F479474
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 321 | 756 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100621735|Ga0068858_1006217351 |
| Length | 129 |
| Sequence | MKSFGCACNPQPIHCIILIQIMRRDIFQAIADPTRRAIIALIAVQAMTPNALAEHFDTSRQAVSKHLQILTECELVTQEQKGREIYYSLEIEKMKEIDKWLEQYRKIWETRLNQLDDLLATIKKQEKEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 3 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 4 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 223 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 229 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 230 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 231 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 237 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 238 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 239 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 242 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 243 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 244 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 245 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 246 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 247 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 285 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 286 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 287 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 293 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 294 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 300 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 301 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 303 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 304 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 305 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 307 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 309 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 310 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 312 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 313 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 314 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 317 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 318 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0 |
| Isolates | 0.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.43 |
| Nodule | 0 |
| Rhizoplane | 0.79 |
| Rhizosphere | 86.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1761633 | 2162886007 | Bacteria | 195701 |
| 2 | JGI24743J22301_10037794 | 3300001991 | Bacteria | 963 |
| 3 | JGI25162J39368_1000881 | 3300002737 | Bacteria | 19655 |
| 4 | JGI25152J39213_1050914 | 3300002773 | Bacteria | 540 |
| 5 | JGI25153J46596_10011436 | 3300003215 | Bacteria | 3922 |
| 6 | rootH1_10040117 | 3300003316 | Bacteria | 2024 |
| 7 | rootH2_10009258 | 3300003320 | Bacteria | 6636 |
| 8 | rootH2_10075751 | 3300003320 | Bacteria | 2014 |
| 9 | rootH2_10148392 | 3300003320 | Bacteria | 5085 |
| 10 | rootL2_10228164 | 3300003322 | Bacteria | 1451 |
| 11 | rootH1_10041130 | 3300003323 | Bacteria | 1110 |
| 12 | rootH1_10121882 | 3300003323 | Bacteria | 11580 |
| 13 | JGI25160J50197_1002465 | 3300003354 | Bacteria | 8610 |
| 14 | Ga0055535_1002560 | 3300003761 | Bacteria | 6142 |
| 15 | Ga0055542_1015957 | 3300003762 | Bacteria | 1194 |
| 16 | Ga0055526_1007155 | 3300003771 | Bacteria | 5876 |
| 17 | Ga0055526_1013227 | 3300003771 | Bacteria | 3510 |
| 18 | Ga0055528_1000314 | 3300003790 | Bacteria | 40742 |
| 19 | Ga0055530_10000619 | 3300003791 | Bacteria | 30885 |
| 20 | Ga0055531_10048271 | 3300003794 | Bacteria | 1150 |
| 21 | Ga0055543_1014328 | 3300004625 | Bacteria | 1547 |
| 22 | Ga0065165_1000182 | 3300005262 | Bacteria | 110108 |
| 23 | Ga0065704_10000195 | 3300005289 | Bacteria | 195830 |
| 24 | Ga0065704_10074748 | 3300005289 | Bacteria | 6041 |
| 25 | Ga0065704_10077797 | 3300005289 | Bacteria | 4616 |
| 26 | Ga0065704_10409115 | 3300005289 | Bacteria | 733 |
| 27 | Ga0065712_10101133 | 3300005290 | Bacteria | 2007 |
| 28 | Ga0065707_10023401 | 3300005295 | Unclassified | 1221 |
| 29 | Ga0070658_10004280 | 3300005327 | Bacteria | 11663 |
| 30 | Ga0070658_10020569 | 3300005327 | Bacteria | 5290 |
| 31 | Ga0070658_10070911 | 3300005327 | Bacteria | 2853 |
| 32 | Ga0070658_10503165 | 3300005327 | Bacteria | 1047 |
| 33 | Ga0070658_11923110 | 3300005327 | Bacteria | 511 |
| 34 | Ga0070676_10000015 | 3300005328 | Bacteria | 52703 |
| 35 | Ga0070676_10025476 | 3300005328 | Bacteria | 3343 |
| 36 | Ga0070676_10180861 | 3300005328 | Bacteria | 1371 |
| 37 | Ga0070670_100070797 | 3300005331 | Bacteria | 2994 |
| 38 | Ga0070670_101463292 | 3300005331 | Bacteria | 627 |
| 39 | Ga0070670_101972507 | 3300005331 | Bacteria | 538 |
| 40 | Ga0070677_10234154 | 3300005333 | Bacteria | 904 |
| 41 | Ga0068869_100079027 | 3300005334 | Bacteria | 2451 |
| 42 | Ga0068869_100079473 | 3300005334 | Bacteria | 2444 |
| 43 | Ga0068869_100132816 | 3300005334 | Bacteria | 1915 |
| 44 | Ga0068869_100312382 | 3300005334 | Bacteria | 1272 |
| 45 | Ga0068869_100434166 | 3300005334 | Bacteria | 1086 |
| 46 | Ga0068869_100820125 | 3300005334 | Bacteria | 801 |
| 47 | Ga0070666_10000042 | 3300005335 | Bacteria | 112296 |
| 48 | Ga0070666_10026174 | 3300005335 | Bacteria | 3808 |
| 49 | Ga0070666_10581194 | 3300005335 | Bacteria | 816 |
| 50 | Ga0070666_11103400 | 3300005335 | Bacteria | 590 |
| 51 | Ga0070680_100003917 | 3300005336 | Bacteria | 11128 |
| 52 | Ga0070680_100035400 | 3300005336 | Bacteria | 4030 |
| 53 | Ga0068868_100012254 | 3300005338 | Bacteria | 6263 |
| 54 | Ga0068868_100060336 | 3300005338 | Bacteria | 3003 |
| 55 | Ga0068868_100120710 | 3300005338 | Bacteria | 2138 |
| 56 | Ga0068868_100367921 | 3300005338 | Bacteria | 1235 |
| 57 | Ga0068868_101268854 | 3300005338 | Bacteria | 683 |
| 58 | Ga0070660_100028681 | 3300005339 | Bacteria | 4166 |
| 59 | Ga0070660_100044533 | 3300005339 | Bacteria | 3395 |
| 60 | Ga0070660_100169934 | 3300005339 | Bacteria | 1760 |
| 61 | Ga0070660_100432358 | 3300005339 | Bacteria | 1091 |
| 62 | Ga0070660_100588345 | 3300005339 | Bacteria | 930 |
| 63 | Ga0070660_101461093 | 3300005339 | Bacteria | 581 |
| 64 | Ga0070689_100747958 | 3300005340 | Bacteria | 857 |
| 65 | Ga0070691_10110364 | 3300005341 | Bacteria | 1375 |
| 66 | Ga0070687_100131270 | 3300005343 | Bacteria | 1447 |
| 67 | Ga0070661_101832669 | 3300005344 | Bacteria | 515 |
| 68 | Ga0070692_10516515 | 3300005345 | Bacteria | 777 |
| 69 | Ga0070669_100029435 | 3300005353 | Bacteria | 3958 |
| 70 | Ga0070675_100208280 | 3300005354 | Bacteria | 1699 |
| 71 | Ga0070675_100709224 | 3300005354 | Bacteria | 917 |
| 72 | Ga0070675_100969052 | 3300005354 | Bacteria | 780 |
| 73 | Ga0070671_100062516 | 3300005355 | Bacteria | 3100 |
| 74 | Ga0070671_100213561 | 3300005355 | Bacteria | 1636 |
| 75 | Ga0070671_101423470 | 3300005355 | Bacteria | 613 |
| 76 | Ga0070674_101515989 | 3300005356 | Bacteria | 603 |
| 77 | Ga0070674_101552583 | 3300005356 | Bacteria | 596 |
| 78 | Ga0070673_100008611 | 3300005364 | Bacteria | 6794 |
| 79 | Ga0070673_100399007 | 3300005364 | Bacteria | 1229 |
| 80 | Ga0070673_100578329 | 3300005364 | Bacteria | 1023 |
| 81 | Ga0070688_100087821 | 3300005365 | Bacteria | 2026 |
| 82 | Ga0070688_100281550 | 3300005365 | Bacteria | 1195 |
| 83 | Ga0070659_100077889 | 3300005366 | Bacteria | 2644 |
| 84 | Ga0070659_100228350 | 3300005366 | Bacteria | 1538 |
| 85 | Ga0070659_100521248 | 3300005366 | Bacteria | 1015 |
| 86 | Ga0070659_100672469 | 3300005366 | Bacteria | 894 |
| 87 | Ga0070667_100287451 | 3300005367 | Bacteria | 1478 |
| 88 | Ga0070667_100502390 | 3300005367 | Bacteria | 1112 |
| 89 | Ga0070667_100636892 | 3300005367 | Bacteria | 984 |
| 90 | Ga0070667_100674097 | 3300005367 | Bacteria | 956 |
| 91 | Ga0070667_100830050 | 3300005367 | Bacteria | 859 |
| 92 | Ga0070667_101093882 | 3300005367 | Bacteria | 745 |
| 93 | Ga0070667_101094853 | 3300005367 | Bacteria | 745 |
| 94 | Ga0070667_102231714 | 3300005367 | Bacteria | 516 |
| 95 | Ga0070714_100946217 | 3300005435 | Bacteria | 837 |
| 96 | Ga0070701_10088579 | 3300005438 | Bacteria | 1691 |
| 97 | Ga0070701_10164206 | 3300005438 | Bacteria | 1289 |
| 98 | Ga0070701_10194353 | 3300005438 | Bacteria | 1196 |
| 99 | Ga0070700_100047956 | 3300005441 | Bacteria | 2646 |
| 100 | Ga0070700_100059909 | 3300005441 | Bacteria | 2398 |
| 101 | Ga0070708_100520848 | 3300005445 | Unclassified | 1121 |
| 102 | Ga0070678_100007585 | 3300005456 | Bacteria | 6443 |
| 103 | Ga0070678_100436965 | 3300005456 | Bacteria | 1144 |
| 104 | Ga0070678_101047122 | 3300005456 | Bacteria | 752 |
| 105 | Ga0070678_101199434 | 3300005456 | Bacteria | 704 |
| 106 | Ga0070662_100000020 | 3300005457 | Bacteria | 99425 |
| 107 | Ga0070662_100127121 | 3300005457 | Bacteria | 1961 |
| 108 | Ga0070681_10066604 | 3300005458 | Bacteria | 3570 |
| 109 | Ga0070681_10178869 | 3300005458 | Bacteria | 2043 |
| 110 | Ga0070681_10329484 | 3300005458 | Bacteria | 1436 |
| 111 | Ga0070681_10789987 | 3300005458 | Bacteria | 866 |
| 112 | Ga0068867_100005742 | 3300005459 | Bacteria | 8803 |
| 113 | Ga0068867_100015064 | 3300005459 | Bacteria | 5483 |
| 114 | Ga0068867_100034465 | 3300005459 | Bacteria | 3669 |
| 115 | Ga0068867_100270581 | 3300005459 | Bacteria | 1389 |
| 116 | Ga0068867_101069628 | 3300005459 | Bacteria | 735 |
| 117 | Ga0068867_102256935 | 3300005459 | Bacteria | 517 |
| 118 | Ga0070685_10375181 | 3300005466 | Bacteria | 979 |
| 119 | Ga0070685_10731758 | 3300005466 | Bacteria | 724 |
| 120 | Ga0070685_11462197 | 3300005466 | Bacteria | 526 |
| 121 | Ga0070698_100000282 | 3300005471 | Bacteria | 51827 |
| 122 | Ga0070698_100045076 | 3300005471 | Bacteria | 4514 |
| 123 | Ga0070698_100075760 | 3300005471 | Bacteria | 3368 |
| 124 | Ga0070679_100121395 | 3300005530 | Bacteria | 2598 |
| 125 | Ga0070679_101000312 | 3300005530 | Bacteria | 780 |
| 126 | Ga0070684_101435525 | 3300005535 | Unclassified | 650 |
| 127 | Ga0070697_100051518 | 3300005536 | Unclassified | 3344 |
| 128 | Ga0068853_100024000 | 3300005539 | Bacteria | 5111 |
| 129 | Ga0068853_100025264 | 3300005539 | Bacteria | 4984 |
| 130 | Ga0068853_100056937 | 3300005539 | Bacteria | 3372 |
| 131 | Ga0068853_100071038 | 3300005539 | Bacteria | 3031 |
| 132 | Ga0068853_100627999 | 3300005539 | Bacteria | 1021 |
| 133 | Ga0068853_100661437 | 3300005539 | Bacteria | 995 |
| 134 | Ga0068853_100935982 | 3300005539 | Bacteria | 833 |
| 135 | Ga0068853_101555170 | 3300005539 | Bacteria | 641 |
| 136 | Ga0068853_101860645 | 3300005539 | Bacteria | 584 |
| 137 | Ga0070672_100218129 | 3300005543 | Bacteria | 1599 |
| 138 | Ga0070672_100379391 | 3300005543 | Bacteria | 1209 |
| 139 | Ga0070672_100511937 | 3300005543 | Bacteria | 1039 |
| 140 | Ga0070672_101942610 | 3300005543 | Bacteria | 530 |
| 141 | Ga0070686_100061045 | 3300005544 | Bacteria | 2434 |
| 142 | Ga0070695_100813774 | 3300005545 | Bacteria | 749 |
| 143 | Ga0070665_100000125 | 3300005548 | Bacteria | 146809 |
| 144 | Ga0070704_100517376 | 3300005549 | Bacteria | 1038 |
| 145 | Ga0068855_100068805 | 3300005563 | Bacteria | 4121 |
| 146 | Ga0068855_100102831 | 3300005563 | Bacteria | 3288 |
| 147 | Ga0068855_100127897 | 3300005563 | Bacteria | 2903 |
| 148 | Ga0068855_100354440 | 3300005563 | Bacteria | 1616 |
| 149 | Ga0068855_100443475 | 3300005563 | Bacteria | 1417 |
| 150 | Ga0068855_100527701 | 3300005563 | Bacteria | 1280 |
| 151 | Ga0068855_100820970 | 3300005563 | Bacteria | 987 |
| 152 | Ga0068855_100840388 | 3300005563 | Bacteria | 974 |
| 153 | Ga0068855_100951509 | 3300005563 | Bacteria | 905 |
| 154 | Ga0068855_101322690 | 3300005563 | Bacteria | 745 |
| 155 | Ga0070664_100001016 | 3300005564 | Bacteria | 22026 |
| 156 | Ga0070664_100723412 | 3300005564 | Bacteria | 928 |
| 157 | Ga0070664_100810250 | 3300005564 | Bacteria | 876 |
| 158 | Ga0070664_101233430 | 3300005564 | Bacteria | 706 |
| 159 | Ga0068857_100507361 | 3300005577 | Bacteria | 1132 |
| 160 | Ga0068857_100517758 | 3300005577 | Bacteria | 1121 |
| 161 | Ga0068857_100822873 | 3300005577 | Bacteria | 887 |
| 162 | Ga0068857_102373572 | 3300005577 | Bacteria | 521 |
| 163 | Ga0068854_100028379 | 3300005578 | Bacteria | 3867 |
| 164 | Ga0068854_100343443 | 3300005578 | Bacteria | 1220 |
| 165 | Ga0068854_100502831 | 3300005578 | Bacteria | 1021 |
| 166 | Ga0068856_100187239 | 3300005614 | Bacteria | 2084 |
| 167 | Ga0068856_101713242 | 3300005614 | Bacteria | 641 |
| 168 | Ga0070702_100010581 | 3300005615 | Bacteria | 4551 |
| 169 | Ga0070702_100310442 | 3300005615 | Bacteria | 1095 |
| 170 | Ga0068852_100002994 | 3300005616 | Bacteria | 11740 |
| 171 | Ga0068852_100078108 | 3300005616 | Bacteria | 2928 |
| 172 | Ga0068852_100558452 | 3300005616 | Bacteria | 1146 |
| 173 | Ga0068852_101208348 | 3300005616 | Bacteria | 777 |
| 174 | Ga0068852_101924310 | 3300005616 | Bacteria | 614 |
| 175 | Ga0068852_102428643 | 3300005616 | Bacteria | 545 |
| 176 | Ga0068859_100000128 | 3300005617 | Bacteria | 72119 |
| 177 | Ga0068859_100000768 | 3300005617 | Bacteria | 32376 |
| 178 | Ga0068859_100118149 | 3300005617 | Bacteria | 2717 |
| 179 | Ga0068859_100162120 | 3300005617 | Bacteria | 2315 |
| 180 | Ga0068859_100340743 | 3300005617 | Bacteria | 1593 |
| 181 | Ga0068859_100353678 | 3300005617 | Bacteria | 1564 |
| 182 | Ga0068859_101191439 | 3300005617 | Bacteria | 839 |
| 183 | Ga0068864_100026441 | 3300005618 | Bacteria | 4894 |
| 184 | Ga0068864_100079795 | 3300005618 | Bacteria | 2866 |
| 185 | Ga0068864_100366918 | 3300005618 | Bacteria | 1362 |
| 186 | Ga0068866_10036252 | 3300005718 | Bacteria | 2415 |
| 187 | Ga0068861_100453396 | 3300005719 | Bacteria | 1150 |
| 188 | Ga0068861_100483931 | 3300005719 | Bacteria | 1115 |
| 189 | Ga0068861_100829985 | 3300005719 | Bacteria | 870 |
| 190 | Ga0068861_101316228 | 3300005719 | Bacteria | 703 |
| 191 | Ga0068870_10085772 | 3300005840 | Bacteria | 1751 |
| 192 | Ga0068870_10110453 | 3300005840 | Bacteria | 1569 |
| 193 | Ga0068870_10828419 | 3300005840 | Unclassified | 649 |
| 194 | Ga0068863_100016956 | 3300005841 | Bacteria | 6986 |
| 195 | Ga0068863_100194564 | 3300005841 | Bacteria | 1949 |
| 196 | Ga0068863_100654900 | 3300005841 | Bacteria | 1042 |
| 197 | Ga0068858_100057422 | 3300005842 | Bacteria | 3597 |
| 198 | Ga0068858_100162391 | 3300005842 | Bacteria | 2103 |
| 199 | Ga0068858_100520777 | 3300005842 | Bacteria | 1150 |
| 200 | Ga0068858_100621735 | 3300005842 | Bacteria | 1049 |
| 201 | Ga0068858_101200109 | 3300005842 | Bacteria | 746 |
| 202 | Ga0068858_102029529 | 3300005842 | Bacteria | 569 |
| 203 | Ga0068860_100000059 | 3300005843 | Bacteria | 196400 |
| 204 | Ga0068860_100009276 | 3300005843 | Bacteria | 9780 |
| 205 | Ga0068860_100181649 | 3300005843 | Bacteria | 2033 |
| 206 | Ga0068860_100472368 | 3300005843 | Bacteria | 1249 |
| 207 | Ga0068860_101496403 | 3300005843 | Bacteria | 697 |
| 208 | Ga0068860_102529530 | 3300005843 | Bacteria | 533 |
| 209 | Ga0068862_100009951 | 3300005844 | Bacteria | 7855 |
| 210 | Ga0068862_101404166 | 3300005844 | Unclassified | 701 |
| 211 | Ga0068862_101901888 | 3300005844 | Bacteria | 605 |
| 212 | Ga0068862_102080960 | 3300005844 | Bacteria | 579 |
| 213 | Ga0081539_10144985 | 3300005985 | Bacteria | 1149 |
| 214 | Ga0075366_10233851 | 3300006195 | Bacteria | 1120 |
| 215 | Ga0075366_10382866 | 3300006195 | Bacteria | 865 |
| 216 | Ga0097621_100000714 | 3300006237 | Bacteria | 23301 |
| 217 | Ga0097621_100016633 | 3300006237 | Bacteria | 5565 |
| 218 | Ga0097621_100426646 | 3300006237 | Bacteria | 1191 |
| 219 | Ga0097621_102401101 | 3300006237 | Bacteria | 504 |
| 220 | Ga0068871_100000046 | 3300006358 | Bacteria | 66964 |
| 221 | Ga0068871_100032967 | 3300006358 | Bacteria | 4096 |
| 222 | Ga0068871_100083877 | 3300006358 | Bacteria | 2643 |
| 223 | Ga0068871_100674003 | 3300006358 | Bacteria | 946 |
| 224 | Ga0068871_102233885 | 3300006358 | Unclassified | 521 |
| 225 | Ga0068865_100000041 | 3300006881 | Bacteria | 72569 |
| 226 | Ga0068865_100016853 | 3300006881 | Bacteria | 4686 |
| 227 | Ga0097620_100000128 | 3300006931 | Bacteria | 72119 |
| 228 | Ga0097620_100000768 | 3300006931 | Bacteria | 32376 |
| 229 | Ga0097620_100118146 | 3300006931 | Bacteria | 2717 |
| 230 | Ga0097620_100162125 | 3300006931 | Bacteria | 2315 |
| 231 | Ga0097620_100353680 | 3300006931 | Bacteria | 1564 |
| 232 | Ga0097620_101191459 | 3300006931 | Bacteria | 839 |
| 233 | Ga0105250_10578428 | 3300009092 | Bacteria | 518 |
| 234 | Ga0105240_10000692 | 3300009093 | Bacteria | 61955 |
| 235 | Ga0105240_10091827 | 3300009093 | Bacteria | 3708 |
| 236 | Ga0105240_10142389 | 3300009093 | Bacteria | 2865 |
| 237 | Ga0105240_10151322 | 3300009093 | Bacteria | 2763 |
| 238 | Ga0105240_10228824 | 3300009093 | Bacteria | 2162 |
| 239 | Ga0105240_10275776 | 3300009093 | Bacteria | 1934 |
| 240 | Ga0105240_10377563 | 3300009093 | Bacteria | 1601 |
| 241 | Ga0105240_11192892 | 3300009093 | Bacteria | 806 |
| 242 | Ga0105245_12352170 | 3300009098 | Bacteria | 586 |
| 243 | Ga0105245_12489654 | 3300009098 | Bacteria | 571 |
| 244 | Ga0105247_10012983 | 3300009101 | Bacteria | 4995 |
| 245 | Ga0105243_10833104 | 3300009148 | Bacteria | 912 |
| 246 | Ga0105241_10000217 | 3300009174 | Bacteria | 43160 |
| 247 | Ga0105241_10000853 | 3300009174 | Bacteria | 23134 |
| 248 | Ga0105241_10014129 | 3300009174 | Bacteria | 5850 |
| 249 | Ga0105241_10230152 | 3300009174 | Bacteria | 1562 |
| 250 | Ga0105241_10704680 | 3300009174 | Unclassified | 922 |
| 251 | Ga0105241_11081115 | 3300009174 | Bacteria | 754 |
| 252 | Ga0105242_10012349 | 3300009176 | Bacteria | 6573 |
| 253 | Ga0105242_10860977 | 3300009176 | Unclassified | 903 |
| 254 | Ga0105248_10018721 | 3300009177 | Bacteria | 7656 |
| 255 | Ga0105248_13043361 | 3300009177 | Bacteria | 534 |
| 256 | Ga0105248_13390872 | 3300009177 | Bacteria | 506 |
| 257 | Ga0105237_10001818 | 3300009545 | Bacteria | 27514 |
| 258 | Ga0105237_10005378 | 3300009545 | Bacteria | 14473 |
| 259 | Ga0105237_10022652 | 3300009545 | Bacteria | 6443 |
| 260 | Ga0105237_10064143 | 3300009545 | Bacteria | 3670 |
| 261 | Ga0105237_10100775 | 3300009545 | Bacteria | 2880 |
| 262 | Ga0105237_10100974 | 3300009545 | Bacteria | 2877 |
| 263 | Ga0105237_10174509 | 3300009545 | Bacteria | 2150 |
| 264 | Ga0105237_11804019 | 3300009545 | Bacteria | 619 |
| 265 | Ga0105237_12764956 | 3300009545 | Bacteria | 502 |
| 266 | Ga0105238_10002068 | 3300009551 | Bacteria | 20258 |
| 267 | Ga0105238_10049554 | 3300009551 | Unclassified | 4228 |
| 268 | Ga0105249_10001650 | 3300009553 | Bacteria | 19547 |
| 269 | Ga0105249_10004971 | 3300009553 | Bacteria | 11467 |
| 270 | Ga0105249_10127295 | 3300009553 | Bacteria | 2427 |
| 271 | Ga0105249_10354681 | 3300009553 | Bacteria | 1487 |
| 272 | Ga0105239_10003770 | 3300010375 | Bacteria | 18441 |
| 273 | Ga0105239_10004595 | 3300010375 | Bacteria | 16444 |
| 274 | Ga0105239_10014883 | 3300010375 | Bacteria | 8624 |
| 275 | Ga0105239_10020326 | 3300010375 | Bacteria | 7324 |
| 276 | Ga0105239_10131045 | 3300010375 | Bacteria | 2789 |
| 277 | Ga0105239_10230797 | 3300010375 | Bacteria | 2076 |
| 278 | Ga0105239_10323232 | 3300010375 | Bacteria | 1740 |
| 279 | Ga0105239_10368999 | 3300010375 | Bacteria | 1622 |
| 280 | Ga0105239_10369001 | 3300010375 | Bacteria | 1622 |
| 281 | Ga0105239_10863001 | 3300010375 | Bacteria | 1038 |
| 282 | Ga0105239_10878842 | 3300010375 | Bacteria | 1028 |
| 283 | Ga0105239_12443028 | 3300010375 | Unclassified | 609 |
| 284 | Ga0105246_10030380 | 3300011119 | Bacteria | 3568 |
| 285 | Ga0157318_1010462 | 3300012482 | Bacteria | 687 |
| 286 | Ga0157373_10018201 | 3300013100 | Bacteria | 5116 |
| 287 | Ga0157373_10115049 | 3300013100 | Bacteria | 1891 |
| 288 | Ga0157373_10451993 | 3300013100 | Bacteria | 925 |
| 289 | Ga0157373_10734773 | 3300013100 | Bacteria | 725 |
| 290 | Ga0157371_10001084 | 3300013102 | Bacteria | 29465 |
| 291 | Ga0157371_10005892 | 3300013102 | Bacteria | 10236 |
| 292 | Ga0157371_10117844 | 3300013102 | Bacteria | 1887 |
| 293 | Ga0157371_10200008 | 3300013102 | Bacteria | 1432 |
| 294 | Ga0157371_10226730 | 3300013102 | Bacteria | 1342 |
| 295 | Ga0157371_10655107 | 3300013102 | Bacteria | 784 |
| 296 | Ga0157370_10004729 | 3300013104 | Bacteria | 15520 |
| 297 | Ga0157370_10005230 | 3300013104 | Bacteria | 14608 |
| 298 | Ga0157370_10007942 | 3300013104 | Bacteria | 11492 |
| 299 | Ga0157370_10741662 | 3300013104 | Bacteria | 895 |
| 300 | Ga0157370_10856618 | 3300013104 | Bacteria | 826 |
| 301 | Ga0157370_11746082 | 3300013104 | Bacteria | 558 |
| 302 | Ga0157369_10710310 | 3300013105 | Bacteria | 1035 |
| 303 | Ga0157374_10024480 | 3300013296 | Bacteria | 5414 |
| 304 | Ga0157374_10120999 | 3300013296 | Bacteria | 2526 |
| 305 | Ga0157374_10180122 | 3300013296 | Bacteria | 2064 |
| 306 | Ga0157374_10361113 | 3300013296 | Bacteria | 1444 |
| 307 | Ga0157374_10411884 | 3300013296 | Bacteria | 1349 |
| 308 | Ga0157374_10764166 | 3300013296 | Bacteria | 981 |
| 309 | Ga0157374_11519916 | 3300013296 | Bacteria | 693 |
| 310 | Ga0157378_10002500 | 3300013297 | Bacteria | 16359 |
| 311 | Ga0157378_10010592 | 3300013297 | Bacteria | 8058 |
| 312 | Ga0157378_10039612 | 3300013297 | Bacteria | 4180 |
| 313 | Ga0157378_10100133 | 3300013297 | Bacteria | 2645 |
| 314 | Ga0157378_10192612 | 3300013297 | Bacteria | 1924 |
| 315 | Ga0157378_10271550 | 3300013297 | Bacteria | 1631 |
| 316 | Ga0157378_10438265 | 3300013297 | Bacteria | 1294 |
| 317 | Ga0157378_10522041 | 3300013297 | Bacteria | 1189 |
| 318 | Ga0157378_11064786 | 3300013297 | Bacteria | 845 |
| 319 | Ga0157378_12967902 | 3300013297 | Bacteria | 526 |
| 320 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 321 | Ga0163162_10004176 | 3300013306 | Bacteria | 13879 |
| 322 | Ga0163162_10025120 | 3300013306 | Bacteria | 5888 |
| 323 | Ga0163162_10118800 | 3300013306 | Bacteria | 2746 |
| 324 | Ga0163162_10162723 | 3300013306 | Bacteria | 2354 |
| 325 | Ga0163162_10790887 | 3300013306 | Bacteria | 1066 |
| 326 | Ga0163162_11089836 | 3300013306 | Bacteria | 905 |
| 327 | Ga0163162_12934557 | 3300013306 | Bacteria | 548 |
| 328 | Ga0157372_10067142 | 3300013307 | Bacteria | 4030 |
| 329 | Ga0157372_10147956 | 3300013307 | Bacteria | 2709 |
| 330 | Ga0157372_10279148 | 3300013307 | Bacteria | 1942 |
| 331 | Ga0157372_10357598 | 3300013307 | Bacteria | 1701 |
| 332 | Ga0157372_10946520 | 3300013307 | Bacteria | 998 |
| 333 | Ga0157372_11516755 | 3300013307 | Bacteria | 772 |
| 334 | Ga0157372_11860707 | 3300013307 | Bacteria | 692 |
| 335 | Ga0157375_10056217 | 3300013308 | Bacteria | 3884 |
| 336 | Ga0157375_10076765 | 3300013308 | Bacteria | 3369 |
| 337 | Ga0157375_10136908 | 3300013308 | Bacteria | 2574 |
| 338 | Ga0157375_10190225 | 3300013308 | Bacteria | 2207 |
| 339 | Ga0157375_10327155 | 3300013308 | Bacteria | 1698 |
| 340 | Ga0157375_10639859 | 3300013308 | Bacteria | 1220 |
| 341 | Ga0157375_12856259 | 3300013308 | Bacteria | 577 |
| 342 | Ga0157375_13298652 | 3300013308 | Bacteria | 538 |
| 343 | Ga0163163_10044636 | 3300014325 | Bacteria | 4349 |
| 344 | Ga0163163_10209269 | 3300014325 | Bacteria | 1999 |
| 345 | Ga0163163_10522091 | 3300014325 | Bacteria | 1250 |
| 346 | Ga0163163_10933780 | 3300014325 | Bacteria | 931 |
| 347 | Ga0163163_11027084 | 3300014325 | Bacteria | 888 |
| 348 | Ga0157380_10760117 | 3300014326 | Bacteria | 982 |
| 349 | Ga0157380_12632947 | 3300014326 | Bacteria | 569 |
| 350 | Ga0182008_10000108 | 3300014497 | Bacteria | 63463 |
| 351 | Ga0157377_10002130 | 3300014745 | Bacteria | 8706 |
| 352 | Ga0157377_10013404 | 3300014745 | Bacteria | 4148 |
| 353 | Ga0157377_10107275 | 3300014745 | Bacteria | 1674 |
| 354 | Ga0157377_10456364 | 3300014745 | Bacteria | 883 |
| 355 | Ga0157379_10927927 | 3300014968 | Bacteria | 827 |
| 356 | Ga0157379_12485608 | 3300014968 | Bacteria | 518 |
| 357 | Ga0157376_10328573 | 3300014969 | Bacteria | 1456 |
| 358 | Ga0157376_10386112 | 3300014969 | Bacteria | 1350 |
| 359 | Ga0157376_11477504 | 3300014969 | Bacteria | 712 |
| 360 | Ga0157376_12559847 | 3300014969 | Bacteria | 550 |
| 361 | Ga0182006_1000109 | 3300015261 | Bacteria | 89541 |
| 362 | Ga0182007_10037805 | 3300015262 | Bacteria | 1620 |
| 363 | Ga0163161_10001003 | 3300017792 | Bacteria | 21495 |
| 364 | Ga0163161_10036486 | 3300017792 | Bacteria | 3520 |
| 365 | Ga0163161_10168620 | 3300017792 | Bacteria | 1673 |
| 366 | Ga0163161_10203301 | 3300017792 | Bacteria | 1527 |
| 367 | Ga0163161_10463349 | 3300017792 | Bacteria | 1026 |
| 368 | Ga0163161_12065873 | 3300017792 | Bacteria | 507 |
| 369 | Ga0213872_10029500 | 3300021361 | Bacteria | 2515 |
| 370 | Ga0213876_10000722 | 3300021384 | Bacteria | 23019 |
| 371 | Ga0209437_100528 | 3300025233 | Bacteria | 26547 |
| 372 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 373 | Ga0209646_1016800 | 3300025246 | Bacteria | 1083 |
| 374 | Ga0209026_1000890 | 3300025250 | Bacteria | 15461 |
| 375 | Ga0209148_1000163 | 3300025254 | Bacteria | 137449 |
| 376 | Ga0209129_1009318 | 3300025258 | Bacteria | 2605 |
| 377 | Ga0209455_1003239 | 3300025272 | Bacteria | 5870 |
| 378 | Ga0209673_1000016 | 3300025273 | Bacteria | 506202 |
| 379 | Ga0209564_1005465 | 3300025295 | Bacteria | 7244 |
| 380 | Ga0209758_1006613 | 3300025297 | Bacteria | 8214 |
| 381 | Ga0209050_1000124 | 3300025298 | Bacteria | 194022 |
| 382 | Ga0207426_1000157 | 3300025302 | Bacteria | 178442 |
| 383 | Ga0207426_1000925 | 3300025302 | Bacteria | 29342 |
| 384 | Ga0209051_1023842 | 3300025303 | Bacteria | 2534 |
| 385 | Ga0209257_1001535 | 3300025304 | Bacteria | 26927 |
| 386 | Ga0207697_10354971 | 3300025315 | Bacteria | 651 |
| 387 | Ga0207682_10349708 | 3300025893 | Unclassified | 696 |
| 388 | Ga0207682_10399046 | 3300025893 | Bacteria | 650 |
| 389 | Ga0207642_10019317 | 3300025899 | Bacteria | 2637 |
| 390 | Ga0207642_10289659 | 3300025899 | Bacteria | 945 |
| 391 | Ga0207710_10043471 | 3300025900 | Bacteria | 1998 |
| 392 | Ga0207688_10005502 | 3300025901 | Bacteria | 6888 |
| 393 | Ga0207688_10747440 | 3300025901 | Bacteria | 619 |
| 394 | Ga0207680_10000448 | 3300025903 | Bacteria | 19470 |
| 395 | Ga0207647_10000117 | 3300025904 | Bacteria | 61849 |
| 396 | Ga0207647_10045721 | 3300025904 | Bacteria | 2730 |
| 397 | Ga0207647_10086213 | 3300025904 | Archaea | 1877 |
| 398 | Ga0207647_10158900 | 3300025904 | Bacteria | 1319 |
| 399 | Ga0207685_10314334 | 3300025905 | Bacteria | 779 |
| 400 | Ga0207645_10009683 | 3300025907 | Bacteria | 6656 |
| 401 | Ga0207645_10013933 | 3300025907 | Bacteria | 5392 |
| 402 | Ga0207645_10088067 | 3300025907 | Bacteria | 1995 |
| 403 | Ga0207643_10045067 | 3300025908 | Bacteria | 2490 |
| 404 | Ga0207643_10138292 | 3300025908 | Bacteria | 1453 |
| 405 | Ga0207705_10000623 | 3300025909 | Bacteria | 29594 |
| 406 | Ga0207705_10078920 | 3300025909 | Bacteria | 2397 |
| 407 | Ga0207705_10085635 | 3300025909 | Bacteria | 2302 |
| 408 | Ga0207705_10179389 | 3300025909 | Bacteria | 1598 |
| 409 | Ga0207705_11286318 | 3300025909 | Bacteria | 559 |
| 410 | Ga0207654_10000524 | 3300025911 | Bacteria | 21970 |
| 411 | Ga0207654_10008858 | 3300025911 | Bacteria | 5104 |
| 412 | Ga0207654_10011575 | 3300025911 | Bacteria | 4502 |
| 413 | Ga0207707_10343059 | 3300025912 | Bacteria | 1288 |
| 414 | Ga0207707_11427569 | 3300025912 | Bacteria | 551 |
| 415 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 416 | Ga0207695_10008260 | 3300025913 | Bacteria | 13066 |
| 417 | Ga0207695_10048139 | 3300025913 | Bacteria | 4505 |
| 418 | Ga0207695_10068845 | 3300025913 | Bacteria | 3625 |
| 419 | Ga0207695_10895876 | 3300025913 | Bacteria | 767 |
| 420 | Ga0207671_10002893 | 3300025914 | Bacteria | 17762 |
| 421 | Ga0207671_10005501 | 3300025914 | Bacteria | 11657 |
| 422 | Ga0207671_10008195 | 3300025914 | Bacteria | 8906 |
| 423 | Ga0207671_10022597 | 3300025914 | Bacteria | 4752 |
| 424 | Ga0207671_10027556 | 3300025914 | Bacteria | 4248 |
| 425 | Ga0207671_10119370 | 3300025914 | Bacteria | 2014 |
| 426 | Ga0207671_10132417 | 3300025914 | Bacteria | 1915 |
| 427 | Ga0207671_10244524 | 3300025914 | Bacteria | 1410 |
| 428 | Ga0207671_11239614 | 3300025914 | Bacteria | 582 |
| 429 | Ga0207663_10540253 | 3300025916 | Bacteria | 910 |
| 430 | Ga0207660_10035604 | 3300025917 | Bacteria | 3457 |
| 431 | Ga0207660_10367560 | 3300025917 | Bacteria | 1155 |
| 432 | Ga0207662_10035006 | 3300025918 | Bacteria | 2932 |
| 433 | Ga0207662_10041489 | 3300025918 | Bacteria | 2709 |
| 434 | Ga0207657_10012327 | 3300025919 | Bacteria | 8448 |
| 435 | Ga0207657_10268913 | 3300025919 | Bacteria | 1355 |
| 436 | Ga0207657_10535440 | 3300025919 | Bacteria | 916 |
| 437 | Ga0207657_10800976 | 3300025919 | Bacteria | 728 |
| 438 | Ga0207657_10912900 | 3300025919 | Bacteria | 676 |
| 439 | Ga0207652_11877545 | 3300025921 | Bacteria | 504 |
| 440 | Ga0207646_10120519 | 3300025922 | Bacteria | 2357 |
| 441 | Ga0207646_11096909 | 3300025922 | Bacteria | 701 |
| 442 | Ga0207681_10367529 | 3300025923 | Bacteria | 1155 |
| 443 | Ga0207681_10585725 | 3300025923 | Bacteria | 921 |
| 444 | Ga0207681_11587396 | 3300025923 | Bacteria | 548 |
| 445 | Ga0207694_10035339 | 3300025924 | Bacteria | 3833 |
| 446 | Ga0207694_10072542 | 3300025924 | Bacteria | 2692 |
| 447 | Ga0207659_10239400 | 3300025926 | Bacteria | 1467 |
| 448 | Ga0207659_10534496 | 3300025926 | Bacteria | 995 |
| 449 | Ga0207687_11720539 | 3300025927 | Bacteria | 537 |
| 450 | Ga0207664_10954863 | 3300025929 | Bacteria | 769 |
| 451 | Ga0207644_10072589 | 3300025931 | Bacteria | 2521 |
| 452 | Ga0207644_10186173 | 3300025931 | Bacteria | 1630 |
| 453 | Ga0207644_10600633 | 3300025931 | Bacteria | 914 |
| 454 | Ga0207690_10220436 | 3300025932 | Bacteria | 1451 |
| 455 | Ga0207690_10320013 | 3300025932 | Bacteria | 1219 |
| 456 | Ga0207690_10401022 | 3300025932 | Bacteria | 1094 |
| 457 | Ga0207690_10619021 | 3300025932 | Bacteria | 885 |
| 458 | Ga0207706_10000044 | 3300025933 | Bacteria | 123576 |
| 459 | Ga0207706_10020437 | 3300025933 | Bacteria | 5953 |
| 460 | Ga0207686_10082882 | 3300025934 | Bacteria | 2098 |
| 461 | Ga0207686_10309192 | 3300025934 | Bacteria | 1176 |
| 462 | Ga0207709_10205784 | 3300025935 | Bacteria | 1409 |
| 463 | Ga0207670_11886993 | 3300025936 | Bacteria | 508 |
| 464 | Ga0207669_10354074 | 3300025937 | Unclassified | 1135 |
| 465 | Ga0207669_11404192 | 3300025937 | Bacteria | 594 |
| 466 | Ga0207704_10000061 | 3300025938 | Bacteria | 76480 |
| 467 | Ga0207704_10359608 | 3300025938 | Bacteria | 1136 |
| 468 | Ga0207665_10693511 | 3300025939 | Bacteria | 800 |
| 469 | Ga0207691_10007611 | 3300025940 | Bacteria | 10425 |
| 470 | Ga0207691_10009816 | 3300025940 | Bacteria | 9191 |
| 471 | Ga0207691_10195375 | 3300025940 | Bacteria | 1763 |
| 472 | Ga0207691_10240574 | 3300025940 | Bacteria | 1565 |
| 473 | Ga0207711_10058541 | 3300025941 | Plasmid | 3316 |
| 474 | Ga0207711_11112052 | 3300025941 | Bacteria | 731 |
| 475 | Ga0207711_11791947 | 3300025941 | Unclassified | 557 |
| 476 | Ga0207689_10064946 | 3300025942 | Bacteria | 3002 |
| 477 | Ga0207689_10095465 | 3300025942 | Bacteria | 2442 |
| 478 | Ga0207689_10164130 | 3300025942 | Bacteria | 1830 |
| 479 | Ga0207689_10350892 | 3300025942 | Bacteria | 1226 |
| 480 | Ga0207689_10356690 | 3300025942 | Bacteria | 1216 |
| 481 | Ga0207661_10656543 | 3300025944 | Bacteria | 964 |
| 482 | Ga0207679_10267921 | 3300025945 | Bacteria | 1459 |
| 483 | Ga0207679_10670249 | 3300025945 | Bacteria | 939 |
| 484 | Ga0207679_11258831 | 3300025945 | Bacteria | 679 |
| 485 | Ga0207667_10081641 | 3300025949 | Bacteria | 3349 |
| 486 | Ga0207667_10129790 | 3300025949 | Bacteria | 2596 |
| 487 | Ga0207667_10187634 | 3300025949 | Bacteria | 2122 |
| 488 | Ga0207667_10798120 | 3300025949 | Bacteria | 941 |
| 489 | Ga0207667_11339039 | 3300025949 | Bacteria | 691 |
| 490 | Ga0207651_10004446 | 3300025960 | Bacteria | 7068 |
| 491 | Ga0207651_10689755 | 3300025960 | Bacteria | 899 |
| 492 | Ga0207712_10065033 | 3300025961 | Bacteria | 2602 |
| 493 | Ga0207712_10114889 | 3300025961 | Bacteria | 2025 |
| 494 | Ga0207712_10170480 | 3300025961 | Bacteria | 1701 |
| 495 | Ga0207712_10196649 | 3300025961 | Bacteria | 1595 |
| 496 | Ga0207712_10449328 | 3300025961 | Bacteria | 1093 |
| 497 | Ga0207712_12000853 | 3300025961 | Bacteria | 519 |
| 498 | Ga0207668_11703580 | 3300025972 | Bacteria | 569 |
| 499 | Ga0207668_11836933 | 3300025972 | Bacteria | 547 |
| 500 | Ga0207668_11994339 | 3300025972 | Bacteria | 523 |
| 501 | Ga0207640_10072546 | 3300025981 | Bacteria | 2323 |
| 502 | Ga0207640_10628518 | 3300025981 | Bacteria | 912 |
| 503 | Ga0207658_10067979 | 3300025986 | Bacteria | 2686 |
| 504 | Ga0207658_10137113 | 3300025986 | Bacteria | 1975 |
| 505 | Ga0207658_10154262 | 3300025986 | Bacteria | 1875 |
| 506 | Ga0207658_10303417 | 3300025986 | Bacteria | 1376 |
| 507 | Ga0207658_10390442 | 3300025986 | Bacteria | 1221 |
| 508 | Ga0207658_11345465 | 3300025986 | Bacteria | 653 |
| 509 | Ga0207658_11621991 | 3300025986 | Bacteria | 591 |
| 510 | Ga0207658_11873631 | 3300025986 | Bacteria | 547 |
| 511 | Ga0207677_10037202 | 3300026023 | Bacteria | 3179 |
| 512 | Ga0207677_10057504 | 3300026023 | Bacteria | 2671 |
| 513 | Ga0207677_10077911 | 3300026023 | Bacteria | 2365 |
| 514 | Ga0207677_10553218 | 3300026023 | Bacteria | 1003 |
| 515 | Ga0207677_11779838 | 3300026023 | Bacteria | 572 |
| 516 | Ga0207703_10006254 | 3300026035 | Bacteria | 9523 |
| 517 | Ga0207703_10331355 | 3300026035 | Bacteria | 1396 |
| 518 | Ga0207703_10484819 | 3300026035 | Bacteria | 1159 |
| 519 | Ga0207703_10786046 | 3300026035 | Bacteria | 908 |
| 520 | Ga0207703_10926305 | 3300026035 | Bacteria | 835 |
| 521 | Ga0207703_11666769 | 3300026035 | Bacteria | 613 |
| 522 | Ga0207703_11719022 | 3300026035 | Bacteria | 603 |
| 523 | Ga0207703_11837569 | 3300026035 | Bacteria | 582 |
| 524 | Ga0207703_12207335 | 3300026035 | Bacteria | 526 |
| 525 | Ga0207639_10010963 | 3300026041 | Bacteria | 6282 |
| 526 | Ga0207639_10012012 | 3300026041 | Bacteria | 6025 |
| 527 | Ga0207639_10115885 | 3300026041 | Bacteria | 2192 |
| 528 | Ga0207639_10130457 | 3300026041 | Bacteria | 2080 |
| 529 | Ga0207639_10166030 | 3300026041 | Bacteria | 1865 |
| 530 | Ga0207639_10329602 | 3300026041 | Bacteria | 1358 |
| 531 | Ga0207639_10331843 | 3300026041 | Bacteria | 1354 |
| 532 | Ga0207678_10201899 | 3300026067 | Unclassified | 1700 |
| 533 | Ga0207678_11809054 | 3300026067 | Bacteria | 535 |
| 534 | Ga0207708_10017604 | 3300026075 | Bacteria | 5380 |
| 535 | Ga0207708_10079070 | 3300026075 | Bacteria | 2526 |
| 536 | Ga0207708_11173679 | 3300026075 | Bacteria | 671 |
| 537 | Ga0207708_11552873 | 3300026075 | Bacteria | 582 |
| 538 | Ga0207708_11909248 | 3300026075 | Bacteria | 520 |
| 539 | Ga0207702_11095342 | 3300026078 | Bacteria | 790 |
| 540 | Ga0207702_12052422 | 3300026078 | Bacteria | 562 |
| 541 | Ga0207641_10005736 | 3300026088 | Bacteria | 10545 |
| 542 | Ga0207641_10233935 | 3300026088 | Bacteria | 1709 |
| 543 | Ga0207641_10541959 | 3300026088 | Bacteria | 1134 |
| 544 | Ga0207641_12612183 | 3300026088 | Bacteria | 503 |
| 545 | Ga0207648_10002338 | 3300026089 | Bacteria | 20455 |
| 546 | Ga0207648_10052614 | 3300026089 | Bacteria | 3561 |
| 547 | Ga0207648_10286460 | 3300026089 | Bacteria | 1474 |
| 548 | Ga0207648_11950885 | 3300026089 | Bacteria | 548 |
| 549 | Ga0207676_10004483 | 3300026095 | Bacteria | 9870 |
| 550 | Ga0207676_10352943 | 3300026095 | Bacteria | 1360 |
| 551 | Ga0207676_11291134 | 3300026095 | Bacteria | 725 |
| 552 | Ga0207674_10023607 | 3300026116 | Bacteria | 6584 |
| 553 | Ga0207674_10156717 | 3300026116 | Bacteria | 2232 |
| 554 | Ga0207674_10353023 | 3300026116 | Bacteria | 1422 |
| 555 | Ga0207674_10497460 | 3300026116 | Bacteria | 1178 |
| 556 | Ga0207674_11042722 | 3300026116 | Bacteria | 787 |
| 557 | Ga0207675_100339515 | 3300026118 | Bacteria | 1470 |
| 558 | Ga0207675_100937586 | 3300026118 | Bacteria | 883 |
| 559 | Ga0207675_101417037 | 3300026118 | Bacteria | 715 |
| 560 | Ga0207675_101789605 | 3300026118 | Bacteria | 634 |
| 561 | Ga0207683_10031283 | 3300026121 | Bacteria | 4619 |
| 562 | Ga0207683_10215435 | 3300026121 | Bacteria | 1749 |
| 563 | Ga0207683_10240671 | 3300026121 | Bacteria | 1651 |
| 564 | Ga0207683_10613569 | 3300026121 | Bacteria | 1007 |
| 565 | Ga0207698_10121920 | 3300026142 | Bacteria | 2208 |
| 566 | Ga0207698_10728534 | 3300026142 | Bacteria | 989 |
| 567 | Ga0207698_10820847 | 3300026142 | Bacteria | 933 |
| 568 | Ga0207698_10834298 | 3300026142 | Bacteria | 926 |
| 569 | Ga0207698_10910885 | 3300026142 | Bacteria | 887 |
| 570 | Ga0207698_12099353 | 3300026142 | Bacteria | 579 |
| 571 | Ga0268266_10000132 | 3300028379 | Bacteria | 145563 |
| 572 | Ga0268266_10637558 | 3300028379 | Bacteria | 1025 |
| 573 | Ga0268265_10013493 | 3300028380 | Bacteria | 5553 |
| 574 | Ga0268265_10286163 | 3300028380 | Bacteria | 1477 |
| 575 | Ga0268265_11442638 | 3300028380 | Bacteria | 691 |
| 576 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 577 | Ga0268264_10383701 | 3300028381 | Bacteria | 1346 |
| 578 | Ga0268264_10601952 | 3300028381 | Bacteria | 1083 |
| 579 | Ga0268264_10945203 | 3300028381 | Bacteria | 867 |
| 580 | Ga0268264_11342442 | 3300028381 | Bacteria | 725 |
| 581 | Ga0265334_10159572 | 3300028573 | Bacteria | 793 |
| 582 | Ga0265323_10000512 | 3300028653 | Bacteria | 21698 |
| 583 | Ga0307517_10007381 | 3300028786 | Bacteria | 16035 |
| 584 | Ga0307515_10000061 | 3300028794 | Bacteria | 251841 |
| 585 | Ga0307515_10064321 | 3300028794 | Bacteria | 5130 |
| 586 | Ga0307515_10629754 | 3300028794 | Bacteria | 684 |
| 587 | Ga0265338_10084234 | 3300028800 | Bacteria | 2655 |
| 588 | Ga0265338_10517135 | 3300028800 | Unclassified | 839 |
| 589 | Ga0316181_1087376 | 3300030744 | Bacteria | 1152 |
| 590 | Ga0265330_10104767 | 3300031235 | Bacteria | 1210 |
| 591 | Ga0265327_10000055 | 3300031251 | Bacteria | 247188 |
| 592 | Ga0265327_10064368 | 3300031251 | Bacteria | 1858 |
| 593 | Ga0265327_10070414 | 3300031251 | Bacteria | 1753 |
| 594 | Ga0265316_10001184 | 3300031344 | Bacteria | 28228 |
| 595 | Ga0307509_10178754 | 3300031507 | Bacteria | 1991 |
| 596 | Ga0307509_10228133 | 3300031507 | Bacteria | 1668 |
| 597 | Ga0307509_10420174 | 3300031507 | Bacteria | 1038 |
| 598 | Ga0307509_10492518 | 3300031507 | Bacteria | 912 |
| 599 | Ga0307514_10433042 | 3300031649 | Bacteria | 655 |
| 600 | Ga0265314_10046768 | 3300031711 | Bacteria | 3051 |
| 601 | Ga0307410_11479517 | 3300031852 | Bacteria | 598 |
| 602 | Ga0307406_10038111 | 3300031901 | Bacteria | 2974 |
| 603 | Ga0307406_10611011 | 3300031901 | Bacteria | 900 |
| 604 | Ga0307412_11208901 | 3300031911 | Bacteria | 677 |
| 605 | Ga0307412_12098833 | 3300031911 | Bacteria | 525 |
| 606 | Ga0307409_101429972 | 3300031995 | Bacteria | 718 |
| 607 | Ga0307416_100224981 | 3300032002 | Bacteria | 1803 |
| 608 | Ga0307416_101593428 | 3300032002 | Bacteria | 758 |
| 609 | Ga0307414_10084723 | 3300032004 | Bacteria | 2332 |
| 610 | Ga0307414_10286507 | 3300032004 | Bacteria | 1387 |
| 611 | Ga0307411_11966865 | 3300032005 | Bacteria | 545 |
| 612 | Ga0307510_10013796 | 3300033180 | Bacteria | 9579 |
| 613 | Ga0373936_0230431 | 3300035113 | Bacteria | 824 |
| 614 | Ga0373939_0215478 | 3300035114 | Bacteria | 733 |
| 615 | Ga0373941_0232872 | 3300035115 | Bacteria | 712 |
| 616 | Ga0373942_0025117 | 3300035207 | Bacteria | 1533 |
| 617 | Ga0395899_0000021 | 3300037312 | Bacteria | 391702 |
| 618 | Ga0395899_0009228 | 3300037312 | Bacteria | 7576 |
| 619 | Ga0395899_0026616 | 3300037312 | Bacteria | 4364 |
| 620 | Ga0395899_0115190 | 3300037312 | Bacteria | 1929 |
| 621 | Ga0395900_0000494 | 3300037418 | Bacteria | 55588 |
| 622 | Ga0395900_0003517 | 3300037418 | Bacteria | 16914 |
| 623 | Ga0395900_0004982 | 3300037418 | Bacteria | 13961 |
| 624 | Ga0395900_0279390 | 3300037418 | Bacteria | 1662 |
| 625 | Ga0395898_0004102 | 3300037466 | Bacteria | 15974 |
| 626 | Ga0395898_0080656 | 3300037466 | Bacteria | 3138 |
| 627 | Ga0395905_0000757 | 3300037471 | Bacteria | 42574 |
| 628 | Ga0395905_0004960 | 3300037471 | Bacteria | 13717 |
| 629 | Ga0395905_0017163 | 3300037471 | Bacteria | 6876 |
| 630 | Ga0395905_0030285 | 3300037471 | Bacteria | 5100 |
| 631 | Ga0395905_0485689 | 3300037471 | Bacteria | 1135 |
| 632 | Ga0395901_0002107 | 3300038443 | Bacteria | 20401 |
| 633 | Ga0395901_0003012 | 3300038443 | Bacteria | 16991 |
| 634 | Ga0395901_0021304 | 3300038443 | Bacteria | 6639 |
| 635 | Ga0395901_0054362 | 3300038443 | Bacteria | 4161 |
| 636 | Ga0436365_1664331 | 3300039437 | Bacteria | 31697 |
| 637 | Ga0436361_0635236 | 3300039447 | Bacteria | 6435 |
| 638 | Ga0439439_0214470 | 3300041406 | Bacteria | 563 |
| 639 | Ga0439466_0139579 | 3300041411 | Bacteria | 744 |
| 640 | Ga0451793_0462005 | 3300041452 | Bacteria | 611 |
| 641 | Ga0451802_1188741 | 3300041460 | Bacteria | 575 |
| 642 | Ga0451804_0543671 | 3300041463 | Bacteria | 605 |
| 643 | Ga0451807_1973634 | 3300041486 | Bacteria | 555 |
| 644 | Ga0451833_0971787 | 3300041491 | Bacteria | 683 |
| 645 | Ga0451837_0256521 | 3300041494 | Bacteria | 523 |
| 646 | Ga0451841_1049833 | 3300041498 | Bacteria | 505 |
| 647 | Ga0451845_0572086 | 3300041501 | Bacteria | 569 |
| 648 | Ga0451851_0947342 | 3300041507 | Bacteria | 671 |
| 649 | Ga0451851_1259567 | 3300041507 | Bacteria | 618 |
| 650 | Ga0451853_0174956 | 3300041512 | Bacteria | 1073 |
| 651 | Ga0439442_026011 | 3300042002 | Bacteria | 1218 |
| 652 | Ga0439432_128270 | 3300042006 | Bacteria | 749 |
| 653 | Ga0439449_0126557 | 3300042007 | Bacteria | 949 |
| 654 | Ga0439457_044691 | 3300042014 | Bacteria | 989 |
| 655 | Ga0450897_050347 | 3300042128 | Bacteria | 502 |
| 656 | Ga0450898_005402 | 3300042134 | Bacteria | 1930 |
| 657 | Ga0450899_009235 | 3300042135 | Bacteria | 1085 |
| 658 | Ga0451577_0023194 | 3300042876 | Bacteria | 5662 |
| 659 | Ga0451577_0027814 | 3300042876 | Bacteria | 5118 |
| 660 | Ga0451577_0202605 | 3300042876 | Bacteria | 1791 |
| 661 | Ga0466972_0301302 | 3300044658 | Bacteria | 749 |
| 662 | Ga0466972_0554611 | 3300044658 | Bacteria | 542 |
| 663 | Ga0453684_0002051 | 3300044712 | Bacteria | 51267 |
| 664 | Ga0453684_0055025 | 3300044712 | Bacteria | 5176 |
| 665 | Ga0453684_0517563 | 3300044712 | Bacteria | 1319 |
| 666 | Ga0466970_0128696 | 3300044765 | Bacteria | 1390 |
| 667 | Ga0466959_0018495 | 3300045049 | Bacteria | 5117 |
| 668 | Ga0466959_0077269 | 3300045049 | Bacteria | 2403 |
| 669 | Ga0466959_0288998 | 3300045049 | Bacteria | 1124 |
| 670 | Ga0451576_0015476 | 3300045051 | Bacteria | 8449 |
| 671 | Ga0451576_0189687 | 3300045051 | Bacteria | 2147 |
| 672 | Ga0451576_1787248 | 3300045051 | Bacteria | 636 |
| 673 | Ga0451576_2609771 | 3300045051 | Bacteria | 515 |
| 674 | Ga0466958_0386462 | 3300045836 | Bacteria | 903 |
| 675 | Ga0495638_0000008 | 3300046460 | Bacteria | 565643 |
| 676 | Ga0495638_0414301 | 3300046460 | Bacteria | 696 |
| 677 | Ga0495651_0468027 | 3300046462 | Bacteria | 812 |
| 678 | Ga0495650_0019537 | 3300046471 | Bacteria | 3330 |
| 679 | Ga0495606_0058371 | 3300046507 | Bacteria | 2480 |
| 680 | Ga0495606_0482368 | 3300046507 | Bacteria | 629 |
| 681 | Ga0495618_0850045 | 3300046514 | Bacteria | 529 |
| 682 | Ga0495644_0096453 | 3300046523 | Bacteria | 1117 |
| 683 | Ga0495652_0901129 | 3300046529 | Bacteria | 583 |
| 684 | Ga0495622_0211461 | 3300046557 | Bacteria | 862 |
| 685 | Ga0495668_0001373 | 3300046616 | Bacteria | 23852 |
| 686 | Ga0495634_0502991 | 3300046642 | Bacteria | 710 |
| 687 | Ga0495611_0120339 | 3300046648 | Bacteria | 1224 |
| 688 | Ga0495625_0118844 | 3300046660 | Bacteria | 1801 |
| 689 | Ga0495661_0612527 | 3300046665 | Bacteria | 511 |
| 690 | Ga0495658_0945769 | 3300046683 | Bacteria | 551 |
| 691 | Ga0495581_0903691 | 3300047315 | Bacteria | 504 |
| 692 | Ga0495674_1254327 | 3300047319 | Bacteria | 558 |
| 693 | Ga0495672_0008239 | 3300047320 | Bacteria | 7726 |
| 694 | Ga0495685_090765 | 3300047447 | Bacteria | 1013 |
| 695 | Ga0495686_0001370 | 3300047472 | Bacteria | 27175 |
| 696 | Ga0496108_0707060 | 3300048911 | Bacteria | 874 |
| 697 | Ga0496115_0926906 | 3300048918 | Bacteria | 670 |
| 698 | Ga0496122_0006972 | 3300048925 | Bacteria | 12720 |
| 699 | Ga0496123_0028687 | 3300048926 | Bacteria | 4113 |
| 700 | Ga0496125_0028469 | 3300048928 | Bacteria | 5046 |
| 701 | Ga0501034_0138376 | 3300049571 | Bacteria | 2415 |
| 702 | Ga0501038_0090718 | 3300049574 | Bacteria | 2561 |
| 703 | Ga0501039_0375002 | 3300049575 | Bacteria | 1118 |
| 704 | Ga0501043_0311516 | 3300049579 | Bacteria | 1201 |
| 705 | Ga0501073_0820270 | 3300049589 | Bacteria | 641 |
| 706 | Ga0501198_105283 | 3300049649 | Bacteria | 577 |
| 707 | Ga0501214_042452 | 3300049659 | Bacteria | 666 |
| 708 | Ga0501217_164696 | 3300049661 | Bacteria | 671 |
| 709 | Ga0501223_028400 | 3300049663 | Bacteria | 1089 |
| 710 | Ga0501224_042369 | 3300049664 | Bacteria | 689 |
| 711 | Ga0501233_148642 | 3300049668 | Bacteria | 652 |
| 712 | Ga0501238_033146 | 3300049671 | Bacteria | 750 |
| 713 | Ga0501250_060581 | 3300049680 | Bacteria | 603 |
| 714 | Ga0501257_022697 | 3300049686 | Bacteria | 1486 |
| 715 | Ga0501221_128947 | 3300049704 | Bacteria | 653 |
| 716 | Ga0501234_052612 | 3300049707 | Bacteria | 680 |
| 717 | Ga0501044_0205041 | 3300049823 | Bacteria | 1929 |
| 718 | nmdc:mga0k408_116299_c1 | 3300050493 | Bacteria | 1582 |
| 719 | nmdc:mga07m45_168367_c1 | 3300050496 | Bacteria | 1273 |
| 720 | nmdc:mga08y16_945191_c1 | 3300050511 | Bacteria | 845 |
| 721 | nmdc:mga08y16_97154_c1 | 3300050511 | Bacteria | 3067 |
| 722 | Ga0500635_0000568 | 3300053080 | Bacteria | 9856 |
| 723 | Ga0500578_0000024 | 3300053086 | Bacteria | 151503 |
| 724 | Ga0500578_0295929 | 3300053086 | Bacteria | 961 |
| 725 | Ga0500644_0000169 | 3300053088 | Bacteria | 41659 |
| 726 | Ga0500644_0084978 | 3300053088 | Bacteria | 1172 |
| 727 | Ga0500581_213282 | 3300053089 | Bacteria | 845 |
| 728 | Ga0500581_237668 | 3300053089 | Bacteria | 776 |
| 729 | Ga0500647_0179297 | 3300053091 | Bacteria | 973 |
| 730 | Ga0500583_0506470 | 3300053092 | Bacteria | 566 |
| 731 | Ga0500650_0176658 | 3300053098 | Bacteria | 980 |
| 732 | Ga0500562_000078 | 3300053108 | Bacteria | 44915 |
| 733 | Ga0500592_068298 | 3300053116 | Bacteria | 585 |
| 734 | Ga0500607_025589 | 3300053121 | Bacteria | 3283 |
| 735 | Ga0500608_095814 | 3300053122 | Bacteria | 1381 |
| 736 | Ga0500618_000004 | 3300053125 | Bacteria | 293180 |
| 737 | Ga0500642_0146371 | 3300053130 | Bacteria | 1109 |
| 738 | Ga0500568_0028977 | 3300053139 | Bacteria | 2303 |
| 739 | Ga0500568_0240949 | 3300053139 | Bacteria | 659 |
| 740 | Ga0500577_0046752 | 3300053142 | Bacteria | 1605 |
| 741 | Ga0500590_092581 | 3300053148 | Bacteria | 1465 |
| 742 | Ga0500616_0000003 | 3300053153 | Bacteria | 1220687 |
| 743 | Ga0500616_0004260 | 3300053153 | Bacteria | 10285 |
| 744 | Ga0500616_0012071 | 3300053153 | Bacteria | 5070 |
| 745 | Ga0500616_0102737 | 3300053153 | Bacteria | 1394 |
| 746 | Ga0500616_0146391 | 3300053153 | Bacteria | 1098 |
| 747 | Ga0500616_0219205 | 3300053153 | Bacteria | 831 |
| 748 | Ga0500622_0000870 | 3300053156 | Bacteria | 25713 |
| 749 | Ga0500622_0001076 | 3300053156 | Bacteria | 22701 |
| 750 | Ga0500622_0243796 | 3300053156 | Bacteria | 792 |
| 751 | Ga0500633_0003460 | 3300053160 | Bacteria | 3451 |
| 752 | Ga0500634_0050744 | 3300053161 | Bacteria | 2234 |
| 753 | Ga0500645_020997 | 3300053730 | Bacteria | 2017 |
| 754 | Ga0500645_143683 | 3300053730 | Bacteria | 659 |
| 755 | Ga0500552_034013 | 3300053733 | Bacteria | 800 |
| 756 | Ga0466962_0058515 | 3300061719 | Unclassified | 1839 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005335 | Ga0070666_10581194 | Ga0070666_105811942 | 85 |
| 2 | 3300005331 | Ga0070670_100070797 | Ga0070670_1000707972 | 102 |
| 3 | iso_pu_bacteria | 2898713307 | 2898715615 | 102 |
| 4 | iso_pu_bacteria | 2910245624 | 2910249359 | 102 |
| 5 | 3300003320 | rootH2_10009258 | rootH2_1000925810 | 103 |
| 6 | 3300005438 | Ga0070701_10194353 | Ga0070701_101943532 | 103 |
| 7 | iso_pu_bacteria | 2919437846 | 2919438741 | 103 |
| 8 | 3300003320 | rootH2_10148392 | rootH2_101483925 | 104 |
| 9 | 3300005289 | Ga0065704_10409115 | Ga0065704_104091152 | 104 |
| 10 | 3300005290 | Ga0065712_10101133 | Ga0065712_101011331 | 104 |
| 11 | 3300005295 | Ga0065707_10023401 | Ga0065707_100234012 | 104 |
| 12 | 3300005334 | Ga0068869_100312382 | Ga0068869_1003123822 | 104 |
| 13 | 3300005338 | Ga0068868_101268854 | Ga0068868_1012688542 | 104 |
| 14 | 3300005353 | Ga0070669_100029435 | Ga0070669_1000294355 | 104 |
| 15 | 3300005354 | Ga0070675_100969052 | Ga0070675_1009690522 | 104 |
| 16 | 3300005355 | Ga0070671_101423470 | Ga0070671_1014234701 | 104 |
| 17 | 3300005367 | Ga0070667_100674097 | Ga0070667_1006740972 | 104 |
| 18 | 3300005367 | Ga0070667_101093882 | Ga0070667_1010938822 | 104 |
| 19 | 3300005438 | Ga0070701_10164206 | Ga0070701_101642062 | 104 |
| 20 | 3300005441 | Ga0070700_100047956 | Ga0070700_1000479563 | 104 |
| 21 | 3300005445 | Ga0070708_100520848 | Ga0070708_1005208482 | 104 |
| 22 | 3300005456 | Ga0070678_100436965 | Ga0070678_1004369652 | 104 |
| 23 | 3300005456 | Ga0070678_101199434 | Ga0070678_1011994341 | 104 |
| 24 | 3300005459 | Ga0068867_100015064 | Ga0068867_1000150643 | 104 |
| 25 | 3300005466 | Ga0070685_10375181 | Ga0070685_103751812 | 104 |
| 26 | 3300005471 | Ga0070698_100075760 | Ga0070698_1000757603 | 104 |
| 27 | 3300005536 | Ga0070697_100051518 | Ga0070697_1000515182 | 104 |
| 28 | 3300005539 | Ga0068853_100627999 | Ga0068853_1006279991 | 104 |
| 29 | 3300005543 | Ga0070672_100218129 | Ga0070672_1002181292 | 104 |
| 30 | 3300005577 | Ga0068857_100507361 | Ga0068857_1005073611 | 104 |
| 31 | 3300005578 | Ga0068854_100343443 | Ga0068854_1003434432 | 104 |
| 32 | 3300005615 | Ga0070702_100310442 | Ga0070702_1003104422 | 104 |
| 33 | 3300005616 | Ga0068852_101924310 | Ga0068852_1019243102 | 104 |
| 34 | 3300005617 | Ga0068859_100000128 | Ga0068859_1000001284 | 104 |
| 35 | 3300005617 | Ga0068859_100118149 | Ga0068859_1001181494 | 104 |
| 36 | 3300005617 | Ga0068859_100340743 | Ga0068859_1003407433 | 104 |
| 37 | 3300005618 | Ga0068864_100079795 | Ga0068864_1000797952 | 104 |
| 38 | 3300005719 | Ga0068861_100483931 | Ga0068861_1004839312 | 104 |
| 39 | 3300005840 | Ga0068870_10828419 | Ga0068870_108284192 | 104 |
| 40 | 3300005841 | Ga0068863_100194564 | Ga0068863_1001945642 | 104 |
| 41 | 3300005844 | Ga0068862_101404166 | Ga0068862_1014041662 | 104 |
| 42 | 3300006358 | Ga0068871_100674003 | Ga0068871_1006740032 | 104 |
| 43 | 3300006358 | Ga0068871_102233885 | Ga0068871_1022338851 | 104 |
| 44 | 3300006881 | Ga0068865_100016853 | Ga0068865_1000168532 | 104 |
| 45 | 3300006931 | Ga0097620_100000128 | Ga0097620_10000012855 | 104 |
| 46 | 3300006931 | Ga0097620_100118146 | Ga0097620_1001181463 | 104 |
| 47 | 3300009093 | Ga0105240_10142389 | Ga0105240_101423893 | 104 |
| 48 | 3300009093 | Ga0105240_10151322 | Ga0105240_101513224 | 104 |
| 49 | 3300009148 | Ga0105243_10833104 | Ga0105243_108331041 | 104 |
| 50 | 3300009174 | Ga0105241_10230152 | Ga0105241_102301521 | 104 |
| 51 | 3300009174 | Ga0105241_10704680 | Ga0105241_107046802 | 104 |
| 52 | 3300009176 | Ga0105242_10860977 | Ga0105242_108609772 | 104 |
| 53 | 3300009177 | Ga0105248_10018721 | Ga0105248_100187212 | 104 |
| 54 | 3300009177 | Ga0105248_13043361 | Ga0105248_130433612 | 104 |
| 55 | 3300009545 | Ga0105237_10022652 | Ga0105237_100226528 | 104 |
| 56 | 3300009545 | Ga0105237_12764956 | Ga0105237_127649561 | 104 |
| 57 | 3300009553 | Ga0105249_10004971 | Ga0105249_100049714 | 104 |
| 58 | 3300010375 | Ga0105239_10014883 | Ga0105239_1001488311 | 104 |
| 59 | 3300010375 | Ga0105239_10863001 | Ga0105239_108630012 | 104 |
| 60 | 3300010375 | Ga0105239_10878842 | Ga0105239_108788421 | 104 |
| 61 | 3300013296 | Ga0157374_10361113 | Ga0157374_103611132 | 104 |
| 62 | 3300013296 | Ga0157374_10411884 | Ga0157374_104118843 | 104 |
| 63 | 3300013297 | Ga0157378_10192612 | Ga0157378_101926122 | 104 |
| 64 | 3300013297 | Ga0157378_10271550 | Ga0157378_102715502 | 104 |
| 65 | 3300013297 | Ga0157378_11064786 | Ga0157378_110647862 | 104 |
| 66 | 3300013306 | Ga0163162_10118800 | Ga0163162_101188004 | 104 |
| 67 | 3300013306 | Ga0163162_10790887 | Ga0163162_107908872 | 104 |
| 68 | 3300013308 | Ga0157375_10639859 | Ga0157375_106398592 | 104 |
| 69 | 3300014325 | Ga0163163_11027084 | Ga0163163_110270842 | 104 |
| 70 | 3300014745 | Ga0157377_10107275 | Ga0157377_101072751 | 104 |
| 71 | 3300025272 | Ga0209455_1003239 | Ga0209455_10032392 | 104 |
| 72 | 3300025893 | Ga0207682_10349708 | Ga0207682_103497082 | 104 |
| 73 | 3300025899 | Ga0207642_10019317 | Ga0207642_100193174 | 104 |
| 74 | 3300025904 | Ga0207647_10158900 | Ga0207647_101589003 | 104 |
| 75 | 3300025913 | Ga0207695_10068845 | Ga0207695_100688453 | 104 |
| 76 | 3300025914 | Ga0207671_10132417 | Ga0207671_101324171 | 104 |
| 77 | 3300025917 | Ga0207660_10367560 | Ga0207660_103675601 | 104 |
| 78 | 3300025918 | Ga0207662_10035006 | Ga0207662_100350061 | 104 |
| 79 | 3300025922 | Ga0207646_10120519 | Ga0207646_101205192 | 104 |
| 80 | 3300025923 | Ga0207681_10367529 | Ga0207681_103675292 | 104 |
| 81 | 3300025926 | Ga0207659_10534496 | Ga0207659_105344962 | 104 |
| 82 | 3300025934 | Ga0207686_10309192 | Ga0207686_103091922 | 104 |
| 83 | 3300025935 | Ga0207709_10205784 | Ga0207709_102057844 | 104 |
| 84 | 3300025937 | Ga0207669_10354074 | Ga0207669_103540741 | 104 |
| 85 | 3300025938 | Ga0207704_10359608 | Ga0207704_103596081 | 104 |
| 86 | 3300025940 | Ga0207691_10007611 | Ga0207691_100076115 | 104 |
| 87 | 3300025941 | Ga0207711_10058541 | Ga0207711_100585414 | 104 |
| 88 | 3300025941 | Ga0207711_11791947 | Ga0207711_117919471 | 104 |
| 89 | 3300025961 | Ga0207712_10170480 | Ga0207712_101704803 | 104 |
| 90 | 3300025986 | Ga0207658_10137113 | Ga0207658_101371134 | 104 |
| 91 | 3300026023 | Ga0207677_10553218 | Ga0207677_105532182 | 104 |
| 92 | 3300026023 | Ga0207677_11779838 | Ga0207677_117798381 | 104 |
| 93 | 3300026041 | Ga0207639_10130457 | Ga0207639_101304574 | 104 |
| 94 | 3300026067 | Ga0207678_10201899 | Ga0207678_102018992 | 104 |
| 95 | 3300026075 | Ga0207708_10017604 | Ga0207708_100176044 | 104 |
| 96 | 3300026088 | Ga0207641_10233935 | Ga0207641_102339352 | 104 |
| 97 | 3300026088 | Ga0207641_10541959 | Ga0207641_105419592 | 104 |
| 98 | 3300026095 | Ga0207676_10352943 | Ga0207676_103529431 | 104 |
| 99 | 3300026121 | Ga0207683_10240671 | Ga0207683_102406713 | 104 |
| 100 | 3300026142 | Ga0207698_10728534 | Ga0207698_107285342 | 104 |
| 101 | 3300028380 | Ga0268265_10286163 | Ga0268265_102861632 | 104 |
| 102 | 3300028381 | Ga0268264_10601952 | Ga0268264_106019522 | 104 |
| 103 | 3300035207 | Ga0373942_0025117 | Ga0373942_0025117_933_1259 | 104 |
| 104 | 3300037312 | Ga0395899_0115190 | Ga0395899_0115190_669_986 | 104 |
| 105 | 3300037471 | Ga0395905_0030285 | Ga0395905_0030285_4539_4856 | 104 |
| 106 | 3300038443 | Ga0395901_0054362 | Ga0395901_0054362_291_608 | 104 |
| 107 | 3300042876 | Ga0451577_0027814 | Ga0451577_0027814_1372_1686 | 104 |
| 108 | 3300042876 | Ga0451577_0202605 | Ga0451577_0202605_830_1156 | 104 |
| 109 | 3300044712 | Ga0453684_0517563 | Ga0453684_0517563_531_845 | 104 |
| 110 | 3300045049 | Ga0466959_0077269 | Ga0466959_0077269_1545_1871 | 104 |
| 111 | 3300045051 | Ga0451576_1787248 | Ga0451576_1787248_91_417 | 104 |
| 112 | 3300053142 | Ga0500577_0046752 | Ga0500577_0046752_264_584 | 104 |
| 113 | 3300005341 | Ga0070691_10110364 | Ga0070691_101103643 | 105 |
| 114 | 3300005545 | Ga0070695_100813774 | Ga0070695_1008137741 | 105 |
| 115 | 3300025936 | Ga0207670_11886993 | Ga0207670_118869931 | 105 |
| 116 | 3300028794 | Ga0307515_10000061 | Ga0307515_10000061169 | 105 |
| 117 | 3300028794 | Ga0307515_10629754 | Ga0307515_106297541 | 105 |
| 118 | 3300031507 | Ga0307509_10178754 | Ga0307509_101787543 | 105 |
| 119 | 3300031649 | Ga0307514_10433042 | Ga0307514_104330422 | 105 |
| 120 | 3300031901 | Ga0307406_10038111 | Ga0307406_100381113 | 105 |
| 121 | 3300041460 | Ga0451802_1188741 | Ga0451802_1188741_127_444 | 105 |
| 122 | 3300046507 | Ga0495606_0482368 | Ga0495606_0482368_13_330 | 105 |
| 123 | 2162886007 | SwRhRL2b_contig_1761633 | SwRhRL2b_0391.00006420 | 106 |
| 124 | 3300001991 | JGI24743J22301_10037794 | JGI24743J22301_100377942 | 106 |
| 125 | 3300002737 | JGI25162J39368_1000881 | JGI25162J39368_10008815 | 106 |
| 126 | 3300002773 | JGI25152J39213_1050914 | JGI25152J39213_10509142 | 106 |
| 127 | 3300003215 | JGI25153J46596_10011436 | JGI25153J46596_100114362 | 106 |
| 128 | 3300003316 | rootH1_10040117 | rootH1_100401175 | 106 |
| 129 | 3300003320 | rootH2_10075751 | rootH2_100757513 | 106 |
| 130 | 3300003322 | rootL2_10228164 | rootL2_102281642 | 106 |
| 131 | 3300003323 | rootH1_10041130 | rootH1_100411301 | 106 |
| 132 | 3300003323 | rootH1_10121882 | rootH1_101218825 | 106 |
| 133 | 3300003354 | JGI25160J50197_1002465 | JGI25160J50197_10024653 | 106 |
| 134 | 3300003761 | Ga0055535_1002560 | Ga0055535_10025606 | 106 |
| 135 | 3300003762 | Ga0055542_1015957 | Ga0055542_10159573 | 106 |
| 136 | 3300003771 | Ga0055526_1007155 | Ga0055526_10071556 | 106 |
| 137 | 3300003771 | Ga0055526_1013227 | Ga0055526_10132274 | 106 |
| 138 | 3300003790 | Ga0055528_1000314 | Ga0055528_100031432 | 106 |
| 139 | 3300003791 | Ga0055530_10000619 | Ga0055530_1000061910 | 106 |
| 140 | 3300003794 | Ga0055531_10048271 | Ga0055531_100482712 | 106 |
| 141 | 3300004625 | Ga0055543_1014328 | Ga0055543_10143282 | 106 |
| 142 | 3300005262 | Ga0065165_1000182 | Ga0065165_100018247 | 106 |
| 143 | 3300005289 | Ga0065704_10000195 | Ga0065704_10000195114 | 106 |
| 144 | 3300005289 | Ga0065704_10074748 | Ga0065704_100747485 | 106 |
| 145 | 3300005289 | Ga0065704_10077797 | Ga0065704_100777977 | 106 |
| 146 | 3300005327 | Ga0070658_10004280 | Ga0070658_1000428010 | 106 |
| 147 | 3300005327 | Ga0070658_10020569 | Ga0070658_100205692 | 106 |
| 148 | 3300005327 | Ga0070658_10070911 | Ga0070658_100709112 | 106 |
| 149 | 3300005327 | Ga0070658_10503165 | Ga0070658_105031652 | 106 |
| 150 | 3300005327 | Ga0070658_11923110 | Ga0070658_119231101 | 106 |
| 151 | 3300005328 | Ga0070676_10000015 | Ga0070676_1000001546 | 106 |
| 152 | 3300005328 | Ga0070676_10025476 | Ga0070676_100254763 | 106 |
| 153 | 3300005328 | Ga0070676_10180861 | Ga0070676_101808611 | 106 |
| 154 | 3300005331 | Ga0070670_101463292 | Ga0070670_1014632921 | 106 |
| 155 | 3300005331 | Ga0070670_101972507 | Ga0070670_1019725071 | 106 |
| 156 | 3300005333 | Ga0070677_10234154 | Ga0070677_102341542 | 106 |
| 157 | 3300005334 | Ga0068869_100079027 | Ga0068869_1000790272 | 106 |
| 158 | 3300005334 | Ga0068869_100079473 | Ga0068869_1000794732 | 106 |
| 159 | 3300005334 | Ga0068869_100132816 | Ga0068869_1001328161 | 106 |
| 160 | 3300005334 | Ga0068869_100434166 | Ga0068869_1004341661 | 106 |
| 161 | 3300005334 | Ga0068869_100820125 | Ga0068869_1008201251 | 106 |
| 162 | 3300005335 | Ga0070666_10000042 | Ga0070666_1000004219 | 106 |
| 163 | 3300005335 | Ga0070666_10026174 | Ga0070666_100261743 | 106 |
| 164 | 3300005335 | Ga0070666_11103400 | Ga0070666_111034002 | 106 |
| 165 | 3300005336 | Ga0070680_100003917 | Ga0070680_10000391712 | 106 |
| 166 | 3300005336 | Ga0070680_100035400 | Ga0070680_1000354006 | 106 |
| 167 | 3300005338 | Ga0068868_100012254 | Ga0068868_10001225410 | 106 |
| 168 | 3300005338 | Ga0068868_100060336 | Ga0068868_1000603363 | 106 |
| 169 | 3300005338 | Ga0068868_100120710 | Ga0068868_1001207102 | 106 |
| 170 | 3300005338 | Ga0068868_100367921 | Ga0068868_1003679212 | 106 |
| 171 | 3300005339 | Ga0070660_100028681 | Ga0070660_1000286812 | 106 |
| 172 | 3300005339 | Ga0070660_100044533 | Ga0070660_1000445334 | 106 |
| 173 | 3300005339 | Ga0070660_100169934 | Ga0070660_1001699342 | 106 |
| 174 | 3300005339 | Ga0070660_100432358 | Ga0070660_1004323581 | 106 |
| 175 | 3300005339 | Ga0070660_100588345 | Ga0070660_1005883452 | 106 |
| 176 | 3300005339 | Ga0070660_101461093 | Ga0070660_1014610931 | 106 |
| 177 | 3300005340 | Ga0070689_100747958 | Ga0070689_1007479581 | 106 |
| 178 | 3300005343 | Ga0070687_100131270 | Ga0070687_1001312702 | 106 |
| 179 | 3300005344 | Ga0070661_101832669 | Ga0070661_1018326692 | 106 |
| 180 | 3300005345 | Ga0070692_10516515 | Ga0070692_105165152 | 106 |
| 181 | 3300005354 | Ga0070675_100208280 | Ga0070675_1002082801 | 106 |
| 182 | 3300005354 | Ga0070675_100709224 | Ga0070675_1007092241 | 106 |
| 183 | 3300005355 | Ga0070671_100062516 | Ga0070671_1000625162 | 106 |
| 184 | 3300005355 | Ga0070671_100213561 | Ga0070671_1002135614 | 106 |
| 185 | 3300005356 | Ga0070674_101515989 | Ga0070674_1015159891 | 106 |
| 186 | 3300005356 | Ga0070674_101552583 | Ga0070674_1015525831 | 106 |
| 187 | 3300005364 | Ga0070673_100008611 | Ga0070673_1000086114 | 106 |
| 188 | 3300005364 | Ga0070673_100399007 | Ga0070673_1003990072 | 106 |
| 189 | 3300005364 | Ga0070673_100578329 | Ga0070673_1005783291 | 106 |
| 190 | 3300005365 | Ga0070688_100087821 | Ga0070688_1000878212 | 106 |
| 191 | 3300005365 | Ga0070688_100281550 | Ga0070688_1002815503 | 106 |
| 192 | 3300005366 | Ga0070659_100077889 | Ga0070659_1000778892 | 106 |
| 193 | 3300005366 | Ga0070659_100228350 | Ga0070659_1002283502 | 106 |
| 194 | 3300005366 | Ga0070659_100521248 | Ga0070659_1005212482 | 106 |
| 195 | 3300005366 | Ga0070659_100672469 | Ga0070659_1006724691 | 106 |
| 196 | 3300005367 | Ga0070667_100287451 | Ga0070667_1002874512 | 106 |
| 197 | 3300005367 | Ga0070667_100502390 | Ga0070667_1005023901 | 106 |
| 198 | 3300005367 | Ga0070667_100636892 | Ga0070667_1006368922 | 106 |
| 199 | 3300005367 | Ga0070667_100830050 | Ga0070667_1008300501 | 106 |
| 200 | 3300005367 | Ga0070667_101094853 | Ga0070667_1010948532 | 106 |
| 201 | 3300005367 | Ga0070667_102231714 | Ga0070667_1022317141 | 106 |
| 202 | 3300005435 | Ga0070714_100946217 | Ga0070714_1009462172 | 106 |
| 203 | 3300005438 | Ga0070701_10088579 | Ga0070701_100885792 | 106 |
| 204 | 3300005441 | Ga0070700_100059909 | Ga0070700_1000599092 | 106 |
| 205 | 3300005456 | Ga0070678_100007585 | Ga0070678_1000075854 | 106 |
| 206 | 3300005456 | Ga0070678_101047122 | Ga0070678_1010471221 | 106 |
| 207 | 3300005457 | Ga0070662_100000020 | Ga0070662_1000000206 | 106 |
| 208 | 3300005457 | Ga0070662_100127121 | Ga0070662_1001271212 | 106 |
| 209 | 3300005458 | Ga0070681_10066604 | Ga0070681_100666042 | 106 |
| 210 | 3300005458 | Ga0070681_10178869 | Ga0070681_101788693 | 106 |
| 211 | 3300005458 | Ga0070681_10329484 | Ga0070681_103294842 | 106 |
| 212 | 3300005458 | Ga0070681_10789987 | Ga0070681_107899872 | 106 |
| 213 | 3300005459 | Ga0068867_100005742 | Ga0068867_1000057426 | 106 |
| 214 | 3300005459 | Ga0068867_100034465 | Ga0068867_1000344654 | 106 |
| 215 | 3300005459 | Ga0068867_100270581 | Ga0068867_1002705813 | 106 |
| 216 | 3300005459 | Ga0068867_101069628 | Ga0068867_1010696281 | 106 |
| 217 | 3300005459 | Ga0068867_102256935 | Ga0068867_1022569352 | 106 |
| 218 | 3300005466 | Ga0070685_10731758 | Ga0070685_107317582 | 106 |
| 219 | 3300005466 | Ga0070685_11462197 | Ga0070685_114621971 | 106 |
| 220 | 3300005471 | Ga0070698_100000282 | Ga0070698_10000028244 | 106 |
| 221 | 3300005471 | Ga0070698_100045076 | Ga0070698_1000450762 | 106 |
| 222 | 3300005530 | Ga0070679_100121395 | Ga0070679_1001213955 | 106 |
| 223 | 3300005530 | Ga0070679_101000312 | Ga0070679_1010003122 | 106 |
| 224 | 3300005535 | Ga0070684_101435525 | Ga0070684_1014355251 | 106 |
| 225 | 3300005539 | Ga0068853_100024000 | Ga0068853_1000240007 | 106 |
| 226 | 3300005539 | Ga0068853_100025264 | Ga0068853_1000252643 | 106 |
| 227 | 3300005539 | Ga0068853_100056937 | Ga0068853_1000569373 | 106 |
| 228 | 3300005539 | Ga0068853_100071038 | Ga0068853_1000710385 | 106 |
| 229 | 3300005539 | Ga0068853_100661437 | Ga0068853_1006614372 | 106 |
| 230 | 3300005539 | Ga0068853_100935982 | Ga0068853_1009359822 | 106 |
| 231 | 3300005539 | Ga0068853_101555170 | Ga0068853_1015551702 | 106 |
| 232 | 3300005539 | Ga0068853_101860645 | Ga0068853_1018606451 | 106 |
| 233 | 3300005543 | Ga0070672_100379391 | Ga0070672_1003793912 | 106 |
| 234 | 3300005543 | Ga0070672_100511937 | Ga0070672_1005119372 | 106 |
| 235 | 3300005543 | Ga0070672_101942610 | Ga0070672_1019426101 | 106 |
| 236 | 3300005544 | Ga0070686_100061045 | Ga0070686_1000610451 | 106 |
| 237 | 3300005548 | Ga0070665_100000125 | Ga0070665_10000012565 | 106 |
| 238 | 3300005549 | Ga0070704_100517376 | Ga0070704_1005173762 | 106 |
| 239 | 3300005563 | Ga0068855_100068805 | Ga0068855_1000688056 | 106 |
| 240 | 3300005563 | Ga0068855_100102831 | Ga0068855_1001028312 | 106 |
| 241 | 3300005563 | Ga0068855_100127897 | Ga0068855_1001278975 | 106 |
| 242 | 3300005563 | Ga0068855_100354440 | Ga0068855_1003544403 | 106 |
| 243 | 3300005563 | Ga0068855_100443475 | Ga0068855_1004434752 | 106 |
| 244 | 3300005563 | Ga0068855_100527701 | Ga0068855_1005277011 | 106 |
| 245 | 3300005563 | Ga0068855_100820970 | Ga0068855_1008209702 | 106 |
| 246 | 3300005563 | Ga0068855_100840388 | Ga0068855_1008403882 | 106 |
| 247 | 3300005563 | Ga0068855_100951509 | Ga0068855_1009515091 | 106 |
| 248 | 3300005563 | Ga0068855_101322690 | Ga0068855_1013226902 | 106 |
| 249 | 3300005564 | Ga0070664_100001016 | Ga0070664_10000101614 | 106 |
| 250 | 3300005564 | Ga0070664_100723412 | Ga0070664_1007234122 | 106 |
| 251 | 3300005564 | Ga0070664_100810250 | Ga0070664_1008102502 | 106 |
| 252 | 3300005564 | Ga0070664_101233430 | Ga0070664_1012334302 | 106 |
| 253 | 3300005577 | Ga0068857_100517758 | Ga0068857_1005177582 | 106 |
| 254 | 3300005577 | Ga0068857_100822873 | Ga0068857_1008228732 | 106 |
| 255 | 3300005577 | Ga0068857_102373572 | Ga0068857_1023735722 | 106 |
| 256 | 3300005578 | Ga0068854_100028379 | Ga0068854_1000283795 | 106 |
| 257 | 3300005578 | Ga0068854_100502831 | Ga0068854_1005028312 | 106 |
| 258 | 3300005614 | Ga0068856_100187239 | Ga0068856_1001872393 | 106 |
| 259 | 3300005614 | Ga0068856_101713242 | Ga0068856_1017132421 | 106 |
| 260 | 3300005615 | Ga0070702_100010581 | Ga0070702_1000105816 | 106 |
| 261 | 3300005616 | Ga0068852_100002994 | Ga0068852_1000029948 | 106 |
| 262 | 3300005616 | Ga0068852_100078108 | Ga0068852_1000781085 | 106 |
| 263 | 3300005616 | Ga0068852_100558452 | Ga0068852_1005584522 | 106 |
| 264 | 3300005616 | Ga0068852_101208348 | Ga0068852_1012083482 | 106 |
| 265 | 3300005616 | Ga0068852_102428643 | Ga0068852_1024286431 | 106 |
| 266 | 3300005617 | Ga0068859_100000768 | Ga0068859_10000076817 | 106 |
| 267 | 3300005617 | Ga0068859_100162120 | Ga0068859_1001621204 | 106 |
| 268 | 3300005617 | Ga0068859_100353678 | Ga0068859_1003536782 | 106 |
| 269 | 3300005617 | Ga0068859_101191439 | Ga0068859_1011914392 | 106 |
| 270 | 3300005618 | Ga0068864_100026441 | Ga0068864_1000264414 | 106 |
| 271 | 3300005618 | Ga0068864_100366918 | Ga0068864_1003669183 | 106 |
| 272 | 3300005718 | Ga0068866_10036252 | Ga0068866_100362524 | 106 |
| 273 | 3300005719 | Ga0068861_100453396 | Ga0068861_1004533961 | 106 |
| 274 | 3300005719 | Ga0068861_100829985 | Ga0068861_1008299852 | 106 |
| 275 | 3300005719 | Ga0068861_101316228 | Ga0068861_1013162281 | 106 |
| 276 | 3300005840 | Ga0068870_10085772 | Ga0068870_100857723 | 106 |
| 277 | 3300005840 | Ga0068870_10110453 | Ga0068870_101104532 | 106 |
| 278 | 3300005841 | Ga0068863_100016956 | Ga0068863_10001695610 | 106 |
| 279 | 3300005841 | Ga0068863_100654900 | Ga0068863_1006549003 | 106 |
| 280 | 3300005842 | Ga0068858_100057422 | Ga0068858_1000574222 | 106 |
| 281 | 3300005842 | Ga0068858_100162391 | Ga0068858_1001623912 | 106 |
| 282 | 3300005842 | Ga0068858_100520777 | Ga0068858_1005207772 | 106 |
| 283 | 3300005842 | Ga0068858_100621735 | Ga0068858_1006217351 | 106 |
| 284 | 3300005842 | Ga0068858_101200109 | Ga0068858_1012001091 | 106 |
| 285 | 3300005842 | Ga0068858_102029529 | Ga0068858_1020295292 | 106 |
| 286 | 3300005843 | Ga0068860_100000059 | Ga0068860_100000059161 | 106 |
| 287 | 3300005843 | Ga0068860_100009276 | Ga0068860_1000092764 | 106 |
| 288 | 3300005843 | Ga0068860_100181649 | Ga0068860_1001816491 | 106 |
| 289 | 3300005843 | Ga0068860_100472368 | Ga0068860_1004723681 | 106 |
| 290 | 3300005843 | Ga0068860_101496403 | Ga0068860_1014964032 | 106 |
| 291 | 3300005843 | Ga0068860_102529530 | Ga0068860_1025295301 | 106 |
| 292 | 3300005844 | Ga0068862_100009951 | Ga0068862_1000099515 | 106 |
| 293 | 3300005844 | Ga0068862_101901888 | Ga0068862_1019018882 | 106 |
| 294 | 3300005844 | Ga0068862_102080960 | Ga0068862_1020809602 | 106 |
| 295 | 3300005985 | Ga0081539_10144985 | Ga0081539_101449852 | 106 |
| 296 | 3300006195 | Ga0075366_10233851 | Ga0075366_102338512 | 106 |
| 297 | 3300006195 | Ga0075366_10382866 | Ga0075366_103828662 | 106 |
| 298 | 3300006237 | Ga0097621_100000714 | Ga0097621_1000007143 | 106 |
| 299 | 3300006237 | Ga0097621_100016633 | Ga0097621_1000166334 | 106 |
| 300 | 3300006237 | Ga0097621_100426646 | Ga0097621_1004266461 | 106 |
| 301 | 3300006237 | Ga0097621_102401101 | Ga0097621_1024011011 | 106 |
| 302 | 3300006358 | Ga0068871_100000046 | Ga0068871_10000004610 | 106 |
| 303 | 3300006358 | Ga0068871_100032967 | Ga0068871_1000329674 | 106 |
| 304 | 3300006358 | Ga0068871_100083877 | Ga0068871_1000838774 | 106 |
| 305 | 3300006881 | Ga0068865_100000041 | Ga0068865_10000004127 | 106 |
| 306 | 3300006931 | Ga0097620_100000768 | Ga0097620_10000076817 | 106 |
| 307 | 3300006931 | Ga0097620_100162125 | Ga0097620_1001621252 | 106 |
| 308 | 3300006931 | Ga0097620_100353680 | Ga0097620_1003536802 | 106 |
| 309 | 3300006931 | Ga0097620_101191459 | Ga0097620_1011914592 | 106 |
| 310 | 3300009092 | Ga0105250_10578428 | Ga0105250_105784281 | 106 |
| 311 | 3300009093 | Ga0105240_10000692 | Ga0105240_1000069214 | 106 |
| 312 | 3300009093 | Ga0105240_10091827 | Ga0105240_100918273 | 106 |
| 313 | 3300009093 | Ga0105240_10228824 | Ga0105240_102288243 | 106 |
| 314 | 3300009093 | Ga0105240_10275776 | Ga0105240_102757762 | 106 |
| 315 | 3300009093 | Ga0105240_10377563 | Ga0105240_103775633 | 106 |
| 316 | 3300009093 | Ga0105240_11192892 | Ga0105240_111928921 | 106 |
| 317 | 3300009098 | Ga0105245_12352170 | Ga0105245_123521701 | 106 |
| 318 | 3300009098 | Ga0105245_12489654 | Ga0105245_124896542 | 106 |
| 319 | 3300009101 | Ga0105247_10012983 | Ga0105247_100129838 | 106 |
| 320 | 3300009174 | Ga0105241_10000217 | Ga0105241_100002179 | 106 |
| 321 | 3300009174 | Ga0105241_10000853 | Ga0105241_1000085314 | 106 |
| 322 | 3300009174 | Ga0105241_10014129 | Ga0105241_100141292 | 106 |
| 323 | 3300009174 | Ga0105241_11081115 | Ga0105241_110811152 | 106 |
| 324 | 3300009176 | Ga0105242_10012349 | Ga0105242_100123493 | 106 |
| 325 | 3300009177 | Ga0105248_13390872 | Ga0105248_133908722 | 106 |
| 326 | 3300009545 | Ga0105237_10001818 | Ga0105237_1000181812 | 106 |
| 327 | 3300009545 | Ga0105237_10005378 | Ga0105237_100053782 | 106 |
| 328 | 3300009545 | Ga0105237_10064143 | Ga0105237_100641436 | 106 |
| 329 | 3300009545 | Ga0105237_10100775 | Ga0105237_101007752 | 106 |
| 330 | 3300009545 | Ga0105237_10100974 | Ga0105237_101009741 | 106 |
| 331 | 3300009545 | Ga0105237_10174509 | Ga0105237_101745093 | 106 |
| 332 | 3300009545 | Ga0105237_11804019 | Ga0105237_118040191 | 106 |
| 333 | 3300009551 | Ga0105238_10002068 | Ga0105238_100020685 | 106 |
| 334 | 3300009551 | Ga0105238_10049554 | Ga0105238_100495542 | 106 |
| 335 | 3300009553 | Ga0105249_10001650 | Ga0105249_100016506 | 106 |
| 336 | 3300009553 | Ga0105249_10127295 | Ga0105249_101272954 | 106 |
| 337 | 3300009553 | Ga0105249_10354681 | Ga0105249_103546811 | 106 |
| 338 | 3300010375 | Ga0105239_10003770 | Ga0105239_1000377016 | 106 |
| 339 | 3300010375 | Ga0105239_10004595 | Ga0105239_100045955 | 106 |
| 340 | 3300010375 | Ga0105239_10020326 | Ga0105239_100203265 | 106 |
| 341 | 3300010375 | Ga0105239_10131045 | Ga0105239_101310454 | 106 |
| 342 | 3300010375 | Ga0105239_10230797 | Ga0105239_102307973 | 106 |
| 343 | 3300010375 | Ga0105239_10323232 | Ga0105239_103232324 | 106 |
| 344 | 3300010375 | Ga0105239_10368999 | Ga0105239_103689992 | 106 |
| 345 | 3300010375 | Ga0105239_10369001 | Ga0105239_103690012 | 106 |
| 346 | 3300010375 | Ga0105239_12443028 | Ga0105239_124430281 | 106 |
| 347 | 3300011119 | Ga0105246_10030380 | Ga0105246_100303803 | 106 |
| 348 | 3300012482 | Ga0157318_1010462 | Ga0157318_10104621 | 106 |
| 349 | 3300013100 | Ga0157373_10018201 | Ga0157373_100182013 | 106 |
| 350 | 3300013100 | Ga0157373_10115049 | Ga0157373_101150492 | 106 |
| 351 | 3300013100 | Ga0157373_10451993 | Ga0157373_104519931 | 106 |
| 352 | 3300013100 | Ga0157373_10734773 | Ga0157373_107347732 | 106 |
| 353 | 3300013102 | Ga0157371_10001084 | Ga0157371_100010845 | 106 |
| 354 | 3300013102 | Ga0157371_10005892 | Ga0157371_1000589211 | 106 |
| 355 | 3300013102 | Ga0157371_10117844 | Ga0157371_101178442 | 106 |
| 356 | 3300013102 | Ga0157371_10200008 | Ga0157371_102000083 | 106 |
| 357 | 3300013102 | Ga0157371_10226730 | Ga0157371_102267303 | 106 |
| 358 | 3300013102 | Ga0157371_10655107 | Ga0157371_106551071 | 106 |
| 359 | 3300013104 | Ga0157370_10004729 | Ga0157370_1000472912 | 106 |
| 360 | 3300013104 | Ga0157370_10005230 | Ga0157370_100052309 | 106 |
| 361 | 3300013104 | Ga0157370_10007942 | Ga0157370_100079429 | 106 |
| 362 | 3300013104 | Ga0157370_10741662 | Ga0157370_107416622 | 106 |
| 363 | 3300013104 | Ga0157370_10856618 | Ga0157370_108566181 | 106 |
| 364 | 3300013104 | Ga0157370_11746082 | Ga0157370_117460821 | 106 |
| 365 | 3300013105 | Ga0157369_10710310 | Ga0157369_107103101 | 106 |
| 366 | 3300013296 | Ga0157374_10024480 | Ga0157374_100244806 | 106 |
| 367 | 3300013296 | Ga0157374_10120999 | Ga0157374_101209994 | 106 |
| 368 | 3300013296 | Ga0157374_10180122 | Ga0157374_101801224 | 106 |
| 369 | 3300013296 | Ga0157374_10764166 | Ga0157374_107641661 | 106 |
| 370 | 3300013296 | Ga0157374_11519916 | Ga0157374_115199162 | 106 |
| 371 | 3300013297 | Ga0157378_10002500 | Ga0157378_1000250010 | 106 |
| 372 | 3300013297 | Ga0157378_10010592 | Ga0157378_100105925 | 106 |
| 373 | 3300013297 | Ga0157378_10039612 | Ga0157378_100396123 | 106 |
| 374 | 3300013297 | Ga0157378_10100133 | Ga0157378_101001335 | 106 |
| 375 | 3300013297 | Ga0157378_10438265 | Ga0157378_104382652 | 106 |
| 376 | 3300013297 | Ga0157378_10522041 | Ga0157378_105220413 | 106 |
| 377 | 3300013297 | Ga0157378_12967902 | Ga0157378_129679022 | 106 |
| 378 | 3300013306 | Ga0163162_10000005 | Ga0163162_1000000575 | 106 |
| 379 | 3300013306 | Ga0163162_10004176 | Ga0163162_100041762 | 106 |
| 380 | 3300013306 | Ga0163162_10025120 | Ga0163162_100251203 | 106 |
| 381 | 3300013306 | Ga0163162_10162723 | Ga0163162_101627235 | 106 |
| 382 | 3300013306 | Ga0163162_11089836 | Ga0163162_110898362 | 106 |
| 383 | 3300013306 | Ga0163162_12934557 | Ga0163162_129345571 | 106 |
| 384 | 3300013307 | Ga0157372_10067142 | Ga0157372_100671423 | 106 |
| 385 | 3300013307 | Ga0157372_10147956 | Ga0157372_101479565 | 106 |
| 386 | 3300013307 | Ga0157372_10279148 | Ga0157372_102791485 | 106 |
| 387 | 3300013307 | Ga0157372_10357598 | Ga0157372_103575983 | 106 |
| 388 | 3300013307 | Ga0157372_10946520 | Ga0157372_109465203 | 106 |
| 389 | 3300013307 | Ga0157372_11516755 | Ga0157372_115167551 | 106 |
| 390 | 3300013307 | Ga0157372_11860707 | Ga0157372_118607072 | 106 |
| 391 | 3300013308 | Ga0157375_10056217 | Ga0157375_100562174 | 106 |
| 392 | 3300013308 | Ga0157375_10076765 | Ga0157375_100767654 | 106 |
| 393 | 3300013308 | Ga0157375_10136908 | Ga0157375_101369083 | 106 |
| 394 | 3300013308 | Ga0157375_10190225 | Ga0157375_101902252 | 106 |
| 395 | 3300013308 | Ga0157375_10327155 | Ga0157375_103271552 | 106 |
| 396 | 3300013308 | Ga0157375_12856259 | Ga0157375_128562591 | 106 |
| 397 | 3300013308 | Ga0157375_13298652 | Ga0157375_132986521 | 106 |
| 398 | 3300014325 | Ga0163163_10044636 | Ga0163163_100446362 | 106 |
| 399 | 3300014325 | Ga0163163_10209269 | Ga0163163_102092691 | 106 |
| 400 | 3300014325 | Ga0163163_10522091 | Ga0163163_105220911 | 106 |
| 401 | 3300014325 | Ga0163163_10933780 | Ga0163163_109337801 | 106 |
| 402 | 3300014326 | Ga0157380_10760117 | Ga0157380_107601172 | 106 |
| 403 | 3300014326 | Ga0157380_12632947 | Ga0157380_126329471 | 106 |
| 404 | 3300014497 | Ga0182008_10000108 | Ga0182008_1000010852 | 106 |
| 405 | 3300014745 | Ga0157377_10002130 | Ga0157377_100021304 | 106 |
| 406 | 3300014745 | Ga0157377_10013404 | Ga0157377_100134043 | 106 |
| 407 | 3300014745 | Ga0157377_10456364 | Ga0157377_104563642 | 106 |
| 408 | 3300014968 | Ga0157379_10927927 | Ga0157379_109279272 | 106 |
| 409 | 3300014968 | Ga0157379_12485608 | Ga0157379_124856082 | 106 |
| 410 | 3300014969 | Ga0157376_10328573 | Ga0157376_103285732 | 106 |
| 411 | 3300014969 | Ga0157376_10386112 | Ga0157376_103861123 | 106 |
| 412 | 3300014969 | Ga0157376_11477504 | Ga0157376_114775042 | 106 |
| 413 | 3300014969 | Ga0157376_12559847 | Ga0157376_125598472 | 106 |
| 414 | 3300015261 | Ga0182006_1000109 | Ga0182006_10001099 | 106 |
| 415 | 3300015262 | Ga0182007_10037805 | Ga0182007_100378053 | 106 |
| 416 | 3300017792 | Ga0163161_10001003 | Ga0163161_100010037 | 106 |
| 417 | 3300017792 | Ga0163161_10036486 | Ga0163161_100364862 | 106 |
| 418 | 3300017792 | Ga0163161_10168620 | Ga0163161_101686203 | 106 |
| 419 | 3300017792 | Ga0163161_10203301 | Ga0163161_102033014 | 106 |
| 420 | 3300017792 | Ga0163161_10463349 | Ga0163161_104633492 | 106 |
| 421 | 3300017792 | Ga0163161_12065873 | Ga0163161_120658731 | 106 |
| 422 | 3300021361 | Ga0213872_10029500 | Ga0213872_100295004 | 106 |
| 423 | 3300021384 | Ga0213876_10000722 | Ga0213876_1000072213 | 106 |
| 424 | 3300025233 | Ga0209437_100528 | Ga0209437_10052824 | 106 |
| 425 | 3300025242 | Ga0209258_100029 | Ga0209258_10002947 | 106 |
| 426 | 3300025246 | Ga0209646_1016800 | Ga0209646_10168002 | 106 |
| 427 | 3300025250 | Ga0209026_1000890 | Ga0209026_10008904 | 106 |
| 428 | 3300025254 | Ga0209148_1000163 | Ga0209148_100016320 | 106 |
| 429 | 3300025258 | Ga0209129_1009318 | Ga0209129_10093184 | 106 |
| 430 | 3300025273 | Ga0209673_1000016 | Ga0209673_100001616 | 106 |
| 431 | 3300025295 | Ga0209564_1005465 | Ga0209564_10054652 | 106 |
| 432 | 3300025297 | Ga0209758_1006613 | Ga0209758_10066139 | 106 |
| 433 | 3300025298 | Ga0209050_1000124 | Ga0209050_1000124162 | 106 |
| 434 | 3300025302 | Ga0207426_1000157 | Ga0207426_1000157118 | 106 |
| 435 | 3300025302 | Ga0207426_1000925 | Ga0207426_100092517 | 106 |
| 436 | 3300025303 | Ga0209051_1023842 | Ga0209051_10238424 | 106 |
| 437 | 3300025304 | Ga0209257_1001535 | Ga0209257_100153519 | 106 |
| 438 | 3300025315 | Ga0207697_10354971 | Ga0207697_103549712 | 106 |
| 439 | 3300025893 | Ga0207682_10399046 | Ga0207682_103990462 | 106 |
| 440 | 3300025899 | Ga0207642_10289659 | Ga0207642_102896592 | 106 |
| 441 | 3300025900 | Ga0207710_10043471 | Ga0207710_100434713 | 106 |
| 442 | 3300025901 | Ga0207688_10005502 | Ga0207688_100055024 | 106 |
| 443 | 3300025901 | Ga0207688_10747440 | Ga0207688_107474402 | 106 |
| 444 | 3300025903 | Ga0207680_10000448 | Ga0207680_1000044819 | 106 |
| 445 | 3300025904 | Ga0207647_10000117 | Ga0207647_1000011720 | 106 |
| 446 | 3300025904 | Ga0207647_10045721 | Ga0207647_100457214 | 106 |
| 447 | 3300025904 | Ga0207647_10086213 | Ga0207647_100862132 | 106 |
| 448 | 3300025905 | Ga0207685_10314334 | Ga0207685_103143342 | 106 |
| 449 | 3300025907 | Ga0207645_10009683 | Ga0207645_100096835 | 106 |
| 450 | 3300025907 | Ga0207645_10013933 | Ga0207645_100139331 | 106 |
| 451 | 3300025907 | Ga0207645_10088067 | Ga0207645_100880674 | 106 |
| 452 | 3300025908 | Ga0207643_10045067 | Ga0207643_100450672 | 106 |
| 453 | 3300025908 | Ga0207643_10138292 | Ga0207643_101382923 | 106 |
| 454 | 3300025909 | Ga0207705_10000623 | Ga0207705_100006237 | 106 |
| 455 | 3300025909 | Ga0207705_10078920 | Ga0207705_100789204 | 106 |
| 456 | 3300025909 | Ga0207705_10085635 | Ga0207705_100856355 | 106 |
| 457 | 3300025909 | Ga0207705_10179389 | Ga0207705_101793893 | 106 |
| 458 | 3300025909 | Ga0207705_11286318 | Ga0207705_112863181 | 106 |
| 459 | 3300025911 | Ga0207654_10000524 | Ga0207654_1000052419 | 106 |
| 460 | 3300025911 | Ga0207654_10008858 | Ga0207654_100088588 | 106 |
| 461 | 3300025911 | Ga0207654_10011575 | Ga0207654_100115754 | 106 |
| 462 | 3300025912 | Ga0207707_10343059 | Ga0207707_103430593 | 106 |
| 463 | 3300025912 | Ga0207707_11427569 | Ga0207707_114275691 | 106 |
| 464 | 3300025913 | Ga0207695_10000020 | Ga0207695_1000002015 | 106 |
| 465 | 3300025913 | Ga0207695_10008260 | Ga0207695_1000826013 | 106 |
| 466 | 3300025913 | Ga0207695_10048139 | Ga0207695_100481393 | 106 |
| 467 | 3300025913 | Ga0207695_10895876 | Ga0207695_108958762 | 106 |
| 468 | 3300025914 | Ga0207671_10002893 | Ga0207671_1000289312 | 106 |
| 469 | 3300025914 | Ga0207671_10005501 | Ga0207671_100055014 | 106 |
| 470 | 3300025914 | Ga0207671_10008195 | Ga0207671_100081959 | 106 |
| 471 | 3300025914 | Ga0207671_10022597 | Ga0207671_100225975 | 106 |
| 472 | 3300025914 | Ga0207671_10027556 | Ga0207671_100275561 | 106 |
| 473 | 3300025914 | Ga0207671_10119370 | Ga0207671_101193703 | 106 |
| 474 | 3300025914 | Ga0207671_10244524 | Ga0207671_102445242 | 106 |
| 475 | 3300025914 | Ga0207671_11239614 | Ga0207671_112396142 | 106 |
| 476 | 3300025916 | Ga0207663_10540253 | Ga0207663_105402531 | 106 |
| 477 | 3300025917 | Ga0207660_10035604 | Ga0207660_100356046 | 106 |
| 478 | 3300025918 | Ga0207662_10041489 | Ga0207662_100414896 | 106 |
| 479 | 3300025919 | Ga0207657_10012327 | Ga0207657_1001232710 | 106 |
| 480 | 3300025919 | Ga0207657_10268913 | Ga0207657_102689133 | 106 |
| 481 | 3300025919 | Ga0207657_10535440 | Ga0207657_105354402 | 106 |
| 482 | 3300025919 | Ga0207657_10800976 | Ga0207657_108009761 | 106 |
| 483 | 3300025919 | Ga0207657_10912900 | Ga0207657_109129001 | 106 |
| 484 | 3300025921 | Ga0207652_11877545 | Ga0207652_118775451 | 106 |
| 485 | 3300025922 | Ga0207646_11096909 | Ga0207646_110969092 | 106 |
| 486 | 3300025923 | Ga0207681_10585725 | Ga0207681_105857252 | 106 |
| 487 | 3300025923 | Ga0207681_11587396 | Ga0207681_115873962 | 106 |
| 488 | 3300025924 | Ga0207694_10035339 | Ga0207694_100353392 | 106 |
| 489 | 3300025924 | Ga0207694_10072542 | Ga0207694_100725422 | 106 |
| 490 | 3300025926 | Ga0207659_10239400 | Ga0207659_102394002 | 106 |
| 491 | 3300025927 | Ga0207687_11720539 | Ga0207687_117205392 | 106 |
| 492 | 3300025929 | Ga0207664_10954863 | Ga0207664_109548632 | 106 |
| 493 | 3300025931 | Ga0207644_10072589 | Ga0207644_100725893 | 106 |
| 494 | 3300025931 | Ga0207644_10186173 | Ga0207644_101861734 | 106 |
| 495 | 3300025931 | Ga0207644_10600633 | Ga0207644_106006331 | 106 |
| 496 | 3300025932 | Ga0207690_10220436 | Ga0207690_102204361 | 106 |
| 497 | 3300025932 | Ga0207690_10320013 | Ga0207690_103200131 | 106 |
| 498 | 3300025932 | Ga0207690_10401022 | Ga0207690_104010223 | 106 |
| 499 | 3300025932 | Ga0207690_10619021 | Ga0207690_106190212 | 106 |
| 500 | 3300025933 | Ga0207706_10000044 | Ga0207706_1000004429 | 106 |
| 501 | 3300025933 | Ga0207706_10020437 | Ga0207706_100204371 | 106 |
| 502 | 3300025934 | Ga0207686_10082882 | Ga0207686_100828823 | 106 |
| 503 | 3300025937 | Ga0207669_11404192 | Ga0207669_114041922 | 106 |
| 504 | 3300025938 | Ga0207704_10000061 | Ga0207704_1000006145 | 106 |
| 505 | 3300025939 | Ga0207665_10693511 | Ga0207665_106935111 | 106 |
| 506 | 3300025940 | Ga0207691_10009816 | Ga0207691_100098167 | 106 |
| 507 | 3300025940 | Ga0207691_10195375 | Ga0207691_101953752 | 106 |
| 508 | 3300025940 | Ga0207691_10240574 | Ga0207691_102405743 | 106 |
| 509 | 3300025941 | Ga0207711_11112052 | Ga0207711_111120521 | 106 |
| 510 | 3300025942 | Ga0207689_10064946 | Ga0207689_100649462 | 106 |
| 511 | 3300025942 | Ga0207689_10095465 | Ga0207689_100954652 | 106 |
| 512 | 3300025942 | Ga0207689_10164130 | Ga0207689_101641304 | 106 |
| 513 | 3300025942 | Ga0207689_10350892 | Ga0207689_103508922 | 106 |
| 514 | 3300025942 | Ga0207689_10356690 | Ga0207689_103566902 | 106 |
| 515 | 3300025944 | Ga0207661_10656543 | Ga0207661_106565431 | 106 |
| 516 | 3300025945 | Ga0207679_10267921 | Ga0207679_102679213 | 106 |
| 517 | 3300025945 | Ga0207679_10670249 | Ga0207679_106702491 | 106 |
| 518 | 3300025945 | Ga0207679_11258831 | Ga0207679_112588311 | 106 |
| 519 | 3300025949 | Ga0207667_10081641 | Ga0207667_100816415 | 106 |
| 520 | 3300025949 | Ga0207667_10129790 | Ga0207667_101297903 | 106 |
| 521 | 3300025949 | Ga0207667_10187634 | Ga0207667_101876342 | 106 |
| 522 | 3300025949 | Ga0207667_10798120 | Ga0207667_107981201 | 106 |
| 523 | 3300025949 | Ga0207667_11339039 | Ga0207667_113390391 | 106 |
| 524 | 3300025960 | Ga0207651_10004446 | Ga0207651_100044464 | 106 |
| 525 | 3300025960 | Ga0207651_10689755 | Ga0207651_106897551 | 106 |
| 526 | 3300025961 | Ga0207712_10065033 | Ga0207712_100650333 | 106 |
| 527 | 3300025961 | Ga0207712_10114889 | Ga0207712_101148893 | 106 |
| 528 | 3300025961 | Ga0207712_10196649 | Ga0207712_101966493 | 106 |
| 529 | 3300025961 | Ga0207712_10449328 | Ga0207712_104493283 | 106 |
| 530 | 3300025961 | Ga0207712_12000853 | Ga0207712_120008531 | 106 |
| 531 | 3300025972 | Ga0207668_11703580 | Ga0207668_117035801 | 106 |
| 532 | 3300025972 | Ga0207668_11836933 | Ga0207668_118369332 | 106 |
| 533 | 3300025972 | Ga0207668_11994339 | Ga0207668_119943392 | 106 |
| 534 | 3300025981 | Ga0207640_10072546 | Ga0207640_100725465 | 106 |
| 535 | 3300025981 | Ga0207640_10628518 | Ga0207640_106285182 | 106 |
| 536 | 3300025986 | Ga0207658_10067979 | Ga0207658_100679793 | 106 |
| 537 | 3300025986 | Ga0207658_10154262 | Ga0207658_101542623 | 106 |
| 538 | 3300025986 | Ga0207658_10303417 | Ga0207658_103034172 | 106 |
| 539 | 3300025986 | Ga0207658_10390442 | Ga0207658_103904423 | 106 |
| 540 | 3300025986 | Ga0207658_11345465 | Ga0207658_113454652 | 106 |
| 541 | 3300025986 | Ga0207658_11621991 | Ga0207658_116219911 | 106 |
| 542 | 3300025986 | Ga0207658_11873631 | Ga0207658_118736311 | 106 |
| 543 | 3300026023 | Ga0207677_10037202 | Ga0207677_100372026 | 106 |
| 544 | 3300026023 | Ga0207677_10057504 | Ga0207677_100575042 | 106 |
| 545 | 3300026023 | Ga0207677_10077911 | Ga0207677_100779112 | 106 |
| 546 | 3300026035 | Ga0207703_10006254 | Ga0207703_100062549 | 106 |
| 547 | 3300026035 | Ga0207703_10331355 | Ga0207703_103313553 | 106 |
| 548 | 3300026035 | Ga0207703_10484819 | Ga0207703_104848192 | 106 |
| 549 | 3300026035 | Ga0207703_10786046 | Ga0207703_107860462 | 106 |
| 550 | 3300026035 | Ga0207703_10926305 | Ga0207703_109263052 | 106 |
| 551 | 3300026035 | Ga0207703_11666769 | Ga0207703_116667692 | 106 |
| 552 | 3300026035 | Ga0207703_11719022 | Ga0207703_117190222 | 106 |
| 553 | 3300026035 | Ga0207703_11837569 | Ga0207703_118375691 | 106 |
| 554 | 3300026035 | Ga0207703_12207335 | Ga0207703_122073351 | 106 |
| 555 | 3300026041 | Ga0207639_10010963 | Ga0207639_100109638 | 106 |
| 556 | 3300026041 | Ga0207639_10012012 | Ga0207639_100120125 | 106 |
| 557 | 3300026041 | Ga0207639_10115885 | Ga0207639_101158852 | 106 |
| 558 | 3300026041 | Ga0207639_10166030 | Ga0207639_101660301 | 106 |
| 559 | 3300026041 | Ga0207639_10329602 | Ga0207639_103296023 | 106 |
| 560 | 3300026041 | Ga0207639_10331843 | Ga0207639_103318432 | 106 |
| 561 | 3300026067 | Ga0207678_11809054 | Ga0207678_118090542 | 106 |
| 562 | 3300026075 | Ga0207708_10079070 | Ga0207708_100790703 | 106 |
| 563 | 3300026075 | Ga0207708_11173679 | Ga0207708_111736791 | 106 |
| 564 | 3300026075 | Ga0207708_11552873 | Ga0207708_115528732 | 106 |
| 565 | 3300026075 | Ga0207708_11909248 | Ga0207708_119092481 | 106 |
| 566 | 3300026078 | Ga0207702_11095342 | Ga0207702_110953421 | 106 |
| 567 | 3300026078 | Ga0207702_12052422 | Ga0207702_120524222 | 106 |
| 568 | 3300026088 | Ga0207641_10005736 | Ga0207641_100057362 | 106 |
| 569 | 3300026088 | Ga0207641_12612183 | Ga0207641_126121831 | 106 |
| 570 | 3300026089 | Ga0207648_10002338 | Ga0207648_1000233813 | 106 |
| 571 | 3300026089 | Ga0207648_10052614 | Ga0207648_100526145 | 106 |
| 572 | 3300026089 | Ga0207648_10286460 | Ga0207648_102864602 | 106 |
| 573 | 3300026089 | Ga0207648_11950885 | Ga0207648_119508852 | 106 |
| 574 | 3300026095 | Ga0207676_10004483 | Ga0207676_100044839 | 106 |
| 575 | 3300026095 | Ga0207676_11291134 | Ga0207676_112911341 | 106 |
| 576 | 3300026116 | Ga0207674_10023607 | Ga0207674_100236071 | 106 |
| 577 | 3300026116 | Ga0207674_10156717 | Ga0207674_101567174 | 106 |
| 578 | 3300026116 | Ga0207674_10353023 | Ga0207674_103530233 | 106 |
| 579 | 3300026116 | Ga0207674_10497460 | Ga0207674_104974601 | 106 |
| 580 | 3300026116 | Ga0207674_11042722 | Ga0207674_110427221 | 106 |
| 581 | 3300026118 | Ga0207675_100339515 | Ga0207675_1003395153 | 106 |
| 582 | 3300026118 | Ga0207675_100937586 | Ga0207675_1009375862 | 106 |
| 583 | 3300026118 | Ga0207675_101417037 | Ga0207675_1014170372 | 106 |
| 584 | 3300026118 | Ga0207675_101789605 | Ga0207675_1017896052 | 106 |
| 585 | 3300026121 | Ga0207683_10031283 | Ga0207683_100312832 | 106 |
| 586 | 3300026121 | Ga0207683_10215435 | Ga0207683_102154354 | 106 |
| 587 | 3300026121 | Ga0207683_10613569 | Ga0207683_106135692 | 106 |
| 588 | 3300026142 | Ga0207698_10121920 | Ga0207698_101219202 | 106 |
| 589 | 3300026142 | Ga0207698_10820847 | Ga0207698_108208471 | 106 |
| 590 | 3300026142 | Ga0207698_10834298 | Ga0207698_108342982 | 106 |
| 591 | 3300026142 | Ga0207698_10910885 | Ga0207698_109108852 | 106 |
| 592 | 3300026142 | Ga0207698_12099353 | Ga0207698_120993532 | 106 |
| 593 | 3300028379 | Ga0268266_10000132 | Ga0268266_1000013253 | 106 |
| 594 | 3300028379 | Ga0268266_10637558 | Ga0268266_106375581 | 106 |
| 595 | 3300028380 | Ga0268265_10013493 | Ga0268265_100134931 | 106 |
| 596 | 3300028380 | Ga0268265_11442638 | Ga0268265_114426381 | 106 |
| 597 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015312 | 106 |
| 598 | 3300028381 | Ga0268264_10383701 | Ga0268264_103837011 | 106 |
| 599 | 3300028381 | Ga0268264_10945203 | Ga0268264_109452031 | 106 |
| 600 | 3300028381 | Ga0268264_11342442 | Ga0268264_113424422 | 106 |
| 601 | 3300028573 | Ga0265334_10159572 | Ga0265334_101595722 | 106 |
| 602 | 3300028653 | Ga0265323_10000512 | Ga0265323_100005129 | 106 |
| 603 | 3300028786 | Ga0307517_10007381 | Ga0307517_100073816 | 106 |
| 604 | 3300028794 | Ga0307515_10064321 | Ga0307515_100643212 | 106 |
| 605 | 3300028800 | Ga0265338_10084234 | Ga0265338_100842343 | 106 |
| 606 | 3300028800 | Ga0265338_10517135 | Ga0265338_105171351 | 106 |
| 607 | 3300030744 | Ga0316181_1087376 | Ga0316181_10873762 | 106 |
| 608 | 3300031235 | Ga0265330_10104767 | Ga0265330_101047671 | 106 |
| 609 | 3300031251 | Ga0265327_10000055 | Ga0265327_1000005525 | 106 |
| 610 | 3300031251 | Ga0265327_10064368 | Ga0265327_100643681 | 106 |
| 611 | 3300031251 | Ga0265327_10070414 | Ga0265327_100704141 | 106 |
| 612 | 3300031344 | Ga0265316_10001184 | Ga0265316_1000118417 | 106 |
| 613 | 3300031507 | Ga0307509_10228133 | Ga0307509_102281333 | 106 |
| 614 | 3300031507 | Ga0307509_10420174 | Ga0307509_104201743 | 106 |
| 615 | 3300031507 | Ga0307509_10492518 | Ga0307509_104925182 | 106 |
| 616 | 3300031711 | Ga0265314_10046768 | Ga0265314_100467684 | 106 |
| 617 | 3300031852 | Ga0307410_11479517 | Ga0307410_114795171 | 106 |
| 618 | 3300031901 | Ga0307406_10611011 | Ga0307406_106110112 | 106 |
| 619 | 3300031911 | Ga0307412_11208901 | Ga0307412_112089012 | 106 |
| 620 | 3300031911 | Ga0307412_12098833 | Ga0307412_120988331 | 106 |
| 621 | 3300031995 | Ga0307409_101429972 | Ga0307409_1014299721 | 106 |
| 622 | 3300032002 | Ga0307416_100224981 | Ga0307416_1002249814 | 106 |
| 623 | 3300032002 | Ga0307416_101593428 | Ga0307416_1015934282 | 106 |
| 624 | 3300032004 | Ga0307414_10084723 | Ga0307414_100847232 | 106 |
| 625 | 3300032004 | Ga0307414_10286507 | Ga0307414_102865072 | 106 |
| 626 | 3300032005 | Ga0307411_11966865 | Ga0307411_119668652 | 106 |
| 627 | 3300033180 | Ga0307510_10013796 | Ga0307510_100137967 | 106 |
| 628 | 3300035113 | Ga0373936_0230431 | Ga0373936_0230431_426_749 | 106 |
| 629 | 3300035114 | Ga0373939_0215478 | Ga0373939_0215478_324_644 | 106 |
| 630 | 3300035115 | Ga0373941_0232872 | Ga0373941_0232872_203_526 | 106 |
| 631 | 3300037312 | Ga0395899_0000021 | Ga0395899_0000021_223364_223684 | 106 |
| 632 | 3300037312 | Ga0395899_0009228 | Ga0395899_0009228_5582_5905 | 106 |
| 633 | 3300037312 | Ga0395899_0026616 | Ga0395899_0026616_1750_2073 | 106 |
| 634 | 3300037418 | Ga0395900_0000494 | Ga0395900_0000494_4944_5267 | 106 |
| 635 | 3300037418 | Ga0395900_0003517 | Ga0395900_0003517_15745_16065 | 106 |
| 636 | 3300037418 | Ga0395900_0004982 | Ga0395900_0004982_6399_6722 | 106 |
| 637 | 3300037418 | Ga0395900_0279390 | Ga0395900_0279390_463_783 | 106 |
| 638 | 3300037466 | Ga0395898_0004102 | Ga0395898_0004102_11411_11731 | 106 |
| 639 | 3300037466 | Ga0395898_0080656 | Ga0395898_0080656_203_526 | 106 |
| 640 | 3300037471 | Ga0395905_0000757 | Ga0395905_0000757_24133_24456 | 106 |
| 641 | 3300037471 | Ga0395905_0004960 | Ga0395905_0004960_10727_11050 | 106 |
| 642 | 3300037471 | Ga0395905_0017163 | Ga0395905_0017163_5468_5788 | 106 |
| 643 | 3300037471 | Ga0395905_0485689 | Ga0395905_0485689_168_491 | 106 |
| 644 | 3300038443 | Ga0395901_0002107 | Ga0395901_0002107_19039_19362 | 106 |
| 645 | 3300038443 | Ga0395901_0003012 | Ga0395901_0003012_11294_11617 | 106 |
| 646 | 3300038443 | Ga0395901_0021304 | Ga0395901_0021304_2973_3293 | 106 |
| 647 | 3300039437 | Ga0436365_1664331 | Ga0436365_1664331_11018_11341 | 106 |
| 648 | 3300039447 | Ga0436361_0635236 | Ga0436361_0635236_3070_3399 | 106 |
| 649 | 3300041406 | Ga0439439_0214470 | Ga0439439_0214470_109_432 | 106 |
| 650 | 3300041411 | Ga0439466_0139579 | Ga0439466_0139579_137_484 | 106 |
| 651 | 3300041452 | Ga0451793_0462005 | Ga0451793_0462005_32_352 | 106 |
| 652 | 3300041463 | Ga0451804_0543671 | Ga0451804_0543671_81_404 | 106 |
| 653 | 3300041486 | Ga0451807_1973634 | Ga0451807_1973634_107_430 | 106 |
| 654 | 3300041491 | Ga0451833_0971787 | Ga0451833_0971787_159_485 | 106 |
| 655 | 3300041494 | Ga0451837_0256521 | Ga0451837_0256521_165_488 | 106 |
| 656 | 3300041498 | Ga0451841_1049833 | Ga0451841_1049833_55_375 | 106 |
| 657 | 3300041501 | Ga0451845_0572086 | Ga0451845_0572086_118_450 | 106 |
| 658 | 3300041507 | Ga0451851_0947342 | Ga0451851_0947342_53_376 | 106 |
| 659 | 3300041507 | Ga0451851_1259567 | Ga0451851_1259567_181_501 | 106 |
| 660 | 3300041512 | Ga0451853_0174956 | Ga0451853_0174956_612_938 | 106 |
| 661 | 3300042002 | Ga0439442_026011 | Ga0439442_026011_63_386 | 106 |
| 662 | 3300042006 | Ga0439432_128270 | Ga0439432_128270_337_684 | 106 |
| 663 | 3300042007 | Ga0439449_0126557 | Ga0439449_0126557_246_569 | 106 |
| 664 | 3300042014 | Ga0439457_044691 | Ga0439457_044691_174_521 | 106 |
| 665 | 3300042128 | Ga0450897_050347 | Ga0450897_050347_71_418 | 106 |
| 666 | 3300042134 | Ga0450898_005402 | Ga0450898_005402_107_454 | 106 |
| 667 | 3300042135 | Ga0450899_009235 | Ga0450899_009235_483_830 | 106 |
| 668 | 3300042876 | Ga0451577_0023194 | Ga0451577_0023194_4591_4917 | 106 |
| 669 | 3300044658 | Ga0466972_0301302 | Ga0466972_0301302_367_693 | 106 |
| 670 | 3300044658 | Ga0466972_0554611 | Ga0466972_0554611_44_382 | 106 |
| 671 | 3300044712 | Ga0453684_0002051 | Ga0453684_0002051_17170_17496 | 106 |
| 672 | 3300044712 | Ga0453684_0055025 | Ga0453684_0055025_3575_3898 | 106 |
| 673 | 3300044765 | Ga0466970_0128696 | Ga0466970_0128696_738_1064 | 106 |
| 674 | 3300045049 | Ga0466959_0018495 | Ga0466959_0018495_465_788 | 106 |
| 675 | 3300045049 | Ga0466959_0288998 | Ga0466959_0288998_391_714 | 106 |
| 676 | 3300045051 | Ga0451576_0015476 | Ga0451576_0015476_5931_6257 | 106 |
| 677 | 3300045051 | Ga0451576_0189687 | Ga0451576_0189687_1159_1479 | 106 |
| 678 | 3300045051 | Ga0451576_2609771 | Ga0451576_2609771_124_447 | 106 |
| 679 | 3300045836 | Ga0466958_0386462 | Ga0466958_0386462_310_633 | 106 |
| 680 | 3300046460 | Ga0495638_0000008 | Ga0495638_0000008_129276_129608 | 106 |
| 681 | 3300046460 | Ga0495638_0414301 | Ga0495638_0414301_358_681 | 106 |
| 682 | 3300046462 | Ga0495651_0468027 | Ga0495651_0468027_23_343 | 106 |
| 683 | 3300046471 | Ga0495650_0019537 | Ga0495650_0019537_1522_1845 | 106 |
| 684 | 3300046507 | Ga0495606_0058371 | Ga0495606_0058371_1836_2159 | 106 |
| 685 | 3300046514 | Ga0495618_0850045 | Ga0495618_0850045_132_455 | 106 |
| 686 | 3300046523 | Ga0495644_0096453 | Ga0495644_0096453_83_403 | 106 |
| 687 | 3300046529 | Ga0495652_0901129 | Ga0495652_0901129_190_513 | 106 |
| 688 | 3300046557 | Ga0495622_0211461 | Ga0495622_0211461_203_523 | 106 |
| 689 | 3300046616 | Ga0495668_0001373 | Ga0495668_0001373_11155_11478 | 106 |
| 690 | 3300046642 | Ga0495634_0502991 | Ga0495634_0502991_103_453 | 106 |
| 691 | 3300046648 | Ga0495611_0120339 | Ga0495611_0120339_154_477 | 106 |
| 692 | 3300046660 | Ga0495625_0118844 | Ga0495625_0118844_604_927 | 106 |
| 693 | 3300046665 | Ga0495661_0612527 | Ga0495661_0612527_118_441 | 106 |
| 694 | 3300046683 | Ga0495658_0945769 | Ga0495658_0945769_158_481 | 106 |
| 695 | 3300047315 | Ga0495581_0903691 | Ga0495581_0903691_78_407 | 106 |
| 696 | 3300047319 | Ga0495674_1254327 | Ga0495674_1254327_224_547 | 106 |
| 697 | 3300047320 | Ga0495672_0008239 | Ga0495672_0008239_2755_3078 | 106 |
| 698 | 3300047447 | Ga0495685_090765 | Ga0495685_090765_644_967 | 106 |
| 699 | 3300047472 | Ga0495686_0001370 | Ga0495686_0001370_24611_24931 | 106 |
| 700 | 3300048911 | Ga0496108_0707060 | Ga0496108_0707060_461_784 | 106 |
| 701 | 3300048918 | Ga0496115_0926906 | Ga0496115_0926906_292_615 | 106 |
| 702 | 3300048925 | Ga0496122_0006972 | Ga0496122_0006972_2135_2455 | 106 |
| 703 | 3300048926 | Ga0496123_0028687 | Ga0496123_0028687_3337_3657 | 106 |
| 704 | 3300048928 | Ga0496125_0028469 | Ga0496125_0028469_2563_2883 | 106 |
| 705 | 3300049571 | Ga0501034_0138376 | Ga0501034_0138376_404_727 | 106 |
| 706 | 3300049574 | Ga0501038_0090718 | Ga0501038_0090718_1490_1813 | 106 |
| 707 | 3300049575 | Ga0501039_0375002 | Ga0501039_0375002_457_780 | 106 |
| 708 | 3300049579 | Ga0501043_0311516 | Ga0501043_0311516_568_891 | 106 |
| 709 | 3300049589 | Ga0501073_0820270 | Ga0501073_0820270_265_591 | 106 |
| 710 | 3300049649 | Ga0501198_105283 | Ga0501198_105283_45_365 | 106 |
| 711 | 3300049659 | Ga0501214_042452 | Ga0501214_042452_172_492 | 106 |
| 712 | 3300049661 | Ga0501217_164696 | Ga0501217_164696_319_639 | 106 |
| 713 | 3300049663 | Ga0501223_028400 | Ga0501223_028400_723_1043 | 106 |
| 714 | 3300049664 | Ga0501224_042369 | Ga0501224_042369_185_505 | 106 |
| 715 | 3300049668 | Ga0501233_148642 | Ga0501233_148642_275_595 | 106 |
| 716 | 3300049671 | Ga0501238_033146 | Ga0501238_033146_35_358 | 106 |
| 717 | 3300049680 | Ga0501250_060581 | Ga0501250_060581_151_471 | 106 |
| 718 | 3300049686 | Ga0501257_022697 | Ga0501257_022697_573_893 | 106 |
| 719 | 3300049704 | Ga0501221_128947 | Ga0501221_128947_110_430 | 106 |
| 720 | 3300049707 | Ga0501234_052612 | Ga0501234_052612_342_662 | 106 |
| 721 | 3300049823 | Ga0501044_0205041 | Ga0501044_0205041_787_1110 | 106 |
| 722 | 3300050493 | nmdc:mga0k408_116299_c1 | nmdc:mga0k408_116299_c1_431_760 | 106 |
| 723 | 3300050496 | nmdc:mga07m45_168367_c1 | nmdc:mga07m45_168367_c1_137_463 | 106 |
| 724 | 3300050511 | nmdc:mga08y16_945191_c1 | nmdc:mga08y16_945191_c1_242_565 | 106 |
| 725 | 3300050511 | nmdc:mga08y16_97154_c1 | nmdc:mga08y16_97154_c1_160_513 | 106 |
| 726 | 3300053080 | Ga0500635_0000568 | Ga0500635_0000568_5285_5605 | 106 |
| 727 | 3300053086 | Ga0500578_0000024 | Ga0500578_0000024_68332_68652 | 106 |
| 728 | 3300053086 | Ga0500578_0295929 | Ga0500578_0295929_516_836 | 106 |
| 729 | 3300053088 | Ga0500644_0000169 | Ga0500644_0000169_34465_34785 | 106 |
| 730 | 3300053088 | Ga0500644_0084978 | Ga0500644_0084978_402_728 | 106 |
| 731 | 3300053089 | Ga0500581_213282 | Ga0500581_213282_161_484 | 106 |
| 732 | 3300053089 | Ga0500581_237668 | Ga0500581_237668_347_670 | 106 |
| 733 | 3300053091 | Ga0500647_0179297 | Ga0500647_0179297_617_940 | 106 |
| 734 | 3300053092 | Ga0500583_0506470 | Ga0500583_0506470_144_464 | 106 |
| 735 | 3300053098 | Ga0500650_0176658 | Ga0500650_0176658_307_639 | 106 |
| 736 | 3300053108 | Ga0500562_000078 | Ga0500562_000078_80_403 | 106 |
| 737 | 3300053116 | Ga0500592_068298 | Ga0500592_068298_107_427 | 106 |
| 738 | 3300053121 | Ga0500607_025589 | Ga0500607_025589_1037_1357 | 106 |
| 739 | 3300053122 | Ga0500608_095814 | Ga0500608_095814_287_610 | 106 |
| 740 | 3300053125 | Ga0500618_000004 | Ga0500618_000004_155435_155758 | 106 |
| 741 | 3300053130 | Ga0500642_0146371 | Ga0500642_0146371_738_1064 | 106 |
| 742 | 3300053139 | Ga0500568_0028977 | Ga0500568_0028977_697_1020 | 106 |
| 743 | 3300053139 | Ga0500568_0240949 | Ga0500568_0240949_20_343 | 106 |
| 744 | 3300053148 | Ga0500590_092581 | Ga0500590_092581_496_816 | 106 |
| 745 | 3300053153 | Ga0500616_0000003 | Ga0500616_0000003_408551_408883 | 106 |
| 746 | 3300053153 | Ga0500616_0004260 | Ga0500616_0004260_7654_7977 | 106 |
| 747 | 3300053153 | Ga0500616_0012071 | Ga0500616_0012071_2537_2863 | 106 |
| 748 | 3300053153 | Ga0500616_0102737 | Ga0500616_0102737_539_859 | 106 |
| 749 | 3300053153 | Ga0500616_0146391 | Ga0500616_0146391_660_983 | 106 |
| 750 | 3300053153 | Ga0500616_0219205 | Ga0500616_0219205_376_696 | 106 |
| 751 | 3300053156 | Ga0500622_0000870 | Ga0500622_0000870_22939_23262 | 106 |
| 752 | 3300053156 | Ga0500622_0001076 | Ga0500622_0001076_18314_18640 | 106 |
| 753 | 3300053156 | Ga0500622_0243796 | Ga0500622_0243796_46_378 | 106 |
| 754 | 3300053160 | Ga0500633_0003460 | Ga0500633_0003460_2049_2369 | 106 |
| 755 | 3300053161 | Ga0500634_0050744 | Ga0500634_0050744_1251_1571 | 106 |
| 756 | 3300053730 | Ga0500645_020997 | Ga0500645_020997_666_989 | 106 |
| 757 | 3300053730 | Ga0500645_143683 | Ga0500645_143683_215_538 | 106 |
| 758 | 3300053733 | Ga0500552_034013 | Ga0500552_034013_251_574 | 106 |
| 759 | 3300061719 | Ga0466962_0058515 | Ga0466962_0058515_1131_1454 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j0e-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9358 | 6 | 79 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9319 | 8 | 88 |
| 6j05-assembly1.cif.gz_B | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.924 | 8 | 82 |
| 6j05-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9156 | 8 | 82 |
| 6j0e-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9151 | 6 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXF7_1_94_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9838 | 8 | 83 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9573 | 13 | 69 | 1.10.10.10 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9428 | 8 | 84 | 1.10.10.10 |
| af_P71941_17_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.941 | 8 | 80 | 1.10.10.10 |
| af_B4FTK6_47_112_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9257 | 13 | 70 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524QVP0-F1-model_v4 | ArsR family transcriptional regulator | 0.9872 | 8 | 79 |
GO:0003700
|
| AF-Q9A415-F1-model_v4 | Transcriptional regulator, ArsR family | 0.979 | 7 | 88 |
GO:0003700
|
| AF-A0A6N4EDV7-F1-model_v4 | deleted | 0.9788 | 1 | 78 |
|
| AF-A0A147DX53-F1-model_v4 | deleted | 0.9762 | 7 | 85 |
|
| AF-A0A089HR62-F1-model_v4 | ArsR family transcriptional regulator | 0.9748 | 8 | 86 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar