |
| 204 | Ga0075435_100229506 | 3300007076 | Bacteria | 1577 |
| 205 | Ga0105240_10006228 | 3300009093 | Bacteria | 17548 |
| 206 | Ga0105240_10013961 | 3300009093 | Bacteria | 10996 |
| 207 | Ga0105240_10036213 | 3300009093 | Bacteria | 6350 |
| 208 | Ga0105240_10174368 | 3300009093 | Bacteria | 2543 |
| 209 | Ga0105240_10828420 | 3300009093 | Bacteria | 1000 |
| 210 | Ga0111539_10004799 | 3300009094 | Bacteria | 17631 |
| 211 | Ga0111539_10159233 | 3300009094 | Bacteria | 2641 |
| 212 | Ga0111539_10653894 | 3300009094 | Bacteria | 1224 |
| 213 | Ga0105245_10000805 | 3300009098 | Bacteria | 28521 |
| 214 | Ga0105247_10000806 | 3300009101 | Bacteria | 23917 |
| 215 | Ga0105247_10032949 | 3300009101 | Bacteria | 3149 |
| 216 | Ga0114129_10024084 | 3300009147 | Bacteria | 8626 |
| 217 | Ga0114129_10177528 | 3300009147 | Bacteria | 2900 |
| 218 | Ga0114129_11227502 | 3300009147 | Bacteria | 932 |
| 219 | Ga0105243_10000892 | 3300009148 | Bacteria | 28107 |
| 220 | Ga0105243_10158865 | 3300009148 | Bacteria | 1947 |
| 221 | Ga0105241_10035178 | 3300009174 | Bacteria | 3768 |
| 222 | Ga0105241_10048218 | 3300009174 | Bacteria | 3241 |
| 223 | Ga0105241_10057050 | 3300009174 | Bacteria | 2995 |
| 224 | Ga0105242_10000906 | 3300009176 | Bacteria | 23034 |
| 225 | Ga0105248_10000005 | 3300009177 | Bacteria | 673111 |
| 226 | Ga0105248_10003309 | 3300009177 | Bacteria | 17885 |
| 227 | Ga0105248_10062045 | 3300009177 | Bacteria | 4198 |
| 228 | Ga0105248_10238795 | 3300009177 | Unclassified | 2046 |
| 229 | Ga0105248_10607108 | 3300009177 | Bacteria | 1234 |
| 230 | Ga0105248_10773013 | 3300009177 | Bacteria | 1084 |
| 231 | Ga0105237_10017309 | 3300009545 | Bacteria | 7473 |
| 232 | Ga0105237_10033645 | 3300009545 | Bacteria | 5194 |
| 233 | Ga0105237_10161873 | 3300009545 | Bacteria | 2236 |
| 234 | Ga0105237_10454853 | 3300009545 | Bacteria | 1286 |
| 235 | Ga0105238_10000847 | 3300009551 | Bacteria | 31513 |
| 236 | Ga0105238_10006764 | 3300009551 | Bacteria | 11456 |
| 237 | Ga0105238_10013382 | 3300009551 | Bacteria | 8281 |
| 238 | Ga0105238_10228957 | 3300009551 | Bacteria | 1836 |
| 239 | Ga0105238_10372514 | 3300009551 | Bacteria | 1418 |
| 240 | Ga0105238_10521210 | 3300009551 | Bacteria | 1191 |
| 241 | Ga0105238_10525531 | 3300009551 | Bacteria | 1186 |
| 242 | Ga0105249_10002484 | 3300009553 | Bacteria | 15975 |
| 243 | Ga0105249_10011618 | 3300009553 | Bacteria | 7740 |
| 244 | Ga0105249_10016052 | 3300009553 | Bacteria | 6637 |
| 245 | Ga0105249_10189334 | 3300009553 | Bacteria | 2007 |
| 246 | Ga0105239_10005268 | 3300010375 | Bacteria | 15205 |
| 247 | Ga0105239_10006709 | 3300010375 | Bacteria | 13295 |
| 248 | Ga0105239_10157411 | 3300010375 | Bacteria | 2538 |
| 249 | Ga0105239_10196186 | 3300010375 | Bacteria | 2261 |
| 250 | Ga0105246_10142649 | 3300011119 | Bacteria | 1803 |
| 251 | Ga0157371_10001910 | 3300013102 | Bacteria | 20840 |
| 252 | Ga0157371_10059879 | 3300013102 | Bacteria | 2700 |
| 253 | Ga0157370_10006919 | 3300013104 | Bacteria | 12398 |
| 254 | Ga0157370_10013933 | 3300013104 | Bacteria | 8256 |
| 255 | Ga0157370_10022363 | 3300013104 | Bacteria | 6291 |
| 256 | Ga0157369_10010560 | 3300013105 | Bacteria | 10508 |
| 257 | Ga0157374_10149026 | 3300013296 | Bacteria | 2274 |
| 258 | Ga0157378_10002708 | 3300013297 | Bacteria | 15786 |
| 259 | Ga0157378_10130928 | 3300013297 | Bacteria | 2322 |
| 260 | Ga0163162_10001291 | 3300013306 | Bacteria | 23417 |
| 261 | Ga0163162_10088265 | 3300013306 | Bacteria | 3181 |
| 262 | Ga0163162_10432924 | 3300013306 | Bacteria | 1447 |
| 263 | Ga0157372_10004635 | 3300013307 | Bacteria | 14606 |
| 264 | Ga0157372_10011558 | 3300013307 | Bacteria | 9392 |
| 265 | Ga0157372_10044607 | 3300013307 | Bacteria | 4914 |
| 266 | Ga0157372_10095779 | 3300013307 | Bacteria | 3382 |
| 267 | Ga0157372_10283496 | 3300013307 | Bacteria | 1926 |
| 268 | Ga0157375_10000618 | 3300013308 | Bacteria | 31552 |
| 269 | Ga0157375_10495819 | 3300013308 | Bacteria | 1386 |
| 270 | Ga0157380_10000346 | 3300014326 | Bacteria | 27776 |
| 271 | Ga0157380_10001643 | 3300014326 | Bacteria | 14727 |
| 272 | Ga0157380_10204038 | 3300014326 | Bacteria | 1756 |
| 273 | Ga0157379_10004376 | 3300014968 | Bacteria | 12087 |
| 274 | Ga0157379_10004513 | 3300014968 | Bacteria | 11942 |
| 275 | Ga0157379_10020130 | 3300014968 | Bacteria | 5898 |
| 276 | Ga0157379_10022857 | 3300014968 | Bacteria | 5542 |
| 277 | Ga0157379_10053671 | 3300014968 | Bacteria | 3601 |
| 278 | Ga0157379_10737004 | 3300014968 | Bacteria | 927 |
| 279 | Ga0157376_10129405 | 3300014969 | Bacteria | 2250 |
| 280 | Ga0163161_10000599 | 3300017792 | Bacteria | 28842 |
| 281 | Ga0197907_10260788 | 3300020069 | Bacteria | 925 |
| 282 | Ga0206350_11054501 | 3300020080 | Bacteria | 868 |
| 283 | Ga0213876_10000201 | 3300021384 | Bacteria | 61091 |
| 284 | Ga0213876_10026630 | 3300021384 | Bacteria | 3050 |
| 285 | Ga0213876_10038055 | 3300021384 | Bacteria | 2538 |
| 286 | Ga0213875_10000228 | 3300021388 | Bacteria | 56927 |
| 287 | Ga0224712_10002545 | 3300022467 | Bacteria | 4525 |
| 288 | Ga0207425_1000094 | 3300025245 | Bacteria | 85629 |
| 289 | Ga0209026_1003810 | 3300025250 | Bacteria | 4765 |
| 290 | Ga0209129_1017796 | 3300025258 | Bacteria | 1383 |
| 291 | Ga0209565_1000386 | 3300025263 | Bacteria | 37364 |
| 292 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 293 | Ga0209676_1000084 | 3300025292 | Bacteria | 274330 |
| 294 | Ga0209676_1000259 | 3300025292 | Bacteria | 111746 |
| 295 | Ga0209676_1000678 | 3300025292 | Bacteria | 48300 |
| 296 | Ga0209676_1011926 | 3300025292 | Bacteria | 3460 |
| 297 | Ga0209025_1000727 | 3300025294 | Bacteria | 55857 |
| 298 | Ga0209025_1010159 | 3300025294 | Bacteria | 6422 |
| 299 | Ga0209025_1090805 | 3300025294 | Bacteria | 999 |
| 300 | Ga0209564_1002114 | 3300025295 | Bacteria | 16891 |
| 301 | Ga0209564_1015689 | 3300025295 | Bacteria | 3064 |
| 302 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 303 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 304 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 305 | Ga0209050_1000104 | 3300025298 | Bacteria | 228921 |
| 306 | Ga0209050_1000342 | 3300025298 | Bacteria | 92644 |
| 307 | Ga0209050_1001308 | 3300025298 | Bacteria | 27984 |
| 308 | Ga0209050_1017052 | 3300025298 | Bacteria | 2925 |
| 309 | Ga0207426_1023307 | 3300025302 | Bacteria | 2113 |
| 310 | Ga0209051_1000226 | 3300025303 | Bacteria | 94990 |
| 311 | Ga0209257_1000120 | 3300025304 | Bacteria | 223025 |
| 312 | Ga0209257_1000174 | 3300025304 | Bacteria | 165255 |
| 313 | Ga0209257_1007904 | 3300025304 | Bacteria | 6251 |
| 314 | Ga0209257_1011412 | 3300025304 | Bacteria | 4280 |
| 315 | Ga0207692_10017950 | 3300025898 | Bacteria | 3166 |
| 316 | Ga0207692_10091624 | 3300025898 | Bacteria | 1650 |
| 317 | Ga0207692_10103439 | 3300025898 | Bacteria | 1568 |
| 318 | Ga0207642_10003369 | 3300025899 | Bacteria | 5036 |
| 319 | Ga0207710_10002182 | 3300025900 | Bacteria | 9199 |
| 320 | Ga0207688_10000382 | 3300025901 | Bacteria | 20691 |
| 321 | Ga0207680_10005625 | 3300025903 | Bacteria | 5999 |
| 322 | Ga0207680_10008005 | 3300025903 | Bacteria | 5175 |
| 323 | Ga0207685_10165699 | 3300025905 | Bacteria | 1013 |
| 324 | Ga0207699_10000181 | 3300025906 | Bacteria | 38302 |
| 325 | Ga0207645_10317893 | 3300025907 | Bacteria | 1038 |
| 326 | Ga0207705_10000391 | 3300025909 | Bacteria | 38775 |
| 327 | Ga0207654_10031910 | 3300025911 | Bacteria | 2905 |
| 328 | Ga0207654_10041310 | 3300025911 | Bacteria | 2603 |
| 329 | Ga0207654_10275834 | 3300025911 | Bacteria | 1136 |
| 330 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 331 | Ga0207707_10008623 | 3300025912 | Bacteria | 8843 |
| 332 | Ga0207695_10010920 | 3300025913 | Bacteria | 11046 |
| 333 | Ga0207695_10106753 | 3300025913 | Bacteria | 2786 |
| 334 | Ga0207695_10140690 | 3300025913 | Bacteria | 2362 |
| 335 | Ga0207671_10034656 | 3300025914 | Bacteria | 3750 |
| 336 | Ga0207671_10115634 | 3300025914 | Bacteria | 2045 |
| 337 | Ga0207693_10000163 | 3300025915 | Bacteria | 59871 |
| 338 | Ga0207693_10001225 | 3300025915 | Bacteria | 22880 |
| 339 | Ga0207693_10001655 | 3300025915 | Bacteria | 19649 |
| 340 | Ga0207693_10001708 | 3300025915 | Bacteria | 19323 |
| 341 | Ga0207693_10295073 | 3300025915 | Bacteria | 1270 |
| 342 | Ga0207663_10002421 | 3300025916 | Bacteria | 8959 |
| 343 | Ga0207663_10011131 | 3300025916 | Bacteria | 4818 |
| 344 | Ga0207663_10023145 | 3300025916 | Bacteria | 3561 |
| 345 | Ga0207660_10001819 | 3300025917 | Bacteria | 14214 |
| 346 | Ga0207660_10008613 | 3300025917 | Bacteria | 6598 |
| 347 | Ga0207660_10041404 | 3300025917 | Bacteria | 3228 |
| 348 | Ga0207657_10001337 | 3300025919 | Bacteria | 26203 |
| 349 | Ga0207657_10380975 | 3300025919 | Bacteria | 1111 |
| 350 | Ga0207649_10000153 | 3300025920 | Bacteria | 56646 |
| 351 | Ga0207652_10000419 | 3300025921 | Bacteria | 44102 |
| 352 | Ga0207652_10019708 | 3300025921 | Bacteria | 5549 |
| 353 | Ga0207652_10021313 | 3300025921 | Bacteria | 5349 |
| 354 | Ga0207652_10024819 | 3300025921 | Bacteria | 4975 |
| 355 | Ga0207646_10113189 | 3300025922 | Bacteria | 2436 |
| 356 | Ga0207646_10275399 | 3300025922 | Unclassified | 1521 |
| 357 | Ga0207681_10005139 | 3300025923 | Bacteria | 8039 |
| 358 | Ga0207681_10032420 | 3300025923 | Bacteria | 3420 |
| 359 | Ga0207681_10054823 | 3300025923 | Bacteria | 2712 |
| 360 | Ga0207694_10025854 | 3300025924 | Bacteria | 4464 |
| 361 | Ga0207694_10055978 | 3300025924 | Bacteria | 3063 |
| 362 | Ga0207694_10217882 | 3300025924 | Bacteria | 1556 |
| 363 | Ga0207694_10255815 | 3300025924 | Bacteria | 1434 |
| 364 | Ga0207694_10258647 | 3300025924 | Bacteria | 1426 |
| 365 | Ga0207650_10004495 | 3300025925 | Bacteria | 9536 |
| 366 | Ga0207687_10001234 | 3300025927 | Bacteria | 17530 |
| 367 | Ga0207687_10423169 | 3300025927 | Bacteria | 1099 |
| 368 | Ga0207700_10000011 | 3300025928 | Bacteria | 266323 |
| 369 | Ga0207700_10011148 | 3300025928 | Bacteria | 5718 |
| 370 | Ga0207700_10092102 | 3300025928 | Unclassified | 2396 |
| 371 | Ga0207664_10033147 | 3300025929 | Bacteria | 3966 |
| 372 | Ga0207664_10037985 | 3300025929 | Bacteria | 3731 |
| 373 | Ga0207664_10592225 | 3300025929 | Unclassified | 996 |
| 374 | Ga0207644_10001453 | 3300025931 | Bacteria | 15277 |
| 375 | Ga0207690_10032885 | 3300025932 | Bacteria | 3331 |
| 376 | Ga0207690_10125202 | 3300025932 | Bacteria | 1873 |
| 377 | Ga0207706_10007698 | 3300025933 | Bacteria | 9945 |
| 378 | Ga0207709_10003516 | 3300025935 | Bacteria | 9272 |
| 379 | Ga0207670_10263526 | 3300025936 | Bacteria | 1337 |
| 380 | Ga0207669_10002869 | 3300025937 | Bacteria | 7392 |
| 381 | Ga0207669_10381462 | 3300025937 | Bacteria | 1098 |
| 382 | Ga0207704_10001123 | 3300025938 | Bacteria | 11913 |
| 383 | Ga0207704_10500972 | 3300025938 | Bacteria | 979 |
| 384 | Ga0207665_10001338 | 3300025939 | Bacteria | 16617 |
| 385 | Ga0207665_10017396 | 3300025939 | Bacteria | 4724 |
| 386 | Ga0207665_10020902 | 3300025939 | Bacteria | 4302 |
| 387 | Ga0207665_10270744 | 3300025939 | Bacteria | 1261 |
| 388 | Ga0207711_10000002 | 3300025941 | Bacteria | 1228676 |
| 389 | Ga0207711_10029196 | 3300025941 | Bacteria | 4648 |
| 390 | Ga0207711_10184860 | 3300025941 | Bacteria | 1897 |
| 391 | Ga0207711_10649117 | 3300025941 | Bacteria | 984 |
| 392 | Ga0207689_10006263 | 3300025942 | Bacteria | 10546 |
| 393 | Ga0207667_10011191 | 3300025949 | Bacteria | 10442 |
| 394 | Ga0207667_10076783 | 3300025949 | Bacteria | 3466 |
| 395 | Ga0207667_10167552 | 3300025949 | Bacteria | 2258 |
| 396 | Ga0207712_10008147 | 3300025961 | Bacteria | 6630 |
| 397 | Ga0207712_10017694 | 3300025961 | Bacteria | 4633 |
| 398 | Ga0207712_10030366 | 3300025961 | Bacteria | 3633 |
| 399 | Ga0207668_10000051 | 3300025972 | Bacteria | 98624 |
| 400 | Ga0207668_10000287 | 3300025972 | Bacteria | 33118 |
| 401 | Ga0207668_10065194 | 3300025972 | Bacteria | 2577 |
| 402 | Ga0207640_10241577 | 3300025981 | Unclassified | 1396 |
| 403 | Ga0207658_10000062 | 3300025986 | Bacteria | 118845 |
| 404 | Ga0207658_10001520 | 3300025986 | Bacteria | 18016 |
| 405 | Ga0207658_10005225 | 3300025986 | Bacteria | 8930 |
| 406 | Ga0207658_10200619 | 3300025986 | Bacteria | 1665 |
| 407 | Ga0207677_10003876 | 3300026023 | Bacteria | 7965 |
| 408 | Ga0207703_10001408 | 3300026035 | Bacteria | 21917 |
| 409 | Ga0207703_10006894 | 3300026035 | Bacteria | 9043 |
| 410 | Ga0207703_10088875 | 3300026035 | Bacteria | 2594 |
| 411 | Ga0207703_10446531 | 3300026035 | Bacteria | 1207 |
| 412 | Ga0207639_10065428 | 3300026041 | Bacteria | 2822 |
| 413 | Ga0207639_10157364 | 3300026041 | Bacteria | 1910 |
| 414 | Ga0207678_10031842 | 3300026067 | Bacteria | 4598 |
| 415 | Ga0207678_10047504 | 3300026067 | Bacteria | 3712 |
| 416 | Ga0207708_10001666 | 3300026075 | Bacteria | 16496 |
| 417 | Ga0207708_10022507 | 3300026075 | Bacteria | 4760 |
| 418 | Ga0207702_10000226 | 3300026078 | Bacteria | 65919 |
| 419 | Ga0207702_10025921 | 3300026078 | Bacteria | 4867 |
| 420 | Ga0207641_10000014 | 3300026088 | Bacteria | 336170 |
| 421 | Ga0207641_10000857 | 3300026088 | Bacteria | 32190 |
| 422 | Ga0207641_10024890 | 3300026088 | Bacteria | 4934 |
| 423 | Ga0207648_10000503 | 3300026089 | Bacteria | 43631 |
| 424 | Ga0207648_10315454 | 3300026089 | Bacteria | 1404 |
| 425 | Ga0207676_10002576 | 3300026095 | Bacteria | 12935 |
| 426 | Ga0207674_10000330 | 3300026116 | Bacteria | 60515 |
| 427 | Ga0207674_10032897 | 3300026116 | Bacteria | 5435 |
| 428 | Ga0207675_100000419 | 3300026118 | Bacteria | 41020 |
| 429 | Ga0207675_100002220 | 3300026118 | Bacteria | 19294 |
| 430 | Ga0207675_100152325 | 3300026118 | Bacteria | 2201 |
| 431 | Ga0207683_10000386 | 3300026121 | Bacteria | 40766 |
| 432 | Ga0207683_10008028 | 3300026121 | Bacteria | 9024 |
| 433 | Ga0207698_10024355 | 3300026142 | Bacteria | 4247 |
| 434 | Ga0209281_1014127 | 3300027111 | Bacteria | 1698 |
| 435 | Ga0209813_10000013 | 3300027866 | Bacteria | 89768 |
| 436 | Ga0207428_10073233 | 3300027907 | Bacteria | 2688 |
| 437 | Ga0268266_10100381 | 3300028379 | Bacteria | 2549 |
| 438 | Ga0268265_10001738 | 3300028380 | Bacteria | 17521 |
| 439 | Ga0268265_10002139 | 3300028380 | Bacteria | 15330 |
| 440 | Ga0268265_10095239 | 3300028380 | Unclassified | 2390 |
| 441 | Ga0268265_10148374 | 3300028380 | Bacteria | 1974 |
| 442 | Ga0268265_10280687 | 3300028380 | Bacteria | 1490 |
| 443 | Ga0268265_10544287 | 3300028380 | Bacteria | 1101 |
| 444 | Ga0268264_10001483 | 3300028381 | Bacteria | 21901 |
| 445 | Ga0268264_10002766 | 3300028381 | Bacteria | 15302 |
| 446 | Ga0268264_10012308 | 3300028381 | Bacteria | 7041 |
| 447 | Ga0268264_10295208 | 3300028381 | Bacteria | 1523 |
| 448 | Ga0265338_10000005 | 3300028800 | Bacteria | 571137 |
| 449 | Ga0265338_10008211 | 3300028800 | Bacteria | 12716 |
| 450 | Ga0265338_10018931 | 3300028800 | Bacteria | 7340 |
| 451 | Ga0265338_10143061 | 3300028800 | Bacteria | 1870 |
| 452 | Ga0265332_10075042 | 3300031238 | Bacteria | 1438 |
| 453 | Ga0265332_10105667 | 3300031238 | Unclassified | 1187 |
| 454 | Ga0265320_10004251 | 3300031240 | Bacteria | 9407 |
| 455 | Ga0265325_10000005 | 3300031241 | Bacteria | 321343 |
| 456 | Ga0265325_10000098 | 3300031241 | Bacteria | 61384 |
| 457 | Ga0265325_10003316 | 3300031241 | Bacteria | 10584 |
| 458 | Ga0265325_10005575 | 3300031241 | Bacteria | 7764 |
| 459 | Ga0265340_10005438 | 3300031247 | Bacteria | 7073 |
| 460 | Ga0265340_10034886 | 3300031247 | Bacteria | 2500 |
| 461 | Ga0265340_10112087 | 3300031247 | Bacteria | 1260 |
| 462 | Ga0265339_10001877 | 3300031249 | Bacteria | 15427 |
| 463 | Ga0265339_10002558 | 3300031249 | Bacteria | 12972 |
| 464 | Ga0265339_10002598 | 3300031249 | Bacteria | 12887 |
| 465 | Ga0265339_10006756 | 3300031249 | Bacteria | 7488 |
| 466 | Ga0265339_10012302 | 3300031249 | Bacteria | 5228 |
| 467 | Ga0265339_10023687 | 3300031249 | Bacteria | 3547 |
| 468 | Ga0265339_10038996 | 3300031249 | Bacteria | 2647 |
| 469 | Ga0265339_10164828 | 3300031249 | Bacteria | 1113 |
| 470 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 471 | Ga0265331_10000793 | 3300031250 | Bacteria | 26281 |
| 472 | Ga0265331_10012945 | 3300031250 | Bacteria | 4497 |
| 473 | Ga0265327_10000187 | 3300031251 | Bacteria | 131135 |
| 474 | Ga0265316_10197283 | 3300031344 | Bacteria | 1493 |
| 475 | Ga0265313_10010486 | 3300031595 | Bacteria | 5850 |
| 476 | Ga0265313_10014393 | 3300031595 | Bacteria | 4676 |
| 477 | Ga0265313_10033370 | 3300031595 | Bacteria | 2616 |
| 478 | Ga0265314_10000125 | 3300031711 | Bacteria | 118671 |
| 479 | Ga0265314_10000835 | 3300031711 | Bacteria | 36433 |
| 480 | Ga0265314_10012124 | 3300031711 | Bacteria | 7060 |
| 481 | Ga0265314_10047873 | 3300031711 | Bacteria | 3005 |
| 482 | Ga0265314_10117820 | 3300031711 | Bacteria | 1677 |
| 483 | Ga0265314_10118251 | 3300031711 | Bacteria | 1673 |
| 484 | Ga0265314_10169539 | 3300031711 | Bacteria | 1319 |
| 485 | Ga0265342_10012164 | 3300031712 | Bacteria | 5838 |
| 486 | Ga0265342_10076101 | 3300031712 | Bacteria | 1946 |
| 487 | Ga0307412_10055008 | 3300031911 | Bacteria | 2645 |
| 488 | Ga0307412_10075526 | 3300031911 | Bacteria | 2312 |
| 489 | Ga0307414_10003389 | 3300032004 | Bacteria | 8514 |
| 490 | Ga0307414_10013889 | 3300032004 | Bacteria | 4809 |
| 491 | Ga0307414_10062012 | 3300032004 | Bacteria | 2651 |
| 492 | Ga0373944_0091004 | 3300035089 | Bacteria | 1020 |
| 493 | Ga0373939_0085129 | 3300035114 | Bacteria | 1058 |
| 494 | Ga0373941_0064335 | 3300035115 | Bacteria | 1202 |
| 495 | Ga0373946_0022552 | 3300035171 | Bacteria | 2452 |
| 496 | Ga0373955_0022124 | 3300035172 | Bacteria | 3221 |
| 497 | Ga0373955_0069437 | 3300035172 | Bacteria | 1966 |
| 498 | Ga0316574_0003926 | 3300035398 | Bacteria | 7731 |
| 499 | Ga0373931_0105078 | 3300035691 | Bacteria | 1594 |
| 500 | Ga0373935_0069528 | 3300035692 | Bacteria | 2268 |
| 501 | Ga0373927_0053577 | 3300035695 | Bacteria | 2610 |
| 502 | Ga0373947_0008391 | 3300035725 | Bacteria | 5952 |
| 503 | Ga0373947_0130056 | 3300035725 | Bacteria | 1607 |
| 504 | Ga0373937_0098051 | 3300036401 | Bacteria | 2718 |
| 505 | Ga0373937_0258748 | 3300036401 | Bacteria | 1641 |
| 506 | Ga0373937_0568685 | 3300036401 | Unclassified | 1077 |
| 507 | Ga0316584_0212852 | 3300036712 | Bacteria | 1422 |
| 508 | Ga0373925_0025017 | 3300037068 | Bacteria | 4360 |
| 509 | Ga0373925_0037097 | 3300037068 | Bacteria | 3597 |
| 510 | Ga0395898_0079034 | 3300037466 | Bacteria | 3173 |
| 511 | Ga0395898_0306029 | 3300037466 | Bacteria | 1516 |
| 512 | Ga0436364_1065372 | 3300037853 | Bacteria | 196587 |
| 513 | Ga0395901_0060755 | 3300038443 | Bacteria | 3933 |
| 514 | Ga0395901_0226672 | 3300038443 | Bacteria | 1952 |
| 515 | Ga0395901_0227683 | 3300038443 | Bacteria | 1947 |
| 516 | Ga0400483_101908 | 3300039062 | Unclassified | 2819 |
| 517 | Ga0436365_1053930 | 3300039437 | Bacteria | 3063 |
| 518 | Ga0436365_1073490 | 3300039437 | Bacteria | 73987 |
| 519 | Ga0436365_1469416 | 3300039437 | Bacteria | 2064 |
| 520 | Ga0436365_1818233 | 3300039437 | Bacteria | 4064 |
| 521 | Ga0436360_0153630 | 3300039438 | Bacteria | 863 |
| 522 | Ga0436360_1001166 | 3300039438 | Bacteria | 1844 |
| 523 | Ga0436363_0399751 | 3300039450 | Bacteria | 20052 |
| 524 | Ga0436363_1233328 | 3300039450 | Bacteria | 1990 |
| 525 | Ga0436363_1240126 | 3300039450 | Bacteria | 22314 |
| 526 | Ga0439465_0031624 | 3300041413 | Bacteria | 1686 |
| 527 | Ga0439442_008156 | 3300042002 | Bacteria | 2115 |
| 528 | Ga0439445_0007199 | 3300042004 | Bacteria | 2576 |
| 529 | Ga0450911_000116 | 3300042115 | Bacteria | 31956 |
| 530 | Ga0439434_0043739 | 3300042435 | Bacteria | 1379 |
| 531 | Ga0453684_0293163 | 3300044712 | Bacteria | 1852 |
| 532 | Ga0451576_0054726 | 3300045051 | Bacteria | 4177 |
| 533 | Ga0495592_0122821 | 3300046454 | Bacteria | 1825 |
| 534 | Ga0495629_0144770 | 3300046459 | Bacteria | 1653 |
| 535 | Ga0495638_0340360 | 3300046460 | Bacteria | 795 |
| 536 | Ga0495650_0001660 | 3300046471 | Bacteria | 20561 |
| 537 | Ga0495580_0012332 | 3300046472 | Bacteria | 6557 |
| 538 | Ga0495596_0000486 | 3300046500 | Bacteria | 25196 |
| 539 | Ga0495596_0004299 | 3300046500 | Bacteria | 6973 |
| 540 | Ga0495607_0004616 | 3300046501 | Bacteria | 10082 |
| 541 | Ga0495583_0039818 | 3300046506 | Bacteria | 2211 |
| 542 | Ga0495606_0000078 | 3300046507 | Bacteria | 164950 |
| 543 | Ga0495606_0012143 | 3300046507 | Bacteria | 6945 |
| 544 | Ga0495610_0002681 | 3300046512 | Bacteria | 14677 |
| 545 | Ga0495610_0004187 | 3300046512 | Bacteria | 10774 |
| 546 | Ga0495632_0013411 | 3300046519 | Bacteria | 4678 |
| 547 | Ga0495643_0000945 | 3300046522 | Bacteria | 30097 |
| 548 | Ga0495643_0004994 | 3300046522 | Bacteria | 9093 |
| 549 | Ga0495643_0011590 | 3300046522 | Bacteria | 5360 |
| 550 | Ga0495643_0045127 | 3300046522 | Bacteria | 2393 |
| 551 | Ga0495644_0063969 | 3300046523 | Bacteria | 1383 |
| 552 | Ga0495648_0000748 | 3300046524 | Bacteria | 34717 |
| 553 | Ga0495648_0033936 | 3300046524 | Bacteria | 3328 |
| 554 | Ga0495654_0178714 | 3300046530 | Bacteria | 920 |
| 555 | Ga0495598_0019749 | 3300046537 | Bacteria | 1771 |
| 556 | Ga0495609_0002362 | 3300046538 | Bacteria | 11646 |
| 557 | Ga0495621_0015587 | 3300046539 | Bacteria | 2426 |
| 558 | Ga0495645_0080018 | 3300046543 | Bacteria | 2346 |
| 559 | Ga0495633_0085839 | 3300046558 | Bacteria | 1464 |
| 560 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 561 | Ga0495625_0001920 | 3300046660 | Bacteria | 23504 |
| 562 | Ga0495625_0008059 | 3300046660 | Bacteria | 9034 |
| 563 | Ga0495625_0055036 | 3300046660 | Bacteria | 2839 |
| 564 | Ga0495659_0002623 | 3300046664 | Bacteria | 5800 |
| 565 | Ga0495658_0010226 | 3300046683 | Bacteria | 4691 |
| 566 | Ga0495613_0243307 | 3300046689 | Bacteria | 1257 |
| 567 | Ga0495604_0243972 | 3300047317 | Bacteria | 1227 |
| 568 | Ga0495604_0295417 | 3300047317 | Bacteria | 1090 |
| 569 | Ga0495674_0164662 | 3300047319 | Bacteria | 1854 |
| 570 | Ga0495672_0000462 | 3300047320 | Bacteria | 48028 |
| 571 | Ga0495673_0000270 | 3300047469 | Bacteria | 71793 |
| 572 | Ga0495684_0226731 | 3300047471 | Bacteria | 1368 |
| 573 | Ga0495686_0263994 | 3300047472 | Bacteria | 963 |
| 574 | Ga0495626_0004324 | 3300048091 | Bacteria | 8754 |
| 575 | Ga0496100_0191174 | 3300048903 | Bacteria | 1486 |
| 576 | Ga0496100_0310387 | 3300048903 | Unclassified | 1182 |
| 577 | Ga0496101_0000975 | 3300048904 | Bacteria | 16910 |
| 578 | Ga0496102_0008220 | 3300048905 | Bacteria | 8931 |
| 579 | Ga0496102_0138570 | 3300048905 | Bacteria | 2280 |
| 580 | Ga0496103_0001134 | 3300048906 | Bacteria | 18514 |
| 581 | Ga0496103_0078443 | 3300048906 | Bacteria | 2074 |
| 582 | Ga0496106_0000769 | 3300048909 | Bacteria | 23204 |
| 583 | Ga0496107_0000672 | 3300048910 | Bacteria | 19397 |
| 584 | Ga0496107_0188925 | 3300048910 | Bacteria | 1530 |
| 585 | Ga0496108_0017612 | 3300048911 | Bacteria | 5845 |
| 586 | Ga0496109_0077119 | 3300048912 | Bacteria | 3066 |
| 587 | Ga0496112_0005828 | 3300048915 | Bacteria | 10724 |
| 588 | Ga0496113_0097261 | 3300048916 | Bacteria | 2277 |
| 589 | Ga0496114_0000486 | 3300048917 | Bacteria | 29134 |
| 590 | Ga0496114_0052904 | 3300048917 | Bacteria | 3384 |
| 591 | Ga0496115_0000286 | 3300048918 | Bacteria | 43642 |
| 592 | Ga0496115_0003434 | 3300048918 | Bacteria | 11382 |
| 593 | Ga0496116_0000039 | 3300048919 | Bacteria | 349134 |
| 594 | Ga0496117_0075369 | 3300048920 | Bacteria | 2242 |
| 595 | Ga0496118_0048034 | 3300048921 | Bacteria | 3302 |
| 596 | Ga0496121_0000733 | 3300048924 | Bacteria | 60446 |
| 597 | Ga0496121_0208333 | 3300048924 | Bacteria | 1387 |
| 598 | Ga0496122_0001526 | 3300048925 | Bacteria | 36870 |
| 599 | Ga0496123_0002207 | 3300048926 | Bacteria | 24751 |
| 600 | Ga0496124_0004725 | 3300048927 | Bacteria | 15729 |
| 601 | Ga0496124_0019477 | 3300048927 | Bacteria | 6314 |
| 602 | Ga0496124_0021030 | 3300048927 | Bacteria | 6016 |
| 603 | Ga0496124_0080489 | 3300048927 | Bacteria | 2680 |
| 604 | Ga0496125_0004368 | 3300048928 | Bacteria | 16377 |
| 605 | Ga0496126_0000041 | 3300048929 | Bacteria | 340389 |
| 606 | Ga0496126_0000498 | 3300048929 | Bacteria | 77619 |
| 607 | Ga0501032_0153860 | 3300049569 | Bacteria | 1511 |
| 608 | Ga0501033_0098754 | 3300049570 | Bacteria | 2132 |
| 609 | Ga0501033_0172391 | 3300049570 | Bacteria | 1553 |
| 610 | Ga0501034_0079948 | 3300049571 | Bacteria | 3273 |
| 611 | Ga0501034_0108480 | 3300049571 | Bacteria | 2767 |
| 612 | Ga0501034_0147813 | 3300049571 | Bacteria | 2326 |
| 613 | Ga0501034_0192076 | 3300049571 | Bacteria | 2004 |
| 614 | Ga0501034_0271308 | 3300049571 | Bacteria | 1637 |
| 615 | Ga0501036_0009156 | 3300049572 | Bacteria | 8141 |
| 616 | Ga0501036_0077432 | 3300049572 | Bacteria | 2814 |
| 617 | Ga0501036_0136834 | 3300049572 | Bacteria | 2067 |
| 618 | Ga0501036_0261477 | 3300049572 | Bacteria | 1450 |
| 619 | Ga0501037_0026713 | 3300049573 | Bacteria | 4266 |
| 620 | Ga0501038_0029433 | 3300049574 | Bacteria | 4867 |
| 621 | Ga0501038_0073917 | 3300049574 | Bacteria | 2885 |
| 622 | Ga0501038_0181272 | 3300049574 | Bacteria | 1699 |
| 623 | Ga0501038_0392377 | 3300049574 | Bacteria | 1075 |
| 624 | Ga0501039_0005227 | 3300049575 | Bacteria | 9832 |
| 625 | Ga0501039_0043147 | 3300049575 | Bacteria | 3484 |
| 626 | Ga0501041_0031462 | 3300049577 | Bacteria | 3206 |
| 627 | Ga0501041_0397138 | 3300049577 | Bacteria | 873 |
| 628 | Ga0501042_0098487 | 3300049578 | Bacteria | 2102 |
| 629 | Ga0501043_0010112 | 3300049579 | Bacteria | 7395 |
| 630 | Ga0501043_0046386 | 3300049579 | Bacteria | 3417 |
| 631 | Ga0501046_0287352 | 3300049580 | Unclassified | 1203 |
| 632 | Ga0501046_0302524 | 3300049580 | Bacteria | 1168 |
| 633 | Ga0501046_0356427 | 3300049580 | Bacteria | 1061 |
| 634 | Ga0501047_0013767 | 3300049581 | Bacteria | 7682 |
| 635 | Ga0501047_0166381 | 3300049581 | Bacteria | 2075 |
| 636 | Ga0501047_0253401 | 3300049581 | Bacteria | 1608 |
| 637 | Ga0501047_0268809 | 3300049581 | Bacteria | 1551 |
| 638 | Ga0501047_0372523 | 3300049581 | Bacteria | 1263 |
| 639 | Ga0501047_0492531 | 3300049581 | Bacteria | 1053 |
| 640 | Ga0501048_0084229 | 3300049582 | Bacteria | 2242 |
| 641 | Ga0501067_0000980 | 3300049583 | Bacteria | 15317 |
| 642 | Ga0501067_0034861 | 3300049583 | Bacteria | 2793 |
| 643 | Ga0501068_0059171 | 3300049584 | Bacteria | 2326 |
| 644 | Ga0501068_0265698 | 3300049584 | Bacteria | 1095 |
| 645 | Ga0501069_0005058 | 3300049585 | Bacteria | 6838 |
| 646 | Ga0501069_0175942 | 3300049585 | Bacteria | 1236 |
| 647 | Ga0501070_0000002 | 3300049586 | Bacteria | 347524 |
| 648 | Ga0501070_0021858 | 3300049586 | Bacteria | 5360 |
| 649 | Ga0501070_0038373 | 3300049586 | Bacteria | 3996 |
| 650 | Ga0501070_0257677 | 3300049586 | Bacteria | 1426 |
| 651 | Ga0501070_0267903 | 3300049586 | Unclassified | 1395 |
| 652 | Ga0501072_0050053 | 3300049588 | Bacteria | 3289 |
| 653 | Ga0501073_0400485 | 3300049589 | Bacteria | 948 |
| 654 | Ga0501074_0082600 | 3300049590 | Bacteria | 2303 |
| 655 | Ga0501074_0450056 | 3300049590 | Bacteria | 913 |
| 656 | Ga0501075_0009709 | 3300049591 | Bacteria | 6744 |
| 657 | Ga0501076_0009741 | 3300049592 | Bacteria | 7098 |
| 658 | Ga0501077_0074383 | 3300049593 | Bacteria | 2152 |
| 659 | Ga0501079_0016537 | 3300049741 | Bacteria | 5635 |
| 660 | Ga0501079_0022801 | 3300049741 | Bacteria | 4805 |
| 661 | Ga0501080_0003580 | 3300049742 | Bacteria | 13678 |
| 662 | Ga0501080_0011904 | 3300049742 | Bacteria | 7968 |
| 663 | Ga0501080_0052166 | 3300049742 | Bacteria | 3806 |
| 664 | Ga0501080_0225354 | 3300049742 | Bacteria | 1714 |
| 665 | Ga0501080_0907748 | 3300049742 | Bacteria | 767 |
| 666 | Ga0501081_0000375 | 3300049743 | Bacteria | 24480 |
| 667 | Ga0501083_0168217 | 3300049744 | Bacteria | 1433 |
| 668 | Ga0501035_0010190 | 3300049822 | Bacteria | 8724 |
| 669 | Ga0501035_0018850 | 3300049822 | Bacteria | 6358 |
| 670 | Ga0501035_0076744 | 3300049822 | Bacteria | 2954 |
| 671 | Ga0501035_0127922 | 3300049822 | Bacteria | 2216 |
| 672 | Ga0501044_0000378 | 3300049823 | Bacteria | 55508 |
| 673 | Ga0501044_0001291 | 3300049823 | Bacteria | 29606 |
| 674 | Ga0501044_0014944 | 3300049823 | Bacteria | 8370 |
| 675 | Ga0501044_0015636 | 3300049823 | Bacteria | 8173 |
| 676 | Ga0501044_0029141 | 3300049823 | Bacteria | 5822 |
| 677 | Ga0501044_0029793 | 3300049823 | Bacteria | 5754 |
| 678 | Ga0501044_0099883 | 3300049823 | Bacteria | 2920 |
| 679 | Ga0501044_0110803 | 3300049823 | Bacteria | 2753 |
| 680 | Ga0501044_0254324 | 3300049823 | Bacteria | 1696 |
| 681 | Ga0501045_0084013 | 3300049824 | Bacteria | 2349 |
| 682 | nmdc:mga03683_17_c1 | 3300050489 | Bacteria | 91111 |
| 683 | nmdc:mga03683_41_c1 | 3300050489 | Bacteria | 60927 |
| 684 | nmdc:mga03n38_973_c1 | 3300050490 | Bacteria | 7791 |
| 685 | nmdc:mga00v17_1323_c1 | 3300050491 | Bacteria | 12971 |
| 686 | nmdc:mga00v17_37643_c1 | 3300050491 | Bacteria | 2890 |
| 687 | nmdc:mga0yw44_23100_c1 | 3300050492 | Bacteria | 3500 |
| 688 | nmdc:mga0yw44_66231_c1 | 3300050492 | Bacteria | 2229 |
| 689 | nmdc:mga0k408_12_c1 | 3300050493 | Bacteria | 125427 |
| 690 | nmdc:mga06z11_545_c1 | 3300050494 | Bacteria | 13835 |
| 691 | nmdc:mga04h51_354_c1 | 3300050495 | Bacteria | 11356 |
| 692 | nmdc:mga07m45_11_c1 | 3300050496 | Bacteria | 163532 |
| 693 | nmdc:mga07m45_16_c1 | 3300050496 | Bacteria | 151695 |
| 694 | nmdc:mga07m45_42597_c1 | 3300050496 | Bacteria | 2545 |
| 695 | nmdc:mga07m45_6452_c1 | 3300050496 | Bacteria | 5929 |
| 696 | nmdc:mga07m45_8999_c1 | 3300050496 | Bacteria | 5158 |
| 697 | nmdc:mga05p37_14495_c2 | 3300050507 | Bacteria | 8751 |
| 698 | nmdc:mga05p37_166992_c2 | 3300050507 | Bacteria | 1799 |
| 699 | nmdc:mga0qj67_32207_c1 | 3300050509 | Bacteria | 4087 |
| 700 | nmdc:mga06r32_93354_c1 | 3300050510 | Bacteria | 2943 |
| 701 | nmdc:mga08y16_2749_c1 | 3300050511 | Bacteria | 18030 |
| 702 | nmdc:mga08y16_524234_c1 | 3300050511 | Bacteria | 1201 |
| 703 | nmdc:mga0n895_20772_c1 | 3300050512 | Bacteria | 6131 |
| 704 | nmdc:mga0n895_377112_c1 | 3300050512 | Bacteria | 1435 |
| 705 | nmdc:mga0n895_563969_c1 | 3300050512 | Bacteria | 1144 |
| 706 | nmdc:mga0n895_700712_c1 | 3300050512 | Bacteria | 1009 |
| 707 | nmdc:mga0n895_84254_c1 | 3300050512 | Bacteria | 3172 |
| 708 | nmdc:mga0rr50_125378_c1 | 3300050513 | Bacteria | 2050 |
| 709 | nmdc:mga0rr50_210970_c1 | 3300050513 | Bacteria | 1600 |
| 710 | nmdc:mga08x19_129_c1 | 3300050514 | Bacteria | 66982 |
| 711 | nmdc:mga0a205_82685_c1 | 3300050515 | Bacteria | 3102 |
| 712 | nmdc:mga0sz30_188_c1 | 3300050516 | Bacteria | 22800 |
| 713 | nmdc:mga0sz30_666_c2 | 3300050516 | Bacteria | 11850 |
| 714 | Ga0500643_012667 | 3300053087 | Bacteria | 3012 |
| 715 | Ga0500643_014174 | 3300053087 | Bacteria | 2782 |
| 716 | Ga0500644_0000142 | 3300053088 | Bacteria | 44270 |
| 717 | Ga0500555_031592 | 3300053103 | Bacteria | 1500 |
| 718 | Ga0500562_000281 | 3300053108 | Bacteria | 12523 |
| 719 | Ga0500592_005174 | 3300053116 | Bacteria | 2072 |
| 720 | Ga0500593_045534 | 3300053117 | Bacteria | 1956 |
| 721 | Ga0500595_001333 | 3300053119 | Bacteria | 13348 |
| 722 | Ga0500595_038324 | 3300053119 | Bacteria | 1559 |
| 723 | Ga0500597_004368 | 3300053120 | Bacteria | 4370 |
| 724 | Ga0500607_000140 | 3300053121 | Bacteria | 60736 |
| 725 | Ga0500607_000188 | 3300053121 | Bacteria | 55367 |
| 726 | Ga0500559_0000722 | 3300053136 | Bacteria | 21736 |
| 727 | Ga0500559_0000883 | 3300053136 | Bacteria | 19195 |
| 728 | Ga0500564_000219 | 3300053138 | Bacteria | 15901 |
| 729 | Ga0500568_0016977 | 3300053139 | Bacteria | 3222 |
| 730 | Ga0500619_020944 | 3300053154 | Bacteria | 1876 |
| 731 | Ga0500622_0002589 | 3300053156 | Bacteria | 12887 |
| 732 | Ga0500624_000041 | 3300053157 | Bacteria | 90321 |
| 733 | Ga0500627_0000149 | 3300053158 | Bacteria | 20586 |
| 734 | Ga0500637_0000206 | 3300053178 | Bacteria | 21961 |
| 735 | Ga0500637_0003008 | 3300053178 | Bacteria | 7651 |
| 736 | Ga0500645_001749 | 3300053730 | Bacteria | 10535 |
| 737 | Ga0500645_002540 | 3300053730 | Bacteria | 8057 |
| 738 | Ga0501084_0000017 | 3300054114 | Bacteria | 148659 |
| 739 | Ga0501084_0048106 | 3300054114 | Bacteria | 3571 |
| 740 | Ga0501084_0067831 | 3300054114 | Bacteria | 2986 |
| 741 | Ga0501084_0110200 | 3300054114 | Bacteria | 2313 |
| 742 | Ga0500661_029894 | 3300055283 | Bacteria | 961 |
| 743 | Ga0501082_0025498 | 3300060353 | Bacteria | 5094 |
| 744 | Ga0466962_0230650 | 3300061719 | Bacteria | 908 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100170500 | Ga0068862_1001705002 | 191 |
| 2 | 3300028380 | Ga0268265_10148374 | Ga0268265_101483742 | 191 |
| 3 | 3300028380 | Ga0268265_10544287 | Ga0268265_105442872 | 193 |
| 4 | 3300006051 | Ga0075364_10003024 | Ga0075364_100030244 | 194 |
| 5 | 3300006177 | Ga0075362_10029599 | Ga0075362_100295993 | 194 |
| 6 | 3300050491 | nmdc:mga00v17_1323_c1 | nmdc:mga00v17_1323_c1_6214_6996 | 194 |
| 7 | 3300050496 | nmdc:mga07m45_42597_c1 | nmdc:mga07m45_42597_c1_1219_2001 | 194 |
| 8 | 3300053117 | Ga0500593_045534 | Ga0500593_045534_600_1382 | 195 |
| 9 | 3300036712 | Ga0316584_0212852 | Ga0316584_0212852_707_1402 | 207 |
| 10 | 3300047317 | Ga0495604_0243972 | Ga0495604_0243972_14_712 | 209 |
| 11 | 3300049742 | Ga0501080_0907748 | Ga0501080_0907748_46_744 | 209 |
| 12 | 3300046530 | Ga0495654_0178714 | Ga0495654_0178714_21_731 | 213 |
| 13 | 3300039438 | Ga0436360_0153630 | Ga0436360_0153630_109_831 | 217 |
| 14 | 3300049577 | Ga0501041_0397138 | Ga0501041_0397138_141_860 | 217 |
| 15 | 3300006163 | Ga0070715_10103781 | Ga0070715_101037813 | 218 |
| 16 | 3300025905 | Ga0207685_10165699 | Ga0207685_101656991 | 218 |
| 17 | 3300025927 | Ga0207687_10423169 | Ga0207687_104231691 | 220 |
| 18 | 3300046460 | Ga0495638_0340360 | Ga0495638_0340360_49_777 | 220 |
| 19 | 3300025250 | Ga0209026_1003810 | Ga0209026_10038105 | 225 |
| 20 | iso_pu_bacteria | 2984555340 | 2984557168 | 226 |
| 21 | iso_pu_bacteria | 2993356040 | 2993359516 | 226 |
| 22 | 3300046523 | Ga0495644_0063969 | Ga0495644_0063969_187_987 | 227 |
| 23 | 3300046664 | Ga0495659_0002623 | Ga0495659_0002623_712_1512 | 227 |
| 24 | 3300005328 | Ga0070676_10423015 | Ga0070676_104230151 | 228 |
| 25 | 3300009177 | Ga0105248_10607108 | Ga0105248_106071081 | 228 |
| 26 | 3300009551 | Ga0105238_10228957 | Ga0105238_102289571 | 228 |
| 27 | 3300025924 | Ga0207694_10258647 | Ga0207694_102586473 | 228 |
| 28 | 3300026116 | Ga0207674_10032897 | Ga0207674_100328973 | 228 |
| 29 | 3300037466 | Ga0395898_0079034 | Ga0395898_0079034_1246_2001 | 228 |
| 30 | 3300038443 | Ga0395901_0227683 | Ga0395901_0227683_36_791 | 228 |
| 31 | 3300049572 | Ga0501036_0261477 | Ga0501036_0261477_12_767 | 228 |
| 32 | 3300042115 | Ga0450911_000116 | Ga0450911_000116_10067_11005 | 230 |
| 33 | 3300048927 | Ga0496124_0019477 | Ga0496124_0019477_3366_4142 | 230 |
| 34 | iso_pu_bacteria | 2928027323 | 2928031103 | 230 |
| 35 | iso_pu_bacteria | 2984564862 | 2984568465 | 230 |
| 36 | 3300013102 | Ga0157371_10001910 | Ga0157371_1000191010 | 231 |
| 37 | 3300003781 | Ga0055536_1007529 | Ga0055536_10075292 | 232 |
| 38 | 3300003781 | Ga0055536_1031355 | Ga0055536_10313552 | 232 |
| 39 | 3300003784 | Ga0055534_1015751 | Ga0055534_10157512 | 232 |
| 40 | 3300003791 | Ga0055530_10000174 | Ga0055530_1000017419 | 232 |
| 41 | 3300003791 | Ga0055530_10000411 | Ga0055530_1000041127 | 232 |
| 42 | 3300003794 | Ga0055531_10001746 | Ga0055531_1000174612 | 232 |
| 43 | 3300003794 | Ga0055531_10014294 | Ga0055531_100142943 | 232 |
| 44 | 3300025291 | Ga0209675_1000025 | Ga0209675_1000025291 | 232 |
| 45 | 3300025292 | Ga0209676_1000259 | Ga0209676_100025982 | 232 |
| 46 | 3300025292 | Ga0209676_1000678 | Ga0209676_100067811 | 232 |
| 47 | 3300025294 | Ga0209025_1010159 | Ga0209025_10101599 | 232 |
| 48 | 3300025298 | Ga0209050_1000104 | Ga0209050_1000104108 | 232 |
| 49 | 3300025298 | Ga0209050_1017052 | Ga0209050_10170523 | 232 |
| 50 | 3300025304 | Ga0209257_1000120 | Ga0209257_100012088 | 232 |
| 51 | 3300025304 | Ga0209257_1000174 | Ga0209257_1000174147 | 232 |
| 52 | 3300031911 | Ga0307412_10075526 | Ga0307412_100755262 | 232 |
| 53 | 3300032004 | Ga0307414_10013889 | Ga0307414_100138896 | 232 |
| 54 | 3300035115 | Ga0373941_0064335 | Ga0373941_0064335_277_1047 | 232 |
| 55 | 3300042002 | Ga0439442_008156 | Ga0439442_008156_768_1595 | 232 |
| 56 | 3300042004 | Ga0439445_0007199 | Ga0439445_0007199_83_910 | 232 |
| 57 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_68878_69684 | 232 |
| 58 | 3300046660 | Ga0495625_0001920 | Ga0495625_0001920_15150_15953 | 232 |
| 59 | 3300053139 | Ga0500568_0016977 | Ga0500568_0016977_405_1208 | 232 |
| 60 | iso_pu_bacteria | 2840878972 | 2840883291 | 232 |
| 61 | 3300003320 | rootH2_10093086 | rootH2_100930861 | 233 |
| 62 | 3300005336 | Ga0070680_100048217 | Ga0070680_1000482172 | 233 |
| 63 | 3300005530 | Ga0070679_100018143 | Ga0070679_1000181434 | 233 |
| 64 | 3300005539 | Ga0068853_100426163 | Ga0068853_1004261632 | 233 |
| 65 | 3300005563 | Ga0068855_100018471 | Ga0068855_1000184719 | 233 |
| 66 | 3300005563 | Ga0068855_100326846 | Ga0068855_1003268462 | 233 |
| 67 | 3300005614 | Ga0068856_100386733 | Ga0068856_1003867331 | 233 |
| 68 | 3300009093 | Ga0105240_10013961 | Ga0105240_100139613 | 233 |
| 69 | 3300009093 | Ga0105240_10036213 | Ga0105240_100362131 | 233 |
| 70 | 3300009093 | Ga0105240_10174368 | Ga0105240_101743682 | 233 |
| 71 | 3300009093 | Ga0105240_10828420 | Ga0105240_108284201 | 233 |
| 72 | 3300009545 | Ga0105237_10017309 | Ga0105237_100173093 | 233 |
| 73 | 3300009545 | Ga0105237_10454853 | Ga0105237_104548532 | 233 |
| 74 | 3300009551 | Ga0105238_10006764 | Ga0105238_100067645 | 233 |
| 75 | 3300009551 | Ga0105238_10372514 | Ga0105238_103725141 | 233 |
| 76 | 3300009551 | Ga0105238_10521210 | Ga0105238_105212102 | 233 |
| 77 | 3300010375 | Ga0105239_10006709 | Ga0105239_1000670914 | 233 |
| 78 | 3300010375 | Ga0105239_10196186 | Ga0105239_101961863 | 233 |
| 79 | 3300021384 | Ga0213876_10026630 | Ga0213876_100266303 | 233 |
| 80 | 3300025907 | Ga0207645_10317893 | Ga0207645_103178931 | 233 |
| 81 | 3300025911 | Ga0207654_10275834 | Ga0207654_102758342 | 233 |
| 82 | 3300025913 | Ga0207695_10010920 | Ga0207695_1001092011 | 233 |
| 83 | 3300025913 | Ga0207695_10140690 | Ga0207695_101406901 | 233 |
| 84 | 3300025914 | Ga0207671_10115634 | Ga0207671_101156342 | 233 |
| 85 | 3300025917 | Ga0207660_10041404 | Ga0207660_100414043 | 233 |
| 86 | 3300025921 | Ga0207652_10024819 | Ga0207652_100248193 | 233 |
| 87 | 3300025924 | Ga0207694_10025854 | Ga0207694_100258546 | 233 |
| 88 | 3300025924 | Ga0207694_10217882 | Ga0207694_102178823 | 233 |
| 89 | 3300025949 | Ga0207667_10076783 | Ga0207667_100767832 | 233 |
| 90 | 3300028379 | Ga0268266_10100381 | Ga0268266_101003812 | 233 |
| 91 | 3300037466 | Ga0395898_0306029 | Ga0395898_0306029_339_1148 | 233 |
| 92 | 3300038443 | Ga0395901_0060755 | Ga0395901_0060755_2806_3615 | 233 |
| 93 | 3300039437 | Ga0436365_1053930 | Ga0436365_1053930_120_896 | 233 |
| 94 | 3300047319 | Ga0495674_0164662 | Ga0495674_0164662_174_962 | 233 |
| 95 | 3300049574 | Ga0501038_0073917 | Ga0501038_0073917_523_1305 | 233 |
| 96 | 3300049581 | Ga0501047_0492531 | Ga0501047_0492531_88_870 | 233 |
| 97 | 3300049822 | Ga0501035_0010190 | Ga0501035_0010190_133_915 | 233 |
| 98 | 3300049823 | Ga0501044_0110803 | Ga0501044_0110803_1932_2714 | 233 |
| 99 | iso_pu_bacteria | 2510917021 | 2511127401 | 233 |
| 100 | iso_pu_bacteria | 2818991438 | 2819550672 | 233 |
| 101 | 3300005336 | Ga0070680_100277283 | Ga0070680_1002772831 | 234 |
| 102 | 3300005341 | Ga0070691_10001038 | Ga0070691_100010389 | 234 |
| 103 | 3300005434 | Ga0070709_10001050 | Ga0070709_100010508 | 234 |
| 104 | 3300005435 | Ga0070714_100087620 | Ga0070714_1000876202 | 234 |
| 105 | 3300005435 | Ga0070714_100331190 | Ga0070714_1003311902 | 234 |
| 106 | 3300005435 | Ga0070714_100345800 | Ga0070714_1003458002 | 234 |
| 107 | 3300005436 | Ga0070713_100000004 | Ga0070713_100000004178 | 234 |
| 108 | 3300005436 | Ga0070713_100090194 | Ga0070713_1000901942 | 234 |
| 109 | 3300005436 | Ga0070713_100144620 | Ga0070713_1001446202 | 234 |
| 110 | 3300005437 | Ga0070710_10313797 | Ga0070710_103137971 | 234 |
| 111 | 3300005439 | Ga0070711_100006293 | Ga0070711_1000062932 | 234 |
| 112 | 3300005439 | Ga0070711_100061692 | Ga0070711_1000616922 | 234 |
| 113 | 3300005458 | Ga0070681_10220409 | Ga0070681_102204092 | 234 |
| 114 | 3300005535 | Ga0070684_100206949 | Ga0070684_1002069492 | 234 |
| 115 | 3300005539 | Ga0068853_100044850 | Ga0068853_1000448502 | 234 |
| 116 | 3300005545 | Ga0070695_100056560 | Ga0070695_1000565602 | 234 |
| 117 | 3300005545 | Ga0070695_100456704 | Ga0070695_1004567041 | 234 |
| 118 | 3300005547 | Ga0070693_100030645 | Ga0070693_1000306453 | 234 |
| 119 | 3300005547 | Ga0070693_100152422 | Ga0070693_1001524222 | 234 |
| 120 | 3300005563 | Ga0068855_100174079 | Ga0068855_1001740792 | 234 |
| 121 | 3300005578 | Ga0068854_100051117 | Ga0068854_1000511172 | 234 |
| 122 | 3300005614 | Ga0068856_100000144 | Ga0068856_10000014430 | 234 |
| 123 | 3300005614 | Ga0068856_100036083 | Ga0068856_1000360832 | 234 |
| 124 | 3300005616 | Ga0068852_100005341 | Ga0068852_1000053419 | 234 |
| 125 | 3300005618 | Ga0068864_100160901 | Ga0068864_1001609012 | 234 |
| 126 | 3300005841 | Ga0068863_100031803 | Ga0068863_1000318037 | 234 |
| 127 | 3300005842 | Ga0068858_100025449 | Ga0068858_1000254492 | 234 |
| 128 | 3300005842 | Ga0068858_100139765 | Ga0068858_1001397652 | 234 |
| 129 | 3300006028 | Ga0070717_10000965 | Ga0070717_100009652 | 234 |
| 130 | 3300006163 | Ga0070715_10145784 | Ga0070715_101457841 | 234 |
| 131 | 3300006173 | Ga0070716_100012336 | Ga0070716_1000123362 | 234 |
| 132 | 3300006175 | Ga0070712_100000293 | Ga0070712_10000029312 | 234 |
| 133 | 3300006175 | Ga0070712_100000567 | Ga0070712_1000005677 | 234 |
| 134 | 3300006871 | Ga0075434_100029766 | Ga0075434_1000297661 | 234 |
| 135 | 3300006871 | Ga0075434_100466078 | Ga0075434_1004660781 | 234 |
| 136 | 3300006871 | Ga0075434_100560615 | Ga0075434_1005606152 | 234 |
| 137 | 3300006914 | Ga0075436_100000574 | Ga0075436_10000057420 | 234 |
| 138 | 3300007076 | Ga0075435_100229506 | Ga0075435_1002295062 | 234 |
| 139 | 3300009093 | Ga0105240_10006228 | Ga0105240_100062282 | 234 |
| 140 | 3300009094 | Ga0111539_10653894 | Ga0111539_106538942 | 234 |
| 141 | 3300009101 | Ga0105247_10032949 | Ga0105247_100329492 | 234 |
| 142 | 3300009174 | Ga0105241_10048218 | Ga0105241_100482182 | 234 |
| 143 | 3300009174 | Ga0105241_10057050 | Ga0105241_100570502 | 234 |
| 144 | 3300009177 | Ga0105248_10238795 | Ga0105248_102387951 | 234 |
| 145 | 3300009545 | Ga0105237_10161873 | Ga0105237_101618732 | 234 |
| 146 | 3300009551 | Ga0105238_10000847 | Ga0105238_1000084713 | 234 |
| 147 | 3300009553 | Ga0105249_10011618 | Ga0105249_100116182 | 234 |
| 148 | 3300013104 | Ga0157370_10022363 | Ga0157370_100223632 | 234 |
| 149 | 3300013105 | Ga0157369_10010560 | Ga0157369_100105603 | 234 |
| 150 | 3300013297 | Ga0157378_10130928 | Ga0157378_101309282 | 234 |
| 151 | 3300013307 | Ga0157372_10095779 | Ga0157372_100957792 | 234 |
| 152 | 3300014968 | Ga0157379_10004376 | Ga0157379_100043764 | 234 |
| 153 | 3300014968 | Ga0157379_10020130 | Ga0157379_100201305 | 234 |
| 154 | 3300014968 | Ga0157379_10053671 | Ga0157379_100536713 | 234 |
| 155 | 3300014968 | Ga0157379_10737004 | Ga0157379_107370041 | 234 |
| 156 | 3300020069 | Ga0197907_10260788 | Ga0197907_102607881 | 234 |
| 157 | 3300020080 | Ga0206350_11054501 | Ga0206350_110545011 | 234 |
| 158 | 3300022467 | Ga0224712_10002545 | Ga0224712_100025451 | 234 |
| 159 | 3300025898 | Ga0207692_10091624 | Ga0207692_100916241 | 234 |
| 160 | 3300025906 | Ga0207699_10000181 | Ga0207699_1000018129 | 234 |
| 161 | 3300025911 | Ga0207654_10031910 | Ga0207654_100319102 | 234 |
| 162 | 3300025913 | Ga0207695_10106753 | Ga0207695_101067532 | 234 |
| 163 | 3300025914 | Ga0207671_10034656 | Ga0207671_100346562 | 234 |
| 164 | 3300025915 | Ga0207693_10000163 | Ga0207693_100001635 | 234 |
| 165 | 3300025915 | Ga0207693_10001708 | Ga0207693_100017089 | 234 |
| 166 | 3300025916 | Ga0207663_10023145 | Ga0207663_100231452 | 234 |
| 167 | 3300025924 | Ga0207694_10055978 | Ga0207694_100559782 | 234 |
| 168 | 3300025928 | Ga0207700_10000011 | Ga0207700_10000011129 | 234 |
| 169 | 3300025928 | Ga0207700_10011148 | Ga0207700_100111482 | 234 |
| 170 | 3300025928 | Ga0207700_10092102 | Ga0207700_100921022 | 234 |
| 171 | 3300025929 | Ga0207664_10033147 | Ga0207664_100331472 | 234 |
| 172 | 3300025929 | Ga0207664_10592225 | Ga0207664_105922251 | 234 |
| 173 | 3300025939 | Ga0207665_10020902 | Ga0207665_100209023 | 234 |
| 174 | 3300025939 | Ga0207665_10270744 | Ga0207665_102707443 | 234 |
| 175 | 3300025941 | Ga0207711_10649117 | Ga0207711_106491172 | 234 |
| 176 | 3300025949 | Ga0207667_10011191 | Ga0207667_100111912 | 234 |
| 177 | 3300025961 | Ga0207712_10030366 | Ga0207712_100303662 | 234 |
| 178 | 3300026035 | Ga0207703_10088875 | Ga0207703_100888752 | 234 |
| 179 | 3300026041 | Ga0207639_10065428 | Ga0207639_100654282 | 234 |
| 180 | 3300026078 | Ga0207702_10000226 | Ga0207702_1000022630 | 234 |
| 181 | 3300026078 | Ga0207702_10025921 | Ga0207702_100259213 | 234 |
| 182 | 3300026116 | Ga0207674_10000330 | Ga0207674_1000033057 | 234 |
| 183 | 3300028800 | Ga0265338_10008211 | Ga0265338_1000821110 | 234 |
| 184 | 3300028800 | Ga0265338_10143061 | Ga0265338_101430612 | 234 |
| 185 | 3300031240 | Ga0265320_10004251 | Ga0265320_100042512 | 234 |
| 186 | 3300031241 | Ga0265325_10000098 | Ga0265325_1000009814 | 234 |
| 187 | 3300031249 | Ga0265339_10006756 | Ga0265339_100067562 | 234 |
| 188 | 3300031249 | Ga0265339_10023687 | Ga0265339_100236873 | 234 |
| 189 | 3300031595 | Ga0265313_10010486 | Ga0265313_100104862 | 234 |
| 190 | 3300031711 | Ga0265314_10000835 | Ga0265314_1000083524 | 234 |
| 191 | 3300031711 | Ga0265314_10047873 | Ga0265314_100478732 | 234 |
| 192 | 3300035089 | Ga0373944_0091004 | Ga0373944_0091004_191_1009 | 234 |
| 193 | 3300035172 | Ga0373955_0022124 | Ga0373955_0022124_950_1735 | 234 |
| 194 | 3300035725 | Ga0373947_0130056 | Ga0373947_0130056_363_1181 | 234 |
| 195 | 3300036401 | Ga0373937_0098051 | Ga0373937_0098051_1235_2020 | 234 |
| 196 | 3300046459 | Ga0495629_0144770 | Ga0495629_0144770_643_1425 | 234 |
| 197 | 3300047471 | Ga0495684_0226731 | Ga0495684_0226731_564_1349 | 234 |
| 198 | 3300048924 | Ga0496121_0208333 | Ga0496121_0208333_103_882 | 234 |
| 199 | 3300050512 | nmdc:mga0n895_20772_c1 | nmdc:mga0n895_20772_c1_56_841 | 234 |
| 200 | 3300050512 | nmdc:mga0n895_563969_c1 | nmdc:mga0n895_563969_c1_103_891 | 234 |
| 201 | 3300050512 | nmdc:mga0n895_700712_c1 | nmdc:mga0n895_700712_c1_165_962 | 234 |
| 202 | 3300050513 | nmdc:mga0rr50_210970_c1 | nmdc:mga0rr50_210970_c1_315_1112 | 234 |
| 203 | 3300050514 | nmdc:mga08x19_129_c1 | nmdc:mga08x19_129_c1_32696_33481 | 234 |
| 204 | 3300053119 | Ga0500595_001333 | Ga0500595_001333_6561_7340 | 234 |
| 205 | 3300005335 | Ga0070666_10001920 | Ga0070666_100019209 | 235 |
| 206 | 3300005367 | Ga0070667_100327458 | Ga0070667_1003274582 | 235 |
| 207 | 3300005548 | Ga0070665_100081373 | Ga0070665_1000813733 | 235 |
| 208 | 3300005563 | Ga0068855_100080830 | Ga0068855_1000808303 | 235 |
| 209 | 3300005937 | Ga0081455_10001531 | Ga0081455_1000153121 | 235 |
| 210 | 3300005937 | Ga0081455_10071738 | Ga0081455_100717382 | 235 |
| 211 | 3300006042 | Ga0075368_10000095 | Ga0075368_100000959 | 235 |
| 212 | 3300006048 | Ga0075363_100000751 | Ga0075363_1000007514 | 235 |
| 213 | 3300006048 | Ga0075363_100004933 | Ga0075363_1000049336 | 235 |
| 214 | 3300006051 | Ga0075364_10045967 | Ga0075364_100459672 | 235 |
| 215 | 3300006177 | Ga0075362_10000114 | Ga0075362_1000011416 | 235 |
| 216 | 3300006177 | Ga0075362_10000265 | Ga0075362_100002657 | 235 |
| 217 | 3300006178 | Ga0075367_10003384 | Ga0075367_100033848 | 235 |
| 218 | 3300006186 | Ga0075369_10001348 | Ga0075369_100013485 | 235 |
| 219 | 3300006186 | Ga0075369_10003423 | Ga0075369_100034236 | 235 |
| 220 | 3300006195 | Ga0075366_10000415 | Ga0075366_100004155 | 235 |
| 221 | 3300006353 | Ga0075370_10000048 | Ga0075370_1000004835 | 235 |
| 222 | 3300006353 | Ga0075370_10001563 | Ga0075370_100015637 | 235 |
| 223 | 3300006353 | Ga0075370_10017171 | Ga0075370_100171714 | 235 |
| 224 | 3300006353 | Ga0075370_10037022 | Ga0075370_100370222 | 235 |
| 225 | 3300009094 | Ga0111539_10159233 | Ga0111539_101592332 | 235 |
| 226 | 3300009177 | Ga0105248_10062045 | Ga0105248_100620453 | 235 |
| 227 | 3300021384 | Ga0213876_10038055 | Ga0213876_100380552 | 235 |
| 228 | 3300025298 | Ga0209050_1001308 | Ga0209050_100130829 | 235 |
| 229 | 3300025924 | Ga0207694_10255815 | Ga0207694_102558152 | 235 |
| 230 | 3300025941 | Ga0207711_10184860 | Ga0207711_101848601 | 235 |
| 231 | 3300025949 | Ga0207667_10167552 | Ga0207667_101675522 | 235 |
| 232 | 3300027866 | Ga0209813_10000013 | Ga0209813_1000001387 | 235 |
| 233 | 3300031238 | Ga0265332_10075042 | Ga0265332_100750422 | 235 |
| 234 | 3300031249 | Ga0265339_10012302 | Ga0265339_100123023 | 235 |
| 235 | 3300035398 | Ga0316574_0003926 | Ga0316574_0003926_1191_1973 | 235 |
| 236 | 3300035695 | Ga0373927_0053577 | Ga0373927_0053577_1425_2213 | 235 |
| 237 | 3300036401 | Ga0373937_0568685 | Ga0373937_0568685_207_995 | 235 |
| 238 | 3300039437 | Ga0436365_1818233 | Ga0436365_1818233_1996_2814 | 235 |
| 239 | 3300039450 | Ga0436363_1233328 | Ga0436363_1233328_1160_1948 | 235 |
| 240 | 3300039450 | Ga0436363_1240126 | Ga0436363_1240126_16056_16844 | 235 |
| 241 | 3300046500 | Ga0495596_0000486 | Ga0495596_0000486_10127_10909 | 235 |
| 242 | 3300046500 | Ga0495596_0004299 | Ga0495596_0004299_3085_3876 | 235 |
| 243 | 3300046501 | Ga0495607_0004616 | Ga0495607_0004616_409_1191 | 235 |
| 244 | 3300046506 | Ga0495583_0039818 | Ga0495583_0039818_863_1645 | 235 |
| 245 | 3300046507 | Ga0495606_0012143 | Ga0495606_0012143_6088_6870 | 235 |
| 246 | 3300046512 | Ga0495610_0002681 | Ga0495610_0002681_9471_10253 | 235 |
| 247 | 3300046512 | Ga0495610_0004187 | Ga0495610_0004187_53_835 | 235 |
| 248 | 3300046519 | Ga0495632_0013411 | Ga0495632_0013411_3768_4550 | 235 |
| 249 | 3300046522 | Ga0495643_0000945 | Ga0495643_0000945_19874_20656 | 235 |
| 250 | 3300046522 | Ga0495643_0004994 | Ga0495643_0004994_6135_6917 | 235 |
| 251 | 3300046522 | Ga0495643_0045127 | Ga0495643_0045127_564_1346 | 235 |
| 252 | 3300046538 | Ga0495609_0002362 | Ga0495609_0002362_9619_10401 | 235 |
| 253 | 3300046660 | Ga0495625_0008059 | Ga0495625_0008059_5210_5992 | 235 |
| 254 | 3300046660 | Ga0495625_0055036 | Ga0495625_0055036_1715_2503 | 235 |
| 255 | 3300047320 | Ga0495672_0000462 | Ga0495672_0000462_18115_18897 | 235 |
| 256 | 3300047472 | Ga0495686_0263994 | Ga0495686_0263994_164_946 | 235 |
| 257 | 3300048091 | Ga0495626_0004324 | Ga0495626_0004324_7449_8231 | 235 |
| 258 | 3300048919 | Ga0496116_0000039 | Ga0496116_0000039_304805_305596 | 235 |
| 259 | 3300048920 | Ga0496117_0075369 | Ga0496117_0075369_1226_2017 | 235 |
| 260 | 3300048921 | Ga0496118_0048034 | Ga0496118_0048034_1453_2244 | 235 |
| 261 | 3300048924 | Ga0496121_0000733 | Ga0496121_0000733_28309_29100 | 235 |
| 262 | 3300048925 | Ga0496122_0001526 | Ga0496122_0001526_30055_30846 | 235 |
| 263 | 3300048926 | Ga0496123_0002207 | Ga0496123_0002207_19230_20021 | 235 |
| 264 | 3300048927 | Ga0496124_0004725 | Ga0496124_0004725_6380_7171 | 235 |
| 265 | 3300048927 | Ga0496124_0021030 | Ga0496124_0021030_4424_5215 | 235 |
| 266 | 3300048927 | Ga0496124_0080489 | Ga0496124_0080489_801_1592 | 235 |
| 267 | 3300048928 | Ga0496125_0004368 | Ga0496125_0004368_4421_5212 | 235 |
| 268 | 3300048929 | Ga0496126_0000041 | Ga0496126_0000041_36304_37095 | 235 |
| 269 | 3300048929 | Ga0496126_0000498 | Ga0496126_0000498_43176_43964 | 235 |
| 270 | 3300049571 | Ga0501034_0147813 | Ga0501034_0147813_125_913 | 235 |
| 271 | 3300049589 | Ga0501073_0400485 | Ga0501073_0400485_37_819 | 235 |
| 272 | 3300049823 | Ga0501044_0001291 | Ga0501044_0001291_5711_6499 | 235 |
| 273 | 3300050489 | nmdc:mga03683_17_c1 | nmdc:mga03683_17_c1_18615_19397 | 235 |
| 274 | 3300050489 | nmdc:mga03683_41_c1 | nmdc:mga03683_41_c1_3085_3867 | 235 |
| 275 | 3300050490 | nmdc:mga03n38_973_c1 | nmdc:mga03n38_973_c1_4874_5656 | 235 |
| 276 | 3300050491 | nmdc:mga00v17_37643_c1 | nmdc:mga00v17_37643_c1_225_1007 | 235 |
| 277 | 3300050492 | nmdc:mga0yw44_23100_c1 | nmdc:mga0yw44_23100_c1_2667_3449 | 235 |
| 278 | 3300050492 | nmdc:mga0yw44_66231_c1 | nmdc:mga0yw44_66231_c1_1418_2200 | 235 |
| 279 | 3300050493 | nmdc:mga0k408_12_c1 | nmdc:mga0k408_12_c1_71247_72029 | 235 |
| 280 | 3300050494 | nmdc:mga06z11_545_c1 | nmdc:mga06z11_545_c1_1983_2765 | 235 |
| 281 | 3300050495 | nmdc:mga04h51_354_c1 | nmdc:mga04h51_354_c1_2354_3136 | 235 |
| 282 | 3300050496 | nmdc:mga07m45_11_c1 | nmdc:mga07m45_11_c1_91536_92318 | 235 |
| 283 | 3300050496 | nmdc:mga07m45_16_c1 | nmdc:mga07m45_16_c1_79456_80238 | 235 |
| 284 | 3300050496 | nmdc:mga07m45_6452_c1 | nmdc:mga07m45_6452_c1_1444_2226 | 235 |
| 285 | 3300050496 | nmdc:mga07m45_8999_c1 | nmdc:mga07m45_8999_c1_125_913 | 235 |
| 286 | 3300050511 | nmdc:mga08y16_524234_c1 | nmdc:mga08y16_524234_c1_90_872 | 235 |
| 287 | 3300050512 | nmdc:mga0n895_377112_c1 | nmdc:mga0n895_377112_c1_431_1204 | 235 |
| 288 | 3300050516 | nmdc:mga0sz30_188_c1 | nmdc:mga0sz30_188_c1_2558_3340 | 235 |
| 289 | 3300050516 | nmdc:mga0sz30_666_c2 | nmdc:mga0sz30_666_c2_4433_5215 | 235 |
| 290 | 3300053087 | Ga0500643_014174 | Ga0500643_014174_43_831 | 235 |
| 291 | 3300053103 | Ga0500555_031592 | Ga0500555_031592_306_1088 | 235 |
| 292 | 3300053119 | Ga0500595_038324 | Ga0500595_038324_406_1194 | 235 |
| 293 | 3300053121 | Ga0500607_000140 | Ga0500607_000140_47151_47939 | 235 |
| 294 | 3300053121 | Ga0500607_000188 | Ga0500607_000188_7551_8333 | 235 |
| 295 | 3300053136 | Ga0500559_0000722 | Ga0500559_0000722_8224_9012 | 235 |
| 296 | 3300053136 | Ga0500559_0000883 | Ga0500559_0000883_6593_7381 | 235 |
| 297 | 3300053156 | Ga0500622_0002589 | Ga0500622_0002589_10170_10958 | 235 |
| 298 | 3300053178 | Ga0500637_0003008 | Ga0500637_0003008_1677_2465 | 235 |
| 299 | 3300053730 | Ga0500645_001749 | Ga0500645_001749_4562_5350 | 235 |
| 300 | 3300053730 | Ga0500645_002540 | Ga0500645_002540_6035_6817 | 235 |
| 301 | iso_pu_bacteria | 2643221574 | 2643883320 | 235 |
| 302 | iso_pu_bacteria | 2643221699 | 2644547862 | 235 |
| 303 | iso_pu_bacteria | 2928972540 | 2928974012 | 235 |
| 304 | 3300002774 | JGI25150J39212_1001047 | JGI25150J39212_10010479 | 236 |
| 305 | 3300003215 | JGI25153J46596_10000535 | JGI25153J46596_100005359 | 236 |
| 306 | 3300003771 | Ga0055526_1001270 | Ga0055526_100127011 | 236 |
| 307 | 3300003771 | Ga0055526_1054591 | Ga0055526_10545911 | 236 |
| 308 | 3300003791 | Ga0055530_10011110 | Ga0055530_100111101 | 236 |
| 309 | 3300003792 | Ga0055540_1000884 | Ga0055540_10008841 | 236 |
| 310 | 3300005262 | Ga0065165_1008527 | Ga0065165_10085277 | 236 |
| 311 | 3300005344 | Ga0070661_100000148 | Ga0070661_10000014812 | 236 |
| 312 | 3300005367 | Ga0070667_100234157 | Ga0070667_1002341573 | 236 |
| 313 | 3300005719 | Ga0068861_100001216 | Ga0068861_1000012167 | 236 |
| 314 | 3300006946 | Ga0079104_1021103 | Ga0079104_10211032 | 236 |
| 315 | 3300013104 | Ga0157370_10006919 | Ga0157370_100069193 | 236 |
| 316 | 3300025245 | Ga0207425_1000094 | Ga0207425_100009414 | 236 |
| 317 | 3300025258 | Ga0209129_1017796 | Ga0209129_10177962 | 236 |
| 318 | 3300025263 | Ga0209565_1000386 | Ga0209565_100038636 | 236 |
| 319 | 3300025292 | Ga0209676_1011926 | Ga0209676_10119263 | 236 |
| 320 | 3300025294 | Ga0209025_1000727 | Ga0209025_100072743 | 236 |
| 321 | 3300025295 | Ga0209564_1002114 | Ga0209564_100211410 | 236 |
| 322 | 3300025295 | Ga0209564_1015689 | Ga0209564_10156893 | 236 |
| 323 | 3300025297 | Ga0209758_1000002 | Ga0209758_100000214 | 236 |
| 324 | 3300025297 | Ga0209758_1000108 | Ga0209758_1000108203 | 236 |
| 325 | 3300025298 | Ga0209050_1000342 | Ga0209050_100034213 | 236 |
| 326 | 3300025302 | Ga0207426_1023307 | Ga0207426_10233071 | 236 |
| 327 | 3300025303 | Ga0209051_1000226 | Ga0209051_100022610 | 236 |
| 328 | 3300025304 | Ga0209257_1007904 | Ga0209257_10079044 | 236 |
| 329 | 3300025304 | Ga0209257_1011412 | Ga0209257_10114122 | 236 |
| 330 | 3300025920 | Ga0207649_10000153 | Ga0207649_1000015316 | 236 |
| 331 | 3300025986 | Ga0207658_10200619 | Ga0207658_102006192 | 236 |
| 332 | 3300026118 | Ga0207675_100002220 | Ga0207675_1000022208 | 236 |
| 333 | 3300027111 | Ga0209281_1014127 | Ga0209281_10141272 | 236 |
| 334 | 3300031250 | Ga0265331_10000003 | Ga0265331_10000003141 | 236 |
| 335 | 3300031250 | Ga0265331_10000793 | Ga0265331_100007937 | 236 |
| 336 | 3300031251 | Ga0265327_10000187 | Ga0265327_1000018762 | 236 |
| 337 | 3300031711 | Ga0265314_10169539 | Ga0265314_101695392 | 236 |
| 338 | 3300046524 | Ga0495648_0033936 | Ga0495648_0033936_427_1209 | 236 |
| 339 | 3300048918 | Ga0496115_0000286 | Ga0496115_0000286_28914_29696 | 236 |
| 340 | 3300049572 | Ga0501036_0077432 | Ga0501036_0077432_1105_1896 | 236 |
| 341 | 3300049579 | Ga0501043_0046386 | Ga0501043_0046386_526_1317 | 236 |
| 342 | 3300049580 | Ga0501046_0287352 | Ga0501046_0287352_282_1073 | 236 |
| 343 | 3300049580 | Ga0501046_0302524 | Ga0501046_0302524_364_1155 | 236 |
| 344 | 3300049586 | Ga0501070_0038373 | Ga0501070_0038373_1105_1896 | 236 |
| 345 | 3300049586 | Ga0501070_0267903 | Ga0501070_0267903_434_1225 | 236 |
| 346 | 3300049742 | Ga0501080_0225354 | Ga0501080_0225354_737_1528 | 236 |
| 347 | 3300049822 | Ga0501035_0076744 | Ga0501035_0076744_250_1041 | 236 |
| 348 | 3300053120 | Ga0500597_004368 | Ga0500597_004368_1081_1863 | 236 |
| 349 | 3300053157 | Ga0500624_000041 | Ga0500624_000041_50153_50935 | 236 |
| 350 | 3300053178 | Ga0500637_0000206 | Ga0500637_0000206_20_802 | 236 |
| 351 | 3300005295 | Ga0065707_10082179 | Ga0065707_1008217918 | 237 |
| 352 | 3300005327 | Ga0070658_10045870 | Ga0070658_100458702 | 237 |
| 353 | 3300005336 | Ga0070680_100100450 | Ga0070680_1001004502 | 237 |
| 354 | 3300005339 | Ga0070660_100016809 | Ga0070660_1000168092 | 237 |
| 355 | 3300005341 | Ga0070691_10022777 | Ga0070691_100227773 | 237 |
| 356 | 3300005366 | Ga0070659_100037928 | Ga0070659_1000379283 | 237 |
| 357 | 3300005455 | Ga0070663_100046764 | Ga0070663_1000467642 | 237 |
| 358 | 3300005539 | Ga0068853_100001204 | Ga0068853_1000012043 | 237 |
| 359 | 3300005563 | Ga0068855_100012015 | Ga0068855_1000120158 | 237 |
| 360 | 3300005578 | Ga0068854_100111245 | Ga0068854_1001112452 | 237 |
| 361 | 3300009177 | Ga0105248_10000005 | Ga0105248_10000005529 | 237 |
| 362 | 3300009551 | Ga0105238_10013382 | Ga0105238_100133823 | 237 |
| 363 | 3300013102 | Ga0157371_10059879 | Ga0157371_100598793 | 237 |
| 364 | 3300013104 | Ga0157370_10013933 | Ga0157370_100139333 | 237 |
| 365 | 3300013307 | Ga0157372_10004635 | Ga0157372_100046356 | 237 |
| 366 | 3300013307 | Ga0157372_10011558 | Ga0157372_100115586 | 237 |
| 367 | 3300013307 | Ga0157372_10044607 | Ga0157372_100446075 | 237 |
| 368 | 3300014326 | Ga0157380_10000346 | Ga0157380_1000034613 | 237 |
| 369 | 3300021384 | Ga0213876_10000201 | Ga0213876_1000020117 | 237 |
| 370 | 3300021388 | Ga0213875_10000228 | Ga0213875_1000022833 | 237 |
| 371 | 3300025909 | Ga0207705_10000391 | Ga0207705_1000039119 | 237 |
| 372 | 3300025911 | Ga0207654_10041310 | Ga0207654_100413102 | 237 |
| 373 | 3300025912 | Ga0207707_10008623 | Ga0207707_100086233 | 237 |
| 374 | 3300025917 | Ga0207660_10008613 | Ga0207660_100086133 | 237 |
| 375 | 3300025919 | Ga0207657_10001337 | Ga0207657_100013376 | 237 |
| 376 | 3300025921 | Ga0207652_10021313 | Ga0207652_100213133 | 237 |
| 377 | 3300025932 | Ga0207690_10032885 | Ga0207690_100328852 | 237 |
| 378 | 3300025941 | Ga0207711_10000002 | Ga0207711_10000002526 | 237 |
| 379 | 3300025981 | Ga0207640_10241577 | Ga0207640_102415772 | 237 |
| 380 | 3300026067 | Ga0207678_10031842 | Ga0207678_100318422 | 237 |
| 381 | 3300028380 | Ga0268265_10280687 | Ga0268265_102806872 | 237 |
| 382 | 3300028800 | Ga0265338_10000005 | Ga0265338_10000005370 | 237 |
| 383 | 3300031241 | Ga0265325_10000005 | Ga0265325_10000005147 | 237 |
| 384 | 3300031249 | Ga0265339_10002598 | Ga0265339_100025983 | 237 |
| 385 | 3300031250 | Ga0265331_10012945 | Ga0265331_100129453 | 237 |
| 386 | 3300031595 | Ga0265313_10014393 | Ga0265313_100143933 | 237 |
| 387 | 3300031711 | Ga0265314_10012124 | Ga0265314_100121245 | 237 |
| 388 | 3300031711 | Ga0265314_10118251 | Ga0265314_101182512 | 237 |
| 389 | 3300032004 | Ga0307414_10003389 | Ga0307414_100033891 | 237 |
| 390 | 3300037853 | Ga0436364_1065372 | Ga0436364_1065372_133504_134325 | 237 |
| 391 | 3300039437 | Ga0436365_1073490 | Ga0436365_1073490_28567_29358 | 237 |
| 392 | 3300039437 | Ga0436365_1469416 | Ga0436365_1469416_302_1123 | 237 |
| 393 | 3300039450 | Ga0436363_0399751 | Ga0436363_0399751_8013_8807 | 237 |
| 394 | 3300046507 | Ga0495606_0000078 | Ga0495606_0000078_82399_83187 | 237 |
| 395 | 3300046522 | Ga0495643_0011590 | Ga0495643_0011590_3896_4684 | 237 |
| 396 | 3300046524 | Ga0495648_0000748 | Ga0495648_0000748_8344_9132 | 237 |
| 397 | 3300047469 | Ga0495673_0000270 | Ga0495673_0000270_25751_26539 | 237 |
| 398 | 3300049570 | Ga0501033_0098754 | Ga0501033_0098754_89_883 | 237 |
| 399 | 3300049571 | Ga0501034_0079948 | Ga0501034_0079948_942_1736 | 237 |
| 400 | 3300049572 | Ga0501036_0136834 | Ga0501036_0136834_344_1138 | 237 |
| 401 | 3300049574 | Ga0501038_0392377 | Ga0501038_0392377_124_918 | 237 |
| 402 | 3300049581 | Ga0501047_0372523 | Ga0501047_0372523_114_908 | 237 |
| 403 | 3300049582 | Ga0501048_0084229 | Ga0501048_0084229_816_1610 | 237 |
| 404 | 3300049583 | Ga0501067_0034861 | Ga0501067_0034861_1269_2063 | 237 |
| 405 | 3300049584 | Ga0501068_0265698 | Ga0501068_0265698_113_907 | 237 |
| 406 | 3300049585 | Ga0501069_0005058 | Ga0501069_0005058_872_1666 | 237 |
| 407 | 3300049586 | Ga0501070_0000002 | Ga0501070_0000002_226067_226861 | 237 |
| 408 | 3300049586 | Ga0501070_0021858 | Ga0501070_0021858_2017_2811 | 237 |
| 409 | 3300049590 | Ga0501074_0082600 | Ga0501074_0082600_131_925 | 237 |
| 410 | 3300049741 | Ga0501079_0022801 | Ga0501079_0022801_2645_3439 | 237 |
| 411 | 3300049742 | Ga0501080_0003580 | Ga0501080_0003580_2623_3417 | 237 |
| 412 | 3300049742 | Ga0501080_0011904 | Ga0501080_0011904_2312_3106 | 237 |
| 413 | 3300049742 | Ga0501080_0052166 | Ga0501080_0052166_1634_2428 | 237 |
| 414 | 3300049744 | Ga0501083_0168217 | Ga0501083_0168217_307_1101 | 237 |
| 415 | 3300049822 | Ga0501035_0018850 | Ga0501035_0018850_2986_3780 | 237 |
| 416 | 3300049823 | Ga0501044_0000378 | Ga0501044_0000378_12033_12827 | 237 |
| 417 | 3300049823 | Ga0501044_0015636 | Ga0501044_0015636_392_1180 | 237 |
| 418 | 3300049823 | Ga0501044_0029141 | Ga0501044_0029141_1774_2568 | 237 |
| 419 | 3300049823 | Ga0501044_0029793 | Ga0501044_0029793_4356_5150 | 237 |
| 420 | 3300049823 | Ga0501044_0099883 | Ga0501044_0099883_1078_1872 | 237 |
| 421 | 3300053087 | Ga0500643_012667 | Ga0500643_012667_64_852 | 237 |
| 422 | 3300053088 | Ga0500644_0000142 | Ga0500644_0000142_41857_42645 | 237 |
| 423 | 3300053138 | Ga0500564_000219 | Ga0500564_000219_13620_14408 | 237 |
| 424 | 3300053154 | Ga0500619_020944 | Ga0500619_020944_169_963 | 237 |
| 425 | 3300054114 | Ga0501084_0000017 | Ga0501084_0000017_98094_98888 | 237 |
| 426 | 3300054114 | Ga0501084_0067831 | Ga0501084_0067831_1011_1805 | 237 |
| 427 | 3300055283 | Ga0500661_029894 | Ga0500661_029894_60_848 | 237 |
| 428 | iso_pu_bacteria | 2643221560 | 2643822857 | 237 |
| 429 | 3300003215 | JGI25153J46596_10000007 | JGI25153J46596_10000007208 | 238 |
| 430 | 3300005331 | Ga0070670_100088543 | Ga0070670_1000885432 | 238 |
| 431 | 3300005335 | Ga0070666_10008011 | Ga0070666_100080114 | 238 |
| 432 | 3300005336 | Ga0070680_100000110 | Ga0070680_10000011032 | 238 |
| 433 | 3300005336 | Ga0070680_100556418 | Ga0070680_1005564181 | 238 |
| 434 | 3300005347 | Ga0070668_100000089 | Ga0070668_10000008950 | 238 |
| 435 | 3300005353 | Ga0070669_100003790 | Ga0070669_10000379011 | 238 |
| 436 | 3300005367 | Ga0070667_100000081 | Ga0070667_100000081102 | 238 |
| 437 | 3300005435 | Ga0070714_100019518 | Ga0070714_1000195185 | 238 |
| 438 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001389 | 238 |
| 439 | 3300005530 | Ga0070679_100000032 | Ga0070679_1000000323 | 238 |
| 440 | 3300005841 | Ga0068863_100000099 | Ga0068863_10000009917 | 238 |
| 441 | 3300005843 | Ga0068860_100009295 | Ga0068860_1000092953 | 238 |
| 442 | 3300005844 | Ga0068862_100092132 | Ga0068862_1000921323 | 238 |
| 443 | 3300006175 | Ga0070712_100378318 | Ga0070712_1003783181 | 238 |
| 444 | 3300009551 | Ga0105238_10525531 | Ga0105238_105255312 | 238 |
| 445 | 3300010375 | Ga0105239_10005268 | Ga0105239_100052687 | 238 |
| 446 | 3300013307 | Ga0157372_10283496 | Ga0157372_102834962 | 238 |
| 447 | 3300025292 | Ga0209676_1000084 | Ga0209676_1000084266 | 238 |
| 448 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017205 | 238 |
| 449 | 3300025903 | Ga0207680_10008005 | Ga0207680_100080054 | 238 |
| 450 | 3300025912 | Ga0207707_10000001 | Ga0207707_1000000176 | 238 |
| 451 | 3300025915 | Ga0207693_10295073 | Ga0207693_102950731 | 238 |
| 452 | 3300025917 | Ga0207660_10001819 | Ga0207660_1000181911 | 238 |
| 453 | 3300025921 | Ga0207652_10000419 | Ga0207652_100004194 | 238 |
| 454 | 3300025923 | Ga0207681_10054823 | Ga0207681_100548234 | 238 |
| 455 | 3300025929 | Ga0207664_10037985 | Ga0207664_100379852 | 238 |
| 456 | 3300025972 | Ga0207668_10000051 | Ga0207668_1000005178 | 238 |
| 457 | 3300025986 | Ga0207658_10000062 | Ga0207658_1000006216 | 238 |
| 458 | 3300026088 | Ga0207641_10000014 | Ga0207641_1000001474 | 238 |
| 459 | 3300028380 | Ga0268265_10095239 | Ga0268265_100952392 | 238 |
| 460 | 3300028381 | Ga0268264_10012308 | Ga0268264_100123083 | 238 |
| 461 | 3300028800 | Ga0265338_10018931 | Ga0265338_100189312 | 238 |
| 462 | 3300031238 | Ga0265332_10105667 | Ga0265332_101056672 | 238 |
| 463 | 3300031241 | Ga0265325_10003316 | Ga0265325_100033164 | 238 |
| 464 | 3300031247 | Ga0265340_10034886 | Ga0265340_100348862 | 238 |
| 465 | 3300031249 | Ga0265339_10002558 | Ga0265339_100025586 | 238 |
| 466 | 3300031595 | Ga0265313_10033370 | Ga0265313_100333702 | 238 |
| 467 | 3300031711 | Ga0265314_10117820 | Ga0265314_101178202 | 238 |
| 468 | 3300031712 | Ga0265342_10076101 | Ga0265342_100761012 | 238 |
| 469 | 3300031911 | Ga0307412_10055008 | Ga0307412_100550083 | 238 |
| 470 | 3300032004 | Ga0307414_10062012 | Ga0307414_100620123 | 238 |
| 471 | 3300035171 | Ga0373946_0022552 | Ga0373946_0022552_976_1773 | 238 |
| 472 | 3300035172 | Ga0373955_0069437 | Ga0373955_0069437_1065_1856 | 238 |
| 473 | 3300035692 | Ga0373935_0069528 | Ga0373935_0069528_127_924 | 238 |
| 474 | 3300035725 | Ga0373947_0008391 | Ga0373947_0008391_2927_3724 | 238 |
| 475 | 3300036401 | Ga0373937_0258748 | Ga0373937_0258748_25_816 | 238 |
| 476 | 3300037068 | Ga0373925_0025017 | Ga0373925_0025017_1146_1943 | 238 |
| 477 | 3300037068 | Ga0373925_0037097 | Ga0373925_0037097_857_1654 | 238 |
| 478 | 3300039062 | Ga0400483_101908 | Ga0400483_101908_575_1366 | 238 |
| 479 | 3300044712 | Ga0453684_0293163 | Ga0453684_0293163_231_1019 | 238 |
| 480 | 3300046454 | Ga0495592_0122821 | Ga0495592_0122821_451_1248 | 238 |
| 481 | 3300046471 | Ga0495650_0001660 | Ga0495650_0001660_4222_5013 | 238 |
| 482 | 3300046472 | Ga0495580_0012332 | Ga0495580_0012332_3833_4630 | 238 |
| 483 | 3300046543 | Ga0495645_0080018 | Ga0495645_0080018_1029_1826 | 238 |
| 484 | 3300046683 | Ga0495658_0010226 | Ga0495658_0010226_698_1495 | 238 |
| 485 | 3300046689 | Ga0495613_0243307 | Ga0495613_0243307_160_957 | 238 |
| 486 | 3300047317 | Ga0495604_0295417 | Ga0495604_0295417_32_829 | 238 |
| 487 | 3300049569 | Ga0501032_0153860 | Ga0501032_0153860_237_1040 | 238 |
| 488 | 3300049570 | Ga0501033_0172391 | Ga0501033_0172391_562_1365 | 238 |
| 489 | 3300049571 | Ga0501034_0108480 | Ga0501034_0108480_267_1070 | 238 |
| 490 | 3300049571 | Ga0501034_0192076 | Ga0501034_0192076_358_1173 | 238 |
| 491 | 3300049571 | Ga0501034_0271308 | Ga0501034_0271308_331_1134 | 238 |
| 492 | 3300049572 | Ga0501036_0009156 | Ga0501036_0009156_7028_7831 | 238 |
| 493 | 3300049573 | Ga0501037_0026713 | Ga0501037_0026713_1936_2721 | 238 |
| 494 | 3300049574 | Ga0501038_0029433 | Ga0501038_0029433_3971_4765 | 238 |
| 495 | 3300049574 | Ga0501038_0181272 | Ga0501038_0181272_136_921 | 238 |
| 496 | 3300049575 | Ga0501039_0005227 | Ga0501039_0005227_8082_8867 | 238 |
| 497 | 3300049575 | Ga0501039_0043147 | Ga0501039_0043147_88_891 | 238 |
| 498 | 3300049577 | Ga0501041_0031462 | Ga0501041_0031462_1276_2061 | 238 |
| 499 | 3300049578 | Ga0501042_0098487 | Ga0501042_0098487_856_1641 | 238 |
| 500 | 3300049579 | Ga0501043_0010112 | Ga0501043_0010112_209_994 | 238 |
| 501 | 3300049580 | Ga0501046_0356427 | Ga0501046_0356427_220_1005 | 238 |
| 502 | 3300049581 | Ga0501047_0013767 | Ga0501047_0013767_1464_2258 | 238 |
| 503 | 3300049581 | Ga0501047_0166381 | Ga0501047_0166381_935_1750 | 238 |
| 504 | 3300049581 | Ga0501047_0253401 | Ga0501047_0253401_562_1365 | 238 |
| 505 | 3300049581 | Ga0501047_0268809 | Ga0501047_0268809_563_1366 | 238 |
| 506 | 3300049583 | Ga0501067_0000980 | Ga0501067_0000980_9933_10748 | 238 |
| 507 | 3300049584 | Ga0501068_0059171 | Ga0501068_0059171_249_1034 | 238 |
| 508 | 3300049585 | Ga0501069_0175942 | Ga0501069_0175942_424_1209 | 238 |
| 509 | 3300049586 | Ga0501070_0257677 | Ga0501070_0257677_533_1348 | 238 |
| 510 | 3300049588 | Ga0501072_0050053 | Ga0501072_0050053_844_1659 | 238 |
| 511 | 3300049590 | Ga0501074_0450056 | Ga0501074_0450056_43_828 | 238 |
| 512 | 3300049591 | Ga0501075_0009709 | Ga0501075_0009709_1619_2404 | 238 |
| 513 | 3300049592 | Ga0501076_0009741 | Ga0501076_0009741_3317_4102 | 238 |
| 514 | 3300049593 | Ga0501077_0074383 | Ga0501077_0074383_1330_2115 | 238 |
| 515 | 3300049741 | Ga0501079_0016537 | Ga0501079_0016537_2250_3035 | 238 |
| 516 | 3300049743 | Ga0501081_0000375 | Ga0501081_0000375_10742_11527 | 238 |
| 517 | 3300049822 | Ga0501035_0127922 | Ga0501035_0127922_452_1255 | 238 |
| 518 | 3300049823 | Ga0501044_0014944 | Ga0501044_0014944_3906_4700 | 238 |
| 519 | 3300049823 | Ga0501044_0254324 | Ga0501044_0254324_331_1134 | 238 |
| 520 | 3300049824 | Ga0501045_0084013 | Ga0501045_0084013_471_1256 | 238 |
| 521 | 3300053116 | Ga0500592_005174 | Ga0500592_005174_838_1638 | 238 |
| 522 | 3300053158 | Ga0500627_0000149 | Ga0500627_0000149_5806_6606 | 238 |
| 523 | 3300054114 | Ga0501084_0048106 | Ga0501084_0048106_1319_2104 | 238 |
| 524 | 3300054114 | Ga0501084_0110200 | Ga0501084_0110200_288_1103 | 238 |
| 525 | 3300060353 | Ga0501082_0025498 | Ga0501082_0025498_3535_4320 | 238 |
| 526 | iso_pu_bacteria | 2643221563 | 2643832522 | 238 |
| 527 | iso_pu_bacteria | 2643221608 | 2644053683 | 238 |
| 528 | iso_pu_bacteria | 2852680915 | 2852681417 | 238 |
| 529 | 3300005335 | Ga0070666_10028389 | Ga0070666_100283892 | 239 |
| 530 | 3300005347 | Ga0070668_100002202 | Ga0070668_1000022023 | 239 |
| 531 | 3300005353 | Ga0070669_100513250 | Ga0070669_1005132501 | 239 |
| 532 | 3300005355 | Ga0070671_100001555 | Ga0070671_10000155513 | 239 |
| 533 | 3300005367 | Ga0070667_100002070 | Ga0070667_10000207013 | 239 |
| 534 | 3300005437 | Ga0070710_10094523 | Ga0070710_100945232 | 239 |
| 535 | 3300005545 | Ga0070695_100116187 | Ga0070695_1001161871 | 239 |
| 536 | 3300005546 | Ga0070696_100121391 | Ga0070696_1001213912 | 239 |
| 537 | 3300005617 | Ga0068859_100039771 | Ga0068859_1000397713 | 239 |
| 538 | 3300005618 | Ga0068864_100003647 | Ga0068864_1000036477 | 239 |
| 539 | 3300005842 | Ga0068858_100000432 | Ga0068858_10000043213 | 239 |
| 540 | 3300005843 | Ga0068860_100002902 | Ga0068860_10000290214 | 239 |
| 541 | 3300005844 | Ga0068862_100002243 | Ga0068862_10000224313 | 239 |
| 542 | 3300006852 | Ga0075433_10147527 | Ga0075433_101475272 | 239 |
| 543 | 3300006871 | Ga0075434_100014637 | Ga0075434_1000146373 | 239 |
| 544 | 3300006914 | Ga0075436_100018816 | Ga0075436_1000188162 | 239 |
| 545 | 3300006931 | Ga0097620_100039774 | Ga0097620_1000397743 | 239 |
| 546 | 3300009147 | Ga0114129_10177528 | Ga0114129_101775282 | 239 |
| 547 | 3300025294 | Ga0209025_1090805 | Ga0209025_10908051 | 239 |
| 548 | 3300025898 | Ga0207692_10103439 | Ga0207692_101034392 | 239 |
| 549 | 3300025903 | Ga0207680_10005625 | Ga0207680_100056253 | 239 |
| 550 | 3300025921 | Ga0207652_10019708 | Ga0207652_100197087 | 239 |
| 551 | 3300025923 | Ga0207681_10005139 | Ga0207681_100051393 | 239 |
| 552 | 3300025923 | Ga0207681_10032420 | Ga0207681_100324202 | 239 |
| 553 | 3300025925 | Ga0207650_10004495 | Ga0207650_100044956 | 239 |
| 554 | 3300025931 | Ga0207644_10001453 | Ga0207644_100014533 | 239 |
| 555 | 3300025972 | Ga0207668_10000287 | Ga0207668_1000028717 | 239 |
| 556 | 3300025986 | Ga0207658_10001520 | Ga0207658_100015204 | 239 |
| 557 | 3300026035 | Ga0207703_10006894 | Ga0207703_100068945 | 239 |
| 558 | 3300026088 | Ga0207641_10000857 | Ga0207641_1000085725 | 239 |
| 559 | 3300026088 | Ga0207641_10024890 | Ga0207641_100248903 | 239 |
| 560 | 3300026095 | Ga0207676_10002576 | Ga0207676_100025767 | 239 |
| 561 | 3300026118 | Ga0207675_100152325 | Ga0207675_1001523252 | 239 |
| 562 | 3300028380 | Ga0268265_10001738 | Ga0268265_1000173813 | 239 |
| 563 | 3300028381 | Ga0268264_10001483 | Ga0268264_1000148317 | 239 |
| 564 | 3300039438 | Ga0436360_1001166 | Ga0436360_1001166_707_1510 | 239 |
| 565 | 3300046539 | Ga0495621_0015587 | Ga0495621_0015587_1573_2367 | 239 |
| 566 | 3300050507 | nmdc:mga05p37_166992_c2 | nmdc:mga05p37_166992_c2_450_1253 | 239 |
| 567 | 3300050512 | nmdc:mga0n895_84254_c1 | nmdc:mga0n895_84254_c1_1883_2686 | 239 |
| 568 | 3300050515 | nmdc:mga0a205_82685_c1 | nmdc:mga0a205_82685_c1_2102_2905 | 239 |
| 569 | 3300061719 | Ga0466962_0230650 | Ga0466962_0230650_85_876 | 239 |
| 570 | iso_pu_bacteria | 2852653556 | 2852654882 | 239 |
| 571 | 3300005340 | Ga0070689_100035411 | Ga0070689_1000354115 | 240 |
| 572 | 3300005466 | Ga0070685_10041332 | Ga0070685_100413322 | 240 |
| 573 | 3300005468 | Ga0070707_100313669 | Ga0070707_1003136692 | 240 |
| 574 | 3300005468 | Ga0070707_100549924 | Ga0070707_1005499242 | 240 |
| 575 | 3300005471 | Ga0070698_100096571 | Ga0070698_1000965712 | 240 |
| 576 | 3300005544 | Ga0070686_100145603 | Ga0070686_1001456032 | 240 |
| 577 | 3300005545 | Ga0070695_100138448 | Ga0070695_1001384482 | 240 |
| 578 | 3300005545 | Ga0070695_100143869 | Ga0070695_1001438692 | 240 |
| 579 | 3300005546 | Ga0070696_100132184 | Ga0070696_1001321842 | 240 |
| 580 | 3300005618 | Ga0068864_100020321 | Ga0068864_1000203213 | 240 |
| 581 | 3300005844 | Ga0068862_100031511 | Ga0068862_1000315114 | 240 |
| 582 | 3300006852 | Ga0075433_10002091 | Ga0075433_100020915 | 240 |
| 583 | 3300007076 | Ga0075435_100143759 | Ga0075435_1001437592 | 240 |
| 584 | 3300009094 | Ga0111539_10004799 | Ga0111539_100047991 | 240 |
| 585 | 3300009147 | Ga0114129_11227502 | Ga0114129_112275021 | 240 |
| 586 | 3300009177 | Ga0105248_10003309 | Ga0105248_100033092 | 240 |
| 587 | 3300014968 | Ga0157379_10022857 | Ga0157379_100228574 | 240 |
| 588 | 3300025922 | Ga0207646_10113189 | Ga0207646_101131892 | 240 |
| 589 | 3300025922 | Ga0207646_10275399 | Ga0207646_102753992 | 240 |
| 590 | 3300025941 | Ga0207711_10029196 | Ga0207711_100291963 | 240 |
| 591 | 3300026035 | Ga0207703_10001408 | Ga0207703_100014087 | 240 |
| 592 | 3300026089 | Ga0207648_10315454 | Ga0207648_103154542 | 240 |
| 593 | 3300027907 | Ga0207428_10073233 | Ga0207428_100732333 | 240 |
| 594 | 3300031241 | Ga0265325_10005575 | Ga0265325_100055753 | 240 |
| 595 | 3300031247 | Ga0265340_10005438 | Ga0265340_100054383 | 240 |
| 596 | 3300031247 | Ga0265340_10112087 | Ga0265340_101120872 | 240 |
| 597 | 3300031249 | Ga0265339_10001877 | Ga0265339_100018773 | 240 |
| 598 | 3300031249 | Ga0265339_10038996 | Ga0265339_100389962 | 240 |
| 599 | 3300031249 | Ga0265339_10164828 | Ga0265339_101648281 | 240 |
| 600 | 3300031344 | Ga0265316_10197283 | Ga0265316_101972832 | 240 |
| 601 | 3300031711 | Ga0265314_10000125 | Ga0265314_1000012549 | 240 |
| 602 | 3300031712 | Ga0265342_10012164 | Ga0265342_100121644 | 240 |
| 603 | 3300038443 | Ga0395901_0226672 | Ga0395901_0226672_1079_1873 | 240 |
| 604 | 3300045051 | Ga0451576_0054726 | Ga0451576_0054726_470_1258 | 240 |
| 605 | 3300046537 | Ga0495598_0019749 | Ga0495598_0019749_431_1231 | 240 |
| 606 | 3300046558 | Ga0495633_0085839 | Ga0495633_0085839_536_1336 | 240 |
| 607 | 3300050511 | nmdc:mga08y16_2749_c1 | nmdc:mga08y16_2749_c1_15753_16541 | 240 |
| 608 | 3300050513 | nmdc:mga0rr50_125378_c1 | nmdc:mga0rr50_125378_c1_895_1683 | 240 |
| 609 | 3300053108 | Ga0500562_000281 | Ga0500562_000281_2322_3122 | 240 |
| 610 | 3300028381 | Ga0268264_10295208 | Ga0268264_102952082 | 241 |
| 611 | 3300005341 | Ga0070691_10163248 | Ga0070691_101632481 | 250 |
| 612 | 3300005347 | Ga0070668_100073886 | Ga0070668_1000738863 | 250 |
| 613 | 3300013306 | Ga0163162_10088265 | Ga0163162_100882652 | 250 |
| 614 | 3300025972 | Ga0207668_10065194 | Ga0207668_100651942 | 250 |
| 615 | 3300005335 | Ga0070666_10026179 | Ga0070666_100261793 | 253 |
| 616 | 3300005367 | Ga0070667_100040279 | Ga0070667_1000402793 | 253 |
| 617 | 3300006048 | Ga0075363_100002626 | Ga0075363_1000026268 | 253 |
| 618 | 3300009553 | Ga0105249_10002484 | Ga0105249_1000248413 | 253 |
| 619 | 3300010375 | Ga0105239_10157411 | Ga0105239_101574114 | 253 |
| 620 | 3300025961 | Ga0207712_10008147 | Ga0207712_100081476 | 253 |
| 621 | 3300048911 | Ga0496108_0017612 | Ga0496108_0017612_917_1744 | 253 |
| 622 | 3300048912 | Ga0496109_0077119 | Ga0496109_0077119_304_1131 | 253 |
| 623 | 3300048915 | Ga0496112_0005828 | Ga0496112_0005828_5617_6444 | 253 |
| 624 | 3300048916 | Ga0496113_0097261 | Ga0496113_0097261_1269_2096 | 253 |
| 625 | 3300002073 | JGI24745J21846_1005543 | JGI24745J21846_10055432 | 255 |
| 626 | 3300002076 | JGI24749J21850_1000704 | JGI24749J21850_10007045 | 255 |
| 627 | 3300005330 | Ga0070690_100027745 | Ga0070690_1000277452 | 255 |
| 628 | 3300005334 | Ga0068869_100002460 | Ga0068869_1000024608 | 255 |
| 629 | 3300005338 | Ga0068868_100000389 | Ga0068868_10000038914 | 255 |
| 630 | 3300005339 | Ga0070660_100455384 | Ga0070660_1004553842 | 255 |
| 631 | 3300005340 | Ga0070689_100017445 | Ga0070689_1000174453 | 255 |
| 632 | 3300005340 | Ga0070689_100063768 | Ga0070689_1000637685 | 255 |
| 633 | 3300005341 | Ga0070691_10010668 | Ga0070691_100106684 | 255 |
| 634 | 3300005347 | Ga0070668_100007157 | Ga0070668_1000071576 | 255 |
| 635 | 3300005356 | Ga0070674_100000125 | Ga0070674_10000012514 | 255 |
| 636 | 3300005356 | Ga0070674_100027141 | Ga0070674_1000271411 | 255 |
| 637 | 3300005365 | Ga0070688_100005716 | Ga0070688_1000057166 | 255 |
| 638 | 3300005366 | Ga0070659_100258406 | Ga0070659_1002584062 | 255 |
| 639 | 3300005366 | Ga0070659_100480189 | Ga0070659_1004801891 | 255 |
| 640 | 3300005367 | Ga0070667_100114032 | Ga0070667_1001140323 | 255 |
| 641 | 3300005367 | Ga0070667_100593947 | Ga0070667_1005939471 | 255 |
| 642 | 3300005434 | Ga0070709_10112514 | Ga0070709_101125142 | 255 |
| 643 | 3300005437 | Ga0070710_10000998 | Ga0070710_1000099814 | 255 |
| 644 | 3300005439 | Ga0070711_100000244 | Ga0070711_10000024426 | 255 |
| 645 | 3300005439 | Ga0070711_100051210 | Ga0070711_1000512102 | 255 |
| 646 | 3300005441 | Ga0070700_100000508 | Ga0070700_1000005088 | 255 |
| 647 | 3300005441 | Ga0070700_100333272 | Ga0070700_1003332722 | 255 |
| 648 | 3300005444 | Ga0070694_100044937 | Ga0070694_1000449374 | 255 |
| 649 | 3300005455 | Ga0070663_100061540 | Ga0070663_1000615402 | 255 |
| 650 | 3300005456 | Ga0070678_100001179 | Ga0070678_10000117914 | 255 |
| 651 | 3300005457 | Ga0070662_100057950 | Ga0070662_1000579504 | 255 |
| 652 | 3300005459 | Ga0068867_100000535 | Ga0068867_10000053514 | 255 |
| 653 | 3300005539 | Ga0068853_100001519 | Ga0068853_1000015194 | 255 |
| 654 | 3300005546 | Ga0070696_100001935 | Ga0070696_10000193514 | 255 |
| 655 | 3300005546 | Ga0070696_100048911 | Ga0070696_1000489112 | 255 |
| 656 | 3300005549 | Ga0070704_100000174 | Ga0070704_10000017414 | 255 |
| 657 | 3300005549 | Ga0070704_100130674 | Ga0070704_1001306742 | 255 |
| 658 | 3300005578 | Ga0068854_100021666 | Ga0068854_1000216663 | 255 |
| 659 | 3300005616 | Ga0068852_100006688 | Ga0068852_1000066886 | 255 |
| 660 | 3300005617 | Ga0068859_100000801 | Ga0068859_1000008019 | 255 |
| 661 | 3300005718 | Ga0068866_10007585 | Ga0068866_100075856 | 255 |
| 662 | 3300005718 | Ga0068866_10246645 | Ga0068866_102466452 | 255 |
| 663 | 3300005719 | Ga0068861_100001120 | Ga0068861_10000112014 | 255 |
| 664 | 3300005842 | Ga0068858_100001869 | Ga0068858_1000018694 | 255 |
| 665 | 3300005843 | Ga0068860_100000743 | Ga0068860_10000074314 | 255 |
| 666 | 3300005843 | Ga0068860_100391869 | Ga0068860_1003918692 | 255 |
| 667 | 3300005844 | Ga0068862_100001026 | Ga0068862_10000102625 | 255 |
| 668 | 3300005844 | Ga0068862_100562130 | Ga0068862_1005621302 | 255 |
| 669 | 3300005981 | Ga0081538_10072604 | Ga0081538_100726042 | 255 |
| 670 | 3300006163 | Ga0070715_10018541 | Ga0070715_100185413 | 255 |
| 671 | 3300006173 | Ga0070716_100004418 | Ga0070716_1000044183 | 255 |
| 672 | 3300006173 | Ga0070716_100013940 | Ga0070716_1000139402 | 255 |
| 673 | 3300006175 | Ga0070712_100001412 | Ga0070712_1000014125 | 255 |
| 674 | 3300006175 | Ga0070712_100034871 | Ga0070712_1000348712 | 255 |
| 675 | 3300006844 | Ga0075428_100021051 | Ga0075428_1000210518 | 255 |
| 676 | 3300006846 | Ga0075430_100010789 | Ga0075430_1000107893 | 255 |
| 677 | 3300006847 | Ga0075431_100071733 | Ga0075431_1000717333 | 255 |
| 678 | 3300006881 | Ga0068865_100000524 | Ga0068865_10000052410 | 255 |
| 679 | 3300006881 | Ga0068865_100033278 | Ga0068865_1000332782 | 255 |
| 680 | 3300006931 | Ga0097620_100000801 | Ga0097620_1000008019 | 255 |
| 681 | 3300009098 | Ga0105245_10000805 | Ga0105245_1000080518 | 255 |
| 682 | 3300009101 | Ga0105247_10000806 | Ga0105247_100008062 | 255 |
| 683 | 3300009147 | Ga0114129_10024084 | Ga0114129_100240843 | 255 |
| 684 | 3300009148 | Ga0105243_10000892 | Ga0105243_1000089220 | 255 |
| 685 | 3300009148 | Ga0105243_10158865 | Ga0105243_101588652 | 255 |
| 686 | 3300009174 | Ga0105241_10035178 | Ga0105241_100351781 | 255 |
| 687 | 3300009176 | Ga0105242_10000906 | Ga0105242_1000090622 | 255 |
| 688 | 3300009177 | Ga0105248_10773013 | Ga0105248_107730131 | 255 |
| 689 | 3300009545 | Ga0105237_10033645 | Ga0105237_100336455 | 255 |
| 690 | 3300009553 | Ga0105249_10016052 | Ga0105249_100160524 | 255 |
| 691 | 3300009553 | Ga0105249_10189334 | Ga0105249_101893342 | 255 |
| 692 | 3300011119 | Ga0105246_10142649 | Ga0105246_101426492 | 255 |
| 693 | 3300013296 | Ga0157374_10149026 | Ga0157374_101490262 | 255 |
| 694 | 3300013297 | Ga0157378_10002708 | Ga0157378_100027086 | 255 |
| 695 | 3300013306 | Ga0163162_10001291 | Ga0163162_100012915 | 255 |
| 696 | 3300013306 | Ga0163162_10432924 | Ga0163162_104329242 | 255 |
| 697 | 3300013308 | Ga0157375_10000618 | Ga0157375_1000061829 | 255 |
| 698 | 3300013308 | Ga0157375_10495819 | Ga0157375_104958192 | 255 |
| 699 | 3300014326 | Ga0157380_10001643 | Ga0157380_1000164315 | 255 |
| 700 | 3300014326 | Ga0157380_10204038 | Ga0157380_102040382 | 255 |
| 701 | 3300014968 | Ga0157379_10004513 | Ga0157379_100045133 | 255 |
| 702 | 3300014969 | Ga0157376_10129405 | Ga0157376_101294052 | 255 |
| 703 | 3300017792 | Ga0163161_10000599 | Ga0163161_1000059914 | 255 |
| 704 | 3300025898 | Ga0207692_10017950 | Ga0207692_100179502 | 255 |
| 705 | 3300025899 | Ga0207642_10003369 | Ga0207642_100033694 | 255 |
| 706 | 3300025900 | Ga0207710_10002182 | Ga0207710_100021828 | 255 |
| 707 | 3300025901 | Ga0207688_10000382 | Ga0207688_1000038218 | 255 |
| 708 | 3300025915 | Ga0207693_10001225 | Ga0207693_1000122516 | 255 |
| 709 | 3300025915 | Ga0207693_10001655 | Ga0207693_100016553 | 255 |
| 710 | 3300025916 | Ga0207663_10002421 | Ga0207663_100024215 | 255 |
| 711 | 3300025916 | Ga0207663_10011131 | Ga0207663_100111315 | 255 |
| 712 | 3300025919 | Ga0207657_10380975 | Ga0207657_103809752 | 255 |
| 713 | 3300025927 | Ga0207687_10001234 | Ga0207687_100012347 | 255 |
| 714 | 3300025932 | Ga0207690_10125202 | Ga0207690_101252022 | 255 |
| 715 | 3300025933 | Ga0207706_10007698 | Ga0207706_100076982 | 255 |
| 716 | 3300025935 | Ga0207709_10003516 | Ga0207709_100035167 | 255 |
| 717 | 3300025936 | Ga0207670_10263526 | Ga0207670_102635262 | 255 |
| 718 | 3300025937 | Ga0207669_10002869 | Ga0207669_100028694 | 255 |
| 719 | 3300025937 | Ga0207669_10381462 | Ga0207669_103814621 | 255 |
| 720 | 3300025938 | Ga0207704_10001123 | Ga0207704_100011238 | 255 |
| 721 | 3300025938 | Ga0207704_10500972 | Ga0207704_105009722 | 255 |
| 722 | 3300025939 | Ga0207665_10001338 | Ga0207665_1000133814 | 255 |
| 723 | 3300025939 | Ga0207665_10017396 | Ga0207665_100173961 | 255 |
| 724 | 3300025942 | Ga0207689_10006263 | Ga0207689_100062632 | 255 |
| 725 | 3300025961 | Ga0207712_10017694 | Ga0207712_100176943 | 255 |
| 726 | 3300025986 | Ga0207658_10005225 | Ga0207658_100052258 | 255 |
| 727 | 3300026023 | Ga0207677_10003876 | Ga0207677_100038765 | 255 |
| 728 | 3300026035 | Ga0207703_10446531 | Ga0207703_104465312 | 255 |
| 729 | 3300026041 | Ga0207639_10157364 | Ga0207639_101573642 | 255 |
| 730 | 3300026067 | Ga0207678_10047504 | Ga0207678_100475045 | 255 |
| 731 | 3300026075 | Ga0207708_10001666 | Ga0207708_100016665 | 255 |
| 732 | 3300026075 | Ga0207708_10022507 | Ga0207708_100225072 | 255 |
| 733 | 3300026089 | Ga0207648_10000503 | Ga0207648_1000050312 | 255 |
| 734 | 3300026118 | Ga0207675_100000419 | Ga0207675_10000041930 | 255 |
| 735 | 3300026121 | Ga0207683_10000386 | Ga0207683_1000038630 | 255 |
| 736 | 3300026121 | Ga0207683_10008028 | Ga0207683_100080287 | 255 |
| 737 | 3300026142 | Ga0207698_10024355 | Ga0207698_100243555 | 255 |
| 738 | 3300028380 | Ga0268265_10002139 | Ga0268265_1000213914 | 255 |
| 739 | 3300028381 | Ga0268264_10002766 | Ga0268264_100027665 | 255 |
| 740 | 3300035114 | Ga0373939_0085129 | Ga0373939_0085129_176_1009 | 255 |
| 741 | 3300035691 | Ga0373931_0105078 | Ga0373931_0105078_490_1323 | 255 |
| 742 | 3300041413 | Ga0439465_0031624 | Ga0439465_0031624_299_1132 | 255 |
| 743 | 3300042435 | Ga0439434_0043739 | Ga0439434_0043739_238_1071 | 255 |
| 744 | 3300048903 | Ga0496100_0191174 | Ga0496100_0191174_451_1284 | 255 |
| 745 | 3300048903 | Ga0496100_0310387 | Ga0496100_0310387_309_1142 | 255 |
| 746 | 3300048904 | Ga0496101_0000975 | Ga0496101_0000975_1587_2420 | 255 |
| 747 | 3300048905 | Ga0496102_0008220 | Ga0496102_0008220_3402_4235 | 255 |
| 748 | 3300048905 | Ga0496102_0138570 | Ga0496102_0138570_1028_1861 | 255 |
| 749 | 3300048906 | Ga0496103_0001134 | Ga0496103_0001134_2576_3409 | 255 |
| 750 | 3300048906 | Ga0496103_0078443 | Ga0496103_0078443_898_1731 | 255 |
| 751 | 3300048909 | Ga0496106_0000769 | Ga0496106_0000769_11370_12203 | 255 |
| 752 | 3300048910 | Ga0496107_0000672 | Ga0496107_0000672_5850_6683 | 255 |
| 753 | 3300048910 | Ga0496107_0188925 | Ga0496107_0188925_647_1480 | 255 |
| 754 | 3300048917 | Ga0496114_0000486 | Ga0496114_0000486_2858_3691 | 255 |
| 755 | 3300048917 | Ga0496114_0052904 | Ga0496114_0052904_250_1083 | 255 |
| 756 | 3300048918 | Ga0496115_0003434 | Ga0496115_0003434_8607_9440 | 255 |
| 757 | 3300050507 | nmdc:mga05p37_14495_c2 | nmdc:mga05p37_14495_c2_2543_3376 | 255 |
| 758 | 3300050509 | nmdc:mga0qj67_32207_c1 | nmdc:mga0qj67_32207_c1_954_1787 | 255 |
| 759 | 3300050510 | nmdc:mga06r32_93354_c1 | nmdc:mga06r32_93354_c1_774_1607 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iun-assembly2.cif.gz_A | crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with nad | 0.9125 | 4 | 179 |
| 1hno-assembly1.cif.gz_A | crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae | 0.8928 | 3 | 177 |
| 3fdu-assembly1.cif.gz_B | crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii | 0.8925 | 1 | 181 |
| 8ahz-assembly1.cif.gz_A | native vird of streptomyces virginiae | 0.8913 | 1 | 183 |
| 3r6h-assembly1.cif.gz_A | crystal structure of an enoyl-coa hydratase (echa3) from mycobacterium marinum | 0.8893 | 3 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pbpA02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9727 | 199 | 254 | 1.10.12.10 |
| 3hrxC02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9727 | 200 | 255 | 1.10.12.10 |
| 3gowE02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9697 | 200 | 255 | 1.10.12.10 |
| 3hrxE02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9696 | 200 | 255 | 1.10.12.10 |
| 2qq3D02 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9692 | 199 | 254 | 1.10.12.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S2QXW3-F1-model_v4 | Enoyl-CoA hydratase domain-containing protein 3 | 0.9191 | 2 | 147 |
GO:0005739
GO:0006631 GO:0016020 GO:0016836 |
| AF-A0A3M0ZPQ4-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9156 | 2 | 181 |
GO:0006635
GO:0016836 GO:0016853 |
| AF-A0A3D2FZ80-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9154 | 4 | 179 |
GO:0016829
GO:0016853 GO:0046395 |
| AF-A0A2E4W181-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9118 | 3 | 182 |
GO:0004300
GO:0006631 |
| AF-A0A519YCW7-F1-model_v4 | deleted | 0.9095 | 2 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar