F479474

General Info

Members Datasets Scaffolds Average Seq Length
759 321 756 107

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100621735|Ga0068858_1006217351
Length 129
Sequence MKSFGCACNPQPIHCIILIQIMRRDIFQAIADPTRRAIIALIAVQAMTPNALAEHFDTSRQAVSKHLQILTECELVTQEQKGREIYYSLEIEKMKEIDKWLEQYRKIWETRLNQLDDLLATIKKQEKEK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
3 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
199 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
230 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
231 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
237 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
238 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
239 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
240 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
241 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
242 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
243 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
246 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
247 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
285 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
286 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
287 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
288 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
291 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
292 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
293 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
294 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
303 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
308 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
309 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
310 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
311 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
314 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
317 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
318 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
319 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
320 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.43
Nodule 0
Rhizoplane 0.79
Rhizosphere 86.69
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
2 JGI24743J22301_10037794 3300001991 Bacteria 963
3 JGI25162J39368_1000881 3300002737 Bacteria 19655
4 JGI25152J39213_1050914 3300002773 Bacteria 540
5 JGI25153J46596_10011436 3300003215 Bacteria 3922
6 rootH1_10040117 3300003316 Bacteria 2024
7 rootH2_10009258 3300003320 Bacteria 6636
8 rootH2_10075751 3300003320 Bacteria 2014
9 rootH2_10148392 3300003320 Bacteria 5085
10 rootL2_10228164 3300003322 Bacteria 1451
11 rootH1_10041130 3300003323 Bacteria 1110
12 rootH1_10121882 3300003323 Bacteria 11580
13 JGI25160J50197_1002465 3300003354 Bacteria 8610
14 Ga0055535_1002560 3300003761 Bacteria 6142
15 Ga0055542_1015957 3300003762 Bacteria 1194
16 Ga0055526_1007155 3300003771 Bacteria 5876
17 Ga0055526_1013227 3300003771 Bacteria 3510
18 Ga0055528_1000314 3300003790 Bacteria 40742
19 Ga0055530_10000619 3300003791 Bacteria 30885
20 Ga0055531_10048271 3300003794 Bacteria 1150
21 Ga0055543_1014328 3300004625 Bacteria 1547
22 Ga0065165_1000182 3300005262 Bacteria 110108
23 Ga0065704_10000195 3300005289 Bacteria 195830
24 Ga0065704_10074748 3300005289 Bacteria 6041
25 Ga0065704_10077797 3300005289 Bacteria 4616
26 Ga0065704_10409115 3300005289 Bacteria 733
27 Ga0065712_10101133 3300005290 Bacteria 2007
28 Ga0065707_10023401 3300005295 Unclassified 1221
29 Ga0070658_10004280 3300005327 Bacteria 11663
30 Ga0070658_10020569 3300005327 Bacteria 5290
31 Ga0070658_10070911 3300005327 Bacteria 2853
32 Ga0070658_10503165 3300005327 Bacteria 1047
33 Ga0070658_11923110 3300005327 Bacteria 511
34 Ga0070676_10000015 3300005328 Bacteria 52703
35 Ga0070676_10025476 3300005328 Bacteria 3343
36 Ga0070676_10180861 3300005328 Bacteria 1371
37 Ga0070670_100070797 3300005331 Bacteria 2994
38 Ga0070670_101463292 3300005331 Bacteria 627
39 Ga0070670_101972507 3300005331 Bacteria 538
40 Ga0070677_10234154 3300005333 Bacteria 904
41 Ga0068869_100079027 3300005334 Bacteria 2451
42 Ga0068869_100079473 3300005334 Bacteria 2444
43 Ga0068869_100132816 3300005334 Bacteria 1915
44 Ga0068869_100312382 3300005334 Bacteria 1272
45 Ga0068869_100434166 3300005334 Bacteria 1086
46 Ga0068869_100820125 3300005334 Bacteria 801
47 Ga0070666_10000042 3300005335 Bacteria 112296
48 Ga0070666_10026174 3300005335 Bacteria 3808
49 Ga0070666_10581194 3300005335 Bacteria 816
50 Ga0070666_11103400 3300005335 Bacteria 590
51 Ga0070680_100003917 3300005336 Bacteria 11128
52 Ga0070680_100035400 3300005336 Bacteria 4030
53 Ga0068868_100012254 3300005338 Bacteria 6263
54 Ga0068868_100060336 3300005338 Bacteria 3003
55 Ga0068868_100120710 3300005338 Bacteria 2138
56 Ga0068868_100367921 3300005338 Bacteria 1235
57 Ga0068868_101268854 3300005338 Bacteria 683
58 Ga0070660_100028681 3300005339 Bacteria 4166
59 Ga0070660_100044533 3300005339 Bacteria 3395
60 Ga0070660_100169934 3300005339 Bacteria 1760
61 Ga0070660_100432358 3300005339 Bacteria 1091
62 Ga0070660_100588345 3300005339 Bacteria 930
63 Ga0070660_101461093 3300005339 Bacteria 581
64 Ga0070689_100747958 3300005340 Bacteria 857
65 Ga0070691_10110364 3300005341 Bacteria 1375
66 Ga0070687_100131270 3300005343 Bacteria 1447
67 Ga0070661_101832669 3300005344 Bacteria 515
68 Ga0070692_10516515 3300005345 Bacteria 777
69 Ga0070669_100029435 3300005353 Bacteria 3958
70 Ga0070675_100208280 3300005354 Bacteria 1699
71 Ga0070675_100709224 3300005354 Bacteria 917
72 Ga0070675_100969052 3300005354 Bacteria 780
73 Ga0070671_100062516 3300005355 Bacteria 3100
74 Ga0070671_100213561 3300005355 Bacteria 1636
75 Ga0070671_101423470 3300005355 Bacteria 613
76 Ga0070674_101515989 3300005356 Bacteria 603
77 Ga0070674_101552583 3300005356 Bacteria 596
78 Ga0070673_100008611 3300005364 Bacteria 6794
79 Ga0070673_100399007 3300005364 Bacteria 1229
80 Ga0070673_100578329 3300005364 Bacteria 1023
81 Ga0070688_100087821 3300005365 Bacteria 2026
82 Ga0070688_100281550 3300005365 Bacteria 1195
83 Ga0070659_100077889 3300005366 Bacteria 2644
84 Ga0070659_100228350 3300005366 Bacteria 1538
85 Ga0070659_100521248 3300005366 Bacteria 1015
86 Ga0070659_100672469 3300005366 Bacteria 894
87 Ga0070667_100287451 3300005367 Bacteria 1478
88 Ga0070667_100502390 3300005367 Bacteria 1112
89 Ga0070667_100636892 3300005367 Bacteria 984
90 Ga0070667_100674097 3300005367 Bacteria 956
91 Ga0070667_100830050 3300005367 Bacteria 859
92 Ga0070667_101093882 3300005367 Bacteria 745
93 Ga0070667_101094853 3300005367 Bacteria 745
94 Ga0070667_102231714 3300005367 Bacteria 516
95 Ga0070714_100946217 3300005435 Bacteria 837
96 Ga0070701_10088579 3300005438 Bacteria 1691
97 Ga0070701_10164206 3300005438 Bacteria 1289
98 Ga0070701_10194353 3300005438 Bacteria 1196
99 Ga0070700_100047956 3300005441 Bacteria 2646
100 Ga0070700_100059909 3300005441 Bacteria 2398
101 Ga0070708_100520848 3300005445 Unclassified 1121
102 Ga0070678_100007585 3300005456 Bacteria 6443
103 Ga0070678_100436965 3300005456 Bacteria 1144
104 Ga0070678_101047122 3300005456 Bacteria 752
105 Ga0070678_101199434 3300005456 Bacteria 704
106 Ga0070662_100000020 3300005457 Bacteria 99425
107 Ga0070662_100127121 3300005457 Bacteria 1961
108 Ga0070681_10066604 3300005458 Bacteria 3570
109 Ga0070681_10178869 3300005458 Bacteria 2043
110 Ga0070681_10329484 3300005458 Bacteria 1436
111 Ga0070681_10789987 3300005458 Bacteria 866
112 Ga0068867_100005742 3300005459 Bacteria 8803
113 Ga0068867_100015064 3300005459 Bacteria 5483
114 Ga0068867_100034465 3300005459 Bacteria 3669
115 Ga0068867_100270581 3300005459 Bacteria 1389
116 Ga0068867_101069628 3300005459 Bacteria 735
117 Ga0068867_102256935 3300005459 Bacteria 517
118 Ga0070685_10375181 3300005466 Bacteria 979
119 Ga0070685_10731758 3300005466 Bacteria 724
120 Ga0070685_11462197 3300005466 Bacteria 526
121 Ga0070698_100000282 3300005471 Bacteria 51827
122 Ga0070698_100045076 3300005471 Bacteria 4514
123 Ga0070698_100075760 3300005471 Bacteria 3368
124 Ga0070679_100121395 3300005530 Bacteria 2598
125 Ga0070679_101000312 3300005530 Bacteria 780
126 Ga0070684_101435525 3300005535 Unclassified 650
127 Ga0070697_100051518 3300005536 Unclassified 3344
128 Ga0068853_100024000 3300005539 Bacteria 5111
129 Ga0068853_100025264 3300005539 Bacteria 4984
130 Ga0068853_100056937 3300005539 Bacteria 3372
131 Ga0068853_100071038 3300005539 Bacteria 3031
132 Ga0068853_100627999 3300005539 Bacteria 1021
133 Ga0068853_100661437 3300005539 Bacteria 995
134 Ga0068853_100935982 3300005539 Bacteria 833
135 Ga0068853_101555170 3300005539 Bacteria 641
136 Ga0068853_101860645 3300005539 Bacteria 584
137 Ga0070672_100218129 3300005543 Bacteria 1599
138 Ga0070672_100379391 3300005543 Bacteria 1209
139 Ga0070672_100511937 3300005543 Bacteria 1039
140 Ga0070672_101942610 3300005543 Bacteria 530
141 Ga0070686_100061045 3300005544 Bacteria 2434
142 Ga0070695_100813774 3300005545 Bacteria 749
143 Ga0070665_100000125 3300005548 Bacteria 146809
144 Ga0070704_100517376 3300005549 Bacteria 1038
145 Ga0068855_100068805 3300005563 Bacteria 4121
146 Ga0068855_100102831 3300005563 Bacteria 3288
147 Ga0068855_100127897 3300005563 Bacteria 2903
148 Ga0068855_100354440 3300005563 Bacteria 1616
149 Ga0068855_100443475 3300005563 Bacteria 1417
150 Ga0068855_100527701 3300005563 Bacteria 1280
151 Ga0068855_100820970 3300005563 Bacteria 987
152 Ga0068855_100840388 3300005563 Bacteria 974
153 Ga0068855_100951509 3300005563 Bacteria 905
154 Ga0068855_101322690 3300005563 Bacteria 745
155 Ga0070664_100001016 3300005564 Bacteria 22026
156 Ga0070664_100723412 3300005564 Bacteria 928
157 Ga0070664_100810250 3300005564 Bacteria 876
158 Ga0070664_101233430 3300005564 Bacteria 706
159 Ga0068857_100507361 3300005577 Bacteria 1132
160 Ga0068857_100517758 3300005577 Bacteria 1121
161 Ga0068857_100822873 3300005577 Bacteria 887
162 Ga0068857_102373572 3300005577 Bacteria 521
163 Ga0068854_100028379 3300005578 Bacteria 3867
164 Ga0068854_100343443 3300005578 Bacteria 1220
165 Ga0068854_100502831 3300005578 Bacteria 1021
166 Ga0068856_100187239 3300005614 Bacteria 2084
167 Ga0068856_101713242 3300005614 Bacteria 641
168 Ga0070702_100010581 3300005615 Bacteria 4551
169 Ga0070702_100310442 3300005615 Bacteria 1095
170 Ga0068852_100002994 3300005616 Bacteria 11740
171 Ga0068852_100078108 3300005616 Bacteria 2928
172 Ga0068852_100558452 3300005616 Bacteria 1146
173 Ga0068852_101208348 3300005616 Bacteria 777
174 Ga0068852_101924310 3300005616 Bacteria 614
175 Ga0068852_102428643 3300005616 Bacteria 545
176 Ga0068859_100000128 3300005617 Bacteria 72119
177 Ga0068859_100000768 3300005617 Bacteria 32376
178 Ga0068859_100118149 3300005617 Bacteria 2717
179 Ga0068859_100162120 3300005617 Bacteria 2315
180 Ga0068859_100340743 3300005617 Bacteria 1593
181 Ga0068859_100353678 3300005617 Bacteria 1564
182 Ga0068859_101191439 3300005617 Bacteria 839
183 Ga0068864_100026441 3300005618 Bacteria 4894
184 Ga0068864_100079795 3300005618 Bacteria 2866
185 Ga0068864_100366918 3300005618 Bacteria 1362
186 Ga0068866_10036252 3300005718 Bacteria 2415
187 Ga0068861_100453396 3300005719 Bacteria 1150
188 Ga0068861_100483931 3300005719 Bacteria 1115
189 Ga0068861_100829985 3300005719 Bacteria 870
190 Ga0068861_101316228 3300005719 Bacteria 703
191 Ga0068870_10085772 3300005840 Bacteria 1751
192 Ga0068870_10110453 3300005840 Bacteria 1569
193 Ga0068870_10828419 3300005840 Unclassified 649
194 Ga0068863_100016956 3300005841 Bacteria 6986
195 Ga0068863_100194564 3300005841 Bacteria 1949
196 Ga0068863_100654900 3300005841 Bacteria 1042
197 Ga0068858_100057422 3300005842 Bacteria 3597
198 Ga0068858_100162391 3300005842 Bacteria 2103
199 Ga0068858_100520777 3300005842 Bacteria 1150
200 Ga0068858_100621735 3300005842 Bacteria 1049
201 Ga0068858_101200109 3300005842 Bacteria 746
202 Ga0068858_102029529 3300005842 Bacteria 569
203 Ga0068860_100000059 3300005843 Bacteria 196400
204 Ga0068860_100009276 3300005843 Bacteria 9780
205 Ga0068860_100181649 3300005843 Bacteria 2033
206 Ga0068860_100472368 3300005843 Bacteria 1249
207 Ga0068860_101496403 3300005843 Bacteria 697
208 Ga0068860_102529530 3300005843 Bacteria 533
209 Ga0068862_100009951 3300005844 Bacteria 7855
210 Ga0068862_101404166 3300005844 Unclassified 701
211 Ga0068862_101901888 3300005844 Bacteria 605
212 Ga0068862_102080960 3300005844 Bacteria 579
213 Ga0081539_10144985 3300005985 Bacteria 1149
214 Ga0075366_10233851 3300006195 Bacteria 1120
215 Ga0075366_10382866 3300006195 Bacteria 865
216 Ga0097621_100000714 3300006237 Bacteria 23301
217 Ga0097621_100016633 3300006237 Bacteria 5565
218 Ga0097621_100426646 3300006237 Bacteria 1191
219 Ga0097621_102401101 3300006237 Bacteria 504
220 Ga0068871_100000046 3300006358 Bacteria 66964
221 Ga0068871_100032967 3300006358 Bacteria 4096
222 Ga0068871_100083877 3300006358 Bacteria 2643
223 Ga0068871_100674003 3300006358 Bacteria 946
224 Ga0068871_102233885 3300006358 Unclassified 521
225 Ga0068865_100000041 3300006881 Bacteria 72569
226 Ga0068865_100016853 3300006881 Bacteria 4686
227 Ga0097620_100000128 3300006931 Bacteria 72119
228 Ga0097620_100000768 3300006931 Bacteria 32376
229 Ga0097620_100118146 3300006931 Bacteria 2717
230 Ga0097620_100162125 3300006931 Bacteria 2315
231 Ga0097620_100353680 3300006931 Bacteria 1564
232 Ga0097620_101191459 3300006931 Bacteria 839
233 Ga0105250_10578428 3300009092 Bacteria 518
234 Ga0105240_10000692 3300009093 Bacteria 61955
235 Ga0105240_10091827 3300009093 Bacteria 3708
236 Ga0105240_10142389 3300009093 Bacteria 2865
237 Ga0105240_10151322 3300009093 Bacteria 2763
238 Ga0105240_10228824 3300009093 Bacteria 2162
239 Ga0105240_10275776 3300009093 Bacteria 1934
240 Ga0105240_10377563 3300009093 Bacteria 1601
241 Ga0105240_11192892 3300009093 Bacteria 806
242 Ga0105245_12352170 3300009098 Bacteria 586
243 Ga0105245_12489654 3300009098 Bacteria 571
244 Ga0105247_10012983 3300009101 Bacteria 4995
245 Ga0105243_10833104 3300009148 Bacteria 912
246 Ga0105241_10000217 3300009174 Bacteria 43160
247 Ga0105241_10000853 3300009174 Bacteria 23134
248 Ga0105241_10014129 3300009174 Bacteria 5850
249 Ga0105241_10230152 3300009174 Bacteria 1562
250 Ga0105241_10704680 3300009174 Unclassified 922
251 Ga0105241_11081115 3300009174 Bacteria 754
252 Ga0105242_10012349 3300009176 Bacteria 6573
253 Ga0105242_10860977 3300009176 Unclassified 903
254 Ga0105248_10018721 3300009177 Bacteria 7656
255 Ga0105248_13043361 3300009177 Bacteria 534
256 Ga0105248_13390872 3300009177 Bacteria 506
257 Ga0105237_10001818 3300009545 Bacteria 27514
258 Ga0105237_10005378 3300009545 Bacteria 14473
259 Ga0105237_10022652 3300009545 Bacteria 6443
260 Ga0105237_10064143 3300009545 Bacteria 3670
261 Ga0105237_10100775 3300009545 Bacteria 2880
262 Ga0105237_10100974 3300009545 Bacteria 2877
263 Ga0105237_10174509 3300009545 Bacteria 2150
264 Ga0105237_11804019 3300009545 Bacteria 619
265 Ga0105237_12764956 3300009545 Bacteria 502
266 Ga0105238_10002068 3300009551 Bacteria 20258
267 Ga0105238_10049554 3300009551 Unclassified 4228
268 Ga0105249_10001650 3300009553 Bacteria 19547
269 Ga0105249_10004971 3300009553 Bacteria 11467
270 Ga0105249_10127295 3300009553 Bacteria 2427
271 Ga0105249_10354681 3300009553 Bacteria 1487
272 Ga0105239_10003770 3300010375 Bacteria 18441
273 Ga0105239_10004595 3300010375 Bacteria 16444
274 Ga0105239_10014883 3300010375 Bacteria 8624
275 Ga0105239_10020326 3300010375 Bacteria 7324
276 Ga0105239_10131045 3300010375 Bacteria 2789
277 Ga0105239_10230797 3300010375 Bacteria 2076
278 Ga0105239_10323232 3300010375 Bacteria 1740
279 Ga0105239_10368999 3300010375 Bacteria 1622
280 Ga0105239_10369001 3300010375 Bacteria 1622
281 Ga0105239_10863001 3300010375 Bacteria 1038
282 Ga0105239_10878842 3300010375 Bacteria 1028
283 Ga0105239_12443028 3300010375 Unclassified 609
284 Ga0105246_10030380 3300011119 Bacteria 3568
285 Ga0157318_1010462 3300012482 Bacteria 687
286 Ga0157373_10018201 3300013100 Bacteria 5116
287 Ga0157373_10115049 3300013100 Bacteria 1891
288 Ga0157373_10451993 3300013100 Bacteria 925
289 Ga0157373_10734773 3300013100 Bacteria 725
290 Ga0157371_10001084 3300013102 Bacteria 29465
291 Ga0157371_10005892 3300013102 Bacteria 10236
292 Ga0157371_10117844 3300013102 Bacteria 1887
293 Ga0157371_10200008 3300013102 Bacteria 1432
294 Ga0157371_10226730 3300013102 Bacteria 1342
295 Ga0157371_10655107 3300013102 Bacteria 784
296 Ga0157370_10004729 3300013104 Bacteria 15520
297 Ga0157370_10005230 3300013104 Bacteria 14608
298 Ga0157370_10007942 3300013104 Bacteria 11492
299 Ga0157370_10741662 3300013104 Bacteria 895
300 Ga0157370_10856618 3300013104 Bacteria 826
301 Ga0157370_11746082 3300013104 Bacteria 558
302 Ga0157369_10710310 3300013105 Bacteria 1035
303 Ga0157374_10024480 3300013296 Bacteria 5414
304 Ga0157374_10120999 3300013296 Bacteria 2526
305 Ga0157374_10180122 3300013296 Bacteria 2064
306 Ga0157374_10361113 3300013296 Bacteria 1444
307 Ga0157374_10411884 3300013296 Bacteria 1349
308 Ga0157374_10764166 3300013296 Bacteria 981
309 Ga0157374_11519916 3300013296 Bacteria 693
310 Ga0157378_10002500 3300013297 Bacteria 16359
311 Ga0157378_10010592 3300013297 Bacteria 8058
312 Ga0157378_10039612 3300013297 Bacteria 4180
313 Ga0157378_10100133 3300013297 Bacteria 2645
314 Ga0157378_10192612 3300013297 Bacteria 1924
315 Ga0157378_10271550 3300013297 Bacteria 1631
316 Ga0157378_10438265 3300013297 Bacteria 1294
317 Ga0157378_10522041 3300013297 Bacteria 1189
318 Ga0157378_11064786 3300013297 Bacteria 845
319 Ga0157378_12967902 3300013297 Bacteria 526
320 Ga0163162_10000005 3300013306 Bacteria 447195
321 Ga0163162_10004176 3300013306 Bacteria 13879
322 Ga0163162_10025120 3300013306 Bacteria 5888
323 Ga0163162_10118800 3300013306 Bacteria 2746
324 Ga0163162_10162723 3300013306 Bacteria 2354
325 Ga0163162_10790887 3300013306 Bacteria 1066
326 Ga0163162_11089836 3300013306 Bacteria 905
327 Ga0163162_12934557 3300013306 Bacteria 548
328 Ga0157372_10067142 3300013307 Bacteria 4030
329 Ga0157372_10147956 3300013307 Bacteria 2709
330 Ga0157372_10279148 3300013307 Bacteria 1942
331 Ga0157372_10357598 3300013307 Bacteria 1701
332 Ga0157372_10946520 3300013307 Bacteria 998
333 Ga0157372_11516755 3300013307 Bacteria 772
334 Ga0157372_11860707 3300013307 Bacteria 692
335 Ga0157375_10056217 3300013308 Bacteria 3884
336 Ga0157375_10076765 3300013308 Bacteria 3369
337 Ga0157375_10136908 3300013308 Bacteria 2574
338 Ga0157375_10190225 3300013308 Bacteria 2207
339 Ga0157375_10327155 3300013308 Bacteria 1698
340 Ga0157375_10639859 3300013308 Bacteria 1220
341 Ga0157375_12856259 3300013308 Bacteria 577
342 Ga0157375_13298652 3300013308 Bacteria 538
343 Ga0163163_10044636 3300014325 Bacteria 4349
344 Ga0163163_10209269 3300014325 Bacteria 1999
345 Ga0163163_10522091 3300014325 Bacteria 1250
346 Ga0163163_10933780 3300014325 Bacteria 931
347 Ga0163163_11027084 3300014325 Bacteria 888
348 Ga0157380_10760117 3300014326 Bacteria 982
349 Ga0157380_12632947 3300014326 Bacteria 569
350 Ga0182008_10000108 3300014497 Bacteria 63463
351 Ga0157377_10002130 3300014745 Bacteria 8706
352 Ga0157377_10013404 3300014745 Bacteria 4148
353 Ga0157377_10107275 3300014745 Bacteria 1674
354 Ga0157377_10456364 3300014745 Bacteria 883
355 Ga0157379_10927927 3300014968 Bacteria 827
356 Ga0157379_12485608 3300014968 Bacteria 518
357 Ga0157376_10328573 3300014969 Bacteria 1456
358 Ga0157376_10386112 3300014969 Bacteria 1350
359 Ga0157376_11477504 3300014969 Bacteria 712
360 Ga0157376_12559847 3300014969 Bacteria 550
361 Ga0182006_1000109 3300015261 Bacteria 89541
362 Ga0182007_10037805 3300015262 Bacteria 1620
363 Ga0163161_10001003 3300017792 Bacteria 21495
364 Ga0163161_10036486 3300017792 Bacteria 3520
365 Ga0163161_10168620 3300017792 Bacteria 1673
366 Ga0163161_10203301 3300017792 Bacteria 1527
367 Ga0163161_10463349 3300017792 Bacteria 1026
368 Ga0163161_12065873 3300017792 Bacteria 507
369 Ga0213872_10029500 3300021361 Bacteria 2515
370 Ga0213876_10000722 3300021384 Bacteria 23019
371 Ga0209437_100528 3300025233 Bacteria 26547
372 Ga0209258_100029 3300025242 Bacteria 490648
373 Ga0209646_1016800 3300025246 Bacteria 1083
374 Ga0209026_1000890 3300025250 Bacteria 15461
375 Ga0209148_1000163 3300025254 Bacteria 137449
376 Ga0209129_1009318 3300025258 Bacteria 2605
377 Ga0209455_1003239 3300025272 Bacteria 5870
378 Ga0209673_1000016 3300025273 Bacteria 506202
379 Ga0209564_1005465 3300025295 Bacteria 7244
380 Ga0209758_1006613 3300025297 Bacteria 8214
381 Ga0209050_1000124 3300025298 Bacteria 194022
382 Ga0207426_1000157 3300025302 Bacteria 178442
383 Ga0207426_1000925 3300025302 Bacteria 29342
384 Ga0209051_1023842 3300025303 Bacteria 2534
385 Ga0209257_1001535 3300025304 Bacteria 26927
386 Ga0207697_10354971 3300025315 Bacteria 651
387 Ga0207682_10349708 3300025893 Unclassified 696
388 Ga0207682_10399046 3300025893 Bacteria 650
389 Ga0207642_10019317 3300025899 Bacteria 2637
390 Ga0207642_10289659 3300025899 Bacteria 945
391 Ga0207710_10043471 3300025900 Bacteria 1998
392 Ga0207688_10005502 3300025901 Bacteria 6888
393 Ga0207688_10747440 3300025901 Bacteria 619
394 Ga0207680_10000448 3300025903 Bacteria 19470
395 Ga0207647_10000117 3300025904 Bacteria 61849
396 Ga0207647_10045721 3300025904 Bacteria 2730
397 Ga0207647_10086213 3300025904 Archaea 1877
398 Ga0207647_10158900 3300025904 Bacteria 1319
399 Ga0207685_10314334 3300025905 Bacteria 779
400 Ga0207645_10009683 3300025907 Bacteria 6656
401 Ga0207645_10013933 3300025907 Bacteria 5392
402 Ga0207645_10088067 3300025907 Bacteria 1995
403 Ga0207643_10045067 3300025908 Bacteria 2490
404 Ga0207643_10138292 3300025908 Bacteria 1453
405 Ga0207705_10000623 3300025909 Bacteria 29594
406 Ga0207705_10078920 3300025909 Bacteria 2397
407 Ga0207705_10085635 3300025909 Bacteria 2302
408 Ga0207705_10179389 3300025909 Bacteria 1598
409 Ga0207705_11286318 3300025909 Bacteria 559
410 Ga0207654_10000524 3300025911 Bacteria 21970
411 Ga0207654_10008858 3300025911 Bacteria 5104
412 Ga0207654_10011575 3300025911 Bacteria 4502
413 Ga0207707_10343059 3300025912 Bacteria 1288
414 Ga0207707_11427569 3300025912 Bacteria 551
415 Ga0207695_10000020 3300025913 Bacteria 723025
416 Ga0207695_10008260 3300025913 Bacteria 13066
417 Ga0207695_10048139 3300025913 Bacteria 4505
418 Ga0207695_10068845 3300025913 Bacteria 3625
419 Ga0207695_10895876 3300025913 Bacteria 767
420 Ga0207671_10002893 3300025914 Bacteria 17762
421 Ga0207671_10005501 3300025914 Bacteria 11657
422 Ga0207671_10008195 3300025914 Bacteria 8906
423 Ga0207671_10022597 3300025914 Bacteria 4752
424 Ga0207671_10027556 3300025914 Bacteria 4248
425 Ga0207671_10119370 3300025914 Bacteria 2014
426 Ga0207671_10132417 3300025914 Bacteria 1915
427 Ga0207671_10244524 3300025914 Bacteria 1410
428 Ga0207671_11239614 3300025914 Bacteria 582
429 Ga0207663_10540253 3300025916 Bacteria 910
430 Ga0207660_10035604 3300025917 Bacteria 3457
431 Ga0207660_10367560 3300025917 Bacteria 1155
432 Ga0207662_10035006 3300025918 Bacteria 2932
433 Ga0207662_10041489 3300025918 Bacteria 2709
434 Ga0207657_10012327 3300025919 Bacteria 8448
435 Ga0207657_10268913 3300025919 Bacteria 1355
436 Ga0207657_10535440 3300025919 Bacteria 916
437 Ga0207657_10800976 3300025919 Bacteria 728
438 Ga0207657_10912900 3300025919 Bacteria 676
439 Ga0207652_11877545 3300025921 Bacteria 504
440 Ga0207646_10120519 3300025922 Bacteria 2357
441 Ga0207646_11096909 3300025922 Bacteria 701
442 Ga0207681_10367529 3300025923 Bacteria 1155
443 Ga0207681_10585725 3300025923 Bacteria 921
444 Ga0207681_11587396 3300025923 Bacteria 548
445 Ga0207694_10035339 3300025924 Bacteria 3833
446 Ga0207694_10072542 3300025924 Bacteria 2692
447 Ga0207659_10239400 3300025926 Bacteria 1467
448 Ga0207659_10534496 3300025926 Bacteria 995
449 Ga0207687_11720539 3300025927 Bacteria 537
450 Ga0207664_10954863 3300025929 Bacteria 769
451 Ga0207644_10072589 3300025931 Bacteria 2521
452 Ga0207644_10186173 3300025931 Bacteria 1630
453 Ga0207644_10600633 3300025931 Bacteria 914
454 Ga0207690_10220436 3300025932 Bacteria 1451
455 Ga0207690_10320013 3300025932 Bacteria 1219
456 Ga0207690_10401022 3300025932 Bacteria 1094
457 Ga0207690_10619021 3300025932 Bacteria 885
458 Ga0207706_10000044 3300025933 Bacteria 123576
459 Ga0207706_10020437 3300025933 Bacteria 5953
460 Ga0207686_10082882 3300025934 Bacteria 2098
461 Ga0207686_10309192 3300025934 Bacteria 1176
462 Ga0207709_10205784 3300025935 Bacteria 1409
463 Ga0207670_11886993 3300025936 Bacteria 508
464 Ga0207669_10354074 3300025937 Unclassified 1135
465 Ga0207669_11404192 3300025937 Bacteria 594
466 Ga0207704_10000061 3300025938 Bacteria 76480
467 Ga0207704_10359608 3300025938 Bacteria 1136
468 Ga0207665_10693511 3300025939 Bacteria 800
469 Ga0207691_10007611 3300025940 Bacteria 10425
470 Ga0207691_10009816 3300025940 Bacteria 9191
471 Ga0207691_10195375 3300025940 Bacteria 1763
472 Ga0207691_10240574 3300025940 Bacteria 1565
473 Ga0207711_10058541 3300025941 Plasmid 3316
474 Ga0207711_11112052 3300025941 Bacteria 731
475 Ga0207711_11791947 3300025941 Unclassified 557
476 Ga0207689_10064946 3300025942 Bacteria 3002
477 Ga0207689_10095465 3300025942 Bacteria 2442
478 Ga0207689_10164130 3300025942 Bacteria 1830
479 Ga0207689_10350892 3300025942 Bacteria 1226
480 Ga0207689_10356690 3300025942 Bacteria 1216
481 Ga0207661_10656543 3300025944 Bacteria 964
482 Ga0207679_10267921 3300025945 Bacteria 1459
483 Ga0207679_10670249 3300025945 Bacteria 939
484 Ga0207679_11258831 3300025945 Bacteria 679
485 Ga0207667_10081641 3300025949 Bacteria 3349
486 Ga0207667_10129790 3300025949 Bacteria 2596
487 Ga0207667_10187634 3300025949 Bacteria 2122
488 Ga0207667_10798120 3300025949 Bacteria 941
489 Ga0207667_11339039 3300025949 Bacteria 691
490 Ga0207651_10004446 3300025960 Bacteria 7068
491 Ga0207651_10689755 3300025960 Bacteria 899
492 Ga0207712_10065033 3300025961 Bacteria 2602
493 Ga0207712_10114889 3300025961 Bacteria 2025
494 Ga0207712_10170480 3300025961 Bacteria 1701
495 Ga0207712_10196649 3300025961 Bacteria 1595
496 Ga0207712_10449328 3300025961 Bacteria 1093
497 Ga0207712_12000853 3300025961 Bacteria 519
498 Ga0207668_11703580 3300025972 Bacteria 569
499 Ga0207668_11836933 3300025972 Bacteria 547
500 Ga0207668_11994339 3300025972 Bacteria 523
501 Ga0207640_10072546 3300025981 Bacteria 2323
502 Ga0207640_10628518 3300025981 Bacteria 912
503 Ga0207658_10067979 3300025986 Bacteria 2686
504 Ga0207658_10137113 3300025986 Bacteria 1975
505 Ga0207658_10154262 3300025986 Bacteria 1875
506 Ga0207658_10303417 3300025986 Bacteria 1376
507 Ga0207658_10390442 3300025986 Bacteria 1221
508 Ga0207658_11345465 3300025986 Bacteria 653
509 Ga0207658_11621991 3300025986 Bacteria 591
510 Ga0207658_11873631 3300025986 Bacteria 547
511 Ga0207677_10037202 3300026023 Bacteria 3179
512 Ga0207677_10057504 3300026023 Bacteria 2671
513 Ga0207677_10077911 3300026023 Bacteria 2365
514 Ga0207677_10553218 3300026023 Bacteria 1003
515 Ga0207677_11779838 3300026023 Bacteria 572
516 Ga0207703_10006254 3300026035 Bacteria 9523
517 Ga0207703_10331355 3300026035 Bacteria 1396
518 Ga0207703_10484819 3300026035 Bacteria 1159
519 Ga0207703_10786046 3300026035 Bacteria 908
520 Ga0207703_10926305 3300026035 Bacteria 835
521 Ga0207703_11666769 3300026035 Bacteria 613
522 Ga0207703_11719022 3300026035 Bacteria 603
523 Ga0207703_11837569 3300026035 Bacteria 582
524 Ga0207703_12207335 3300026035 Bacteria 526
525 Ga0207639_10010963 3300026041 Bacteria 6282
526 Ga0207639_10012012 3300026041 Bacteria 6025
527 Ga0207639_10115885 3300026041 Bacteria 2192
528 Ga0207639_10130457 3300026041 Bacteria 2080
529 Ga0207639_10166030 3300026041 Bacteria 1865
530 Ga0207639_10329602 3300026041 Bacteria 1358
531 Ga0207639_10331843 3300026041 Bacteria 1354
532 Ga0207678_10201899 3300026067 Unclassified 1700
533 Ga0207678_11809054 3300026067 Bacteria 535
534 Ga0207708_10017604 3300026075 Bacteria 5380
535 Ga0207708_10079070 3300026075 Bacteria 2526
536 Ga0207708_11173679 3300026075 Bacteria 671
537 Ga0207708_11552873 3300026075 Bacteria 582
538 Ga0207708_11909248 3300026075 Bacteria 520
539 Ga0207702_11095342 3300026078 Bacteria 790
540 Ga0207702_12052422 3300026078 Bacteria 562
541 Ga0207641_10005736 3300026088 Bacteria 10545
542 Ga0207641_10233935 3300026088 Bacteria 1709
543 Ga0207641_10541959 3300026088 Bacteria 1134
544 Ga0207641_12612183 3300026088 Bacteria 503
545 Ga0207648_10002338 3300026089 Bacteria 20455
546 Ga0207648_10052614 3300026089 Bacteria 3561
547 Ga0207648_10286460 3300026089 Bacteria 1474
548 Ga0207648_11950885 3300026089 Bacteria 548
549 Ga0207676_10004483 3300026095 Bacteria 9870
550 Ga0207676_10352943 3300026095 Bacteria 1360
551 Ga0207676_11291134 3300026095 Bacteria 725
552 Ga0207674_10023607 3300026116 Bacteria 6584
553 Ga0207674_10156717 3300026116 Bacteria 2232
554 Ga0207674_10353023 3300026116 Bacteria 1422
555 Ga0207674_10497460 3300026116 Bacteria 1178
556 Ga0207674_11042722 3300026116 Bacteria 787
557 Ga0207675_100339515 3300026118 Bacteria 1470
558 Ga0207675_100937586 3300026118 Bacteria 883
559 Ga0207675_101417037 3300026118 Bacteria 715
560 Ga0207675_101789605 3300026118 Bacteria 634
561 Ga0207683_10031283 3300026121 Bacteria 4619
562 Ga0207683_10215435 3300026121 Bacteria 1749
563 Ga0207683_10240671 3300026121 Bacteria 1651
564 Ga0207683_10613569 3300026121 Bacteria 1007
565 Ga0207698_10121920 3300026142 Bacteria 2208
566 Ga0207698_10728534 3300026142 Bacteria 989
567 Ga0207698_10820847 3300026142 Bacteria 933
568 Ga0207698_10834298 3300026142 Bacteria 926
569 Ga0207698_10910885 3300026142 Bacteria 887
570 Ga0207698_12099353 3300026142 Bacteria 579
571 Ga0268266_10000132 3300028379 Bacteria 145563
572 Ga0268266_10637558 3300028379 Bacteria 1025
573 Ga0268265_10013493 3300028380 Bacteria 5553
574 Ga0268265_10286163 3300028380 Bacteria 1477
575 Ga0268265_11442638 3300028380 Bacteria 691
576 Ga0268264_10000015 3300028381 Bacteria 508501
577 Ga0268264_10383701 3300028381 Bacteria 1346
578 Ga0268264_10601952 3300028381 Bacteria 1083
579 Ga0268264_10945203 3300028381 Bacteria 867
580 Ga0268264_11342442 3300028381 Bacteria 725
581 Ga0265334_10159572 3300028573 Bacteria 793
582 Ga0265323_10000512 3300028653 Bacteria 21698
583 Ga0307517_10007381 3300028786 Bacteria 16035
584 Ga0307515_10000061 3300028794 Bacteria 251841
585 Ga0307515_10064321 3300028794 Bacteria 5130
586 Ga0307515_10629754 3300028794 Bacteria 684
587 Ga0265338_10084234 3300028800 Bacteria 2655
588 Ga0265338_10517135 3300028800 Unclassified 839
589 Ga0316181_1087376 3300030744 Bacteria 1152
590 Ga0265330_10104767 3300031235 Bacteria 1210
591 Ga0265327_10000055 3300031251 Bacteria 247188
592 Ga0265327_10064368 3300031251 Bacteria 1858
593 Ga0265327_10070414 3300031251 Bacteria 1753
594 Ga0265316_10001184 3300031344 Bacteria 28228
595 Ga0307509_10178754 3300031507 Bacteria 1991
596 Ga0307509_10228133 3300031507 Bacteria 1668
597 Ga0307509_10420174 3300031507 Bacteria 1038
598 Ga0307509_10492518 3300031507 Bacteria 912
599 Ga0307514_10433042 3300031649 Bacteria 655
600 Ga0265314_10046768 3300031711 Bacteria 3051
601 Ga0307410_11479517 3300031852 Bacteria 598
602 Ga0307406_10038111 3300031901 Bacteria 2974
603 Ga0307406_10611011 3300031901 Bacteria 900
604 Ga0307412_11208901 3300031911 Bacteria 677
605 Ga0307412_12098833 3300031911 Bacteria 525
606 Ga0307409_101429972 3300031995 Bacteria 718
607 Ga0307416_100224981 3300032002 Bacteria 1803
608 Ga0307416_101593428 3300032002 Bacteria 758
609 Ga0307414_10084723 3300032004 Bacteria 2332
610 Ga0307414_10286507 3300032004 Bacteria 1387
611 Ga0307411_11966865 3300032005 Bacteria 545
612 Ga0307510_10013796 3300033180 Bacteria 9579
613 Ga0373936_0230431 3300035113 Bacteria 824
614 Ga0373939_0215478 3300035114 Bacteria 733
615 Ga0373941_0232872 3300035115 Bacteria 712
616 Ga0373942_0025117 3300035207 Bacteria 1533
617 Ga0395899_0000021 3300037312 Bacteria 391702
618 Ga0395899_0009228 3300037312 Bacteria 7576
619 Ga0395899_0026616 3300037312 Bacteria 4364
620 Ga0395899_0115190 3300037312 Bacteria 1929
621 Ga0395900_0000494 3300037418 Bacteria 55588
622 Ga0395900_0003517 3300037418 Bacteria 16914
623 Ga0395900_0004982 3300037418 Bacteria 13961
624 Ga0395900_0279390 3300037418 Bacteria 1662
625 Ga0395898_0004102 3300037466 Bacteria 15974
626 Ga0395898_0080656 3300037466 Bacteria 3138
627 Ga0395905_0000757 3300037471 Bacteria 42574
628 Ga0395905_0004960 3300037471 Bacteria 13717
629 Ga0395905_0017163 3300037471 Bacteria 6876
630 Ga0395905_0030285 3300037471 Bacteria 5100
631 Ga0395905_0485689 3300037471 Bacteria 1135
632 Ga0395901_0002107 3300038443 Bacteria 20401
633 Ga0395901_0003012 3300038443 Bacteria 16991
634 Ga0395901_0021304 3300038443 Bacteria 6639
635 Ga0395901_0054362 3300038443 Bacteria 4161
636 Ga0436365_1664331 3300039437 Bacteria 31697
637 Ga0436361_0635236 3300039447 Bacteria 6435
638 Ga0439439_0214470 3300041406 Bacteria 563
639 Ga0439466_0139579 3300041411 Bacteria 744
640 Ga0451793_0462005 3300041452 Bacteria 611
641 Ga0451802_1188741 3300041460 Bacteria 575
642 Ga0451804_0543671 3300041463 Bacteria 605
643 Ga0451807_1973634 3300041486 Bacteria 555
644 Ga0451833_0971787 3300041491 Bacteria 683
645 Ga0451837_0256521 3300041494 Bacteria 523
646 Ga0451841_1049833 3300041498 Bacteria 505
647 Ga0451845_0572086 3300041501 Bacteria 569
648 Ga0451851_0947342 3300041507 Bacteria 671
649 Ga0451851_1259567 3300041507 Bacteria 618
650 Ga0451853_0174956 3300041512 Bacteria 1073
651 Ga0439442_026011 3300042002 Bacteria 1218
652 Ga0439432_128270 3300042006 Bacteria 749
653 Ga0439449_0126557 3300042007 Bacteria 949
654 Ga0439457_044691 3300042014 Bacteria 989
655 Ga0450897_050347 3300042128 Bacteria 502
656 Ga0450898_005402 3300042134 Bacteria 1930
657 Ga0450899_009235 3300042135 Bacteria 1085
658 Ga0451577_0023194 3300042876 Bacteria 5662
659 Ga0451577_0027814 3300042876 Bacteria 5118
660 Ga0451577_0202605 3300042876 Bacteria 1791
661 Ga0466972_0301302 3300044658 Bacteria 749
662 Ga0466972_0554611 3300044658 Bacteria 542
663 Ga0453684_0002051 3300044712 Bacteria 51267
664 Ga0453684_0055025 3300044712 Bacteria 5176
665 Ga0453684_0517563 3300044712 Bacteria 1319
666 Ga0466970_0128696 3300044765 Bacteria 1390
667 Ga0466959_0018495 3300045049 Bacteria 5117
668 Ga0466959_0077269 3300045049 Bacteria 2403
669 Ga0466959_0288998 3300045049 Bacteria 1124
670 Ga0451576_0015476 3300045051 Bacteria 8449
671 Ga0451576_0189687 3300045051 Bacteria 2147
672 Ga0451576_1787248 3300045051 Bacteria 636
673 Ga0451576_2609771 3300045051 Bacteria 515
674 Ga0466958_0386462 3300045836 Bacteria 903
675 Ga0495638_0000008 3300046460 Bacteria 565643
676 Ga0495638_0414301 3300046460 Bacteria 696
677 Ga0495651_0468027 3300046462 Bacteria 812
678 Ga0495650_0019537 3300046471 Bacteria 3330
679 Ga0495606_0058371 3300046507 Bacteria 2480
680 Ga0495606_0482368 3300046507 Bacteria 629
681 Ga0495618_0850045 3300046514 Bacteria 529
682 Ga0495644_0096453 3300046523 Bacteria 1117
683 Ga0495652_0901129 3300046529 Bacteria 583
684 Ga0495622_0211461 3300046557 Bacteria 862
685 Ga0495668_0001373 3300046616 Bacteria 23852
686 Ga0495634_0502991 3300046642 Bacteria 710
687 Ga0495611_0120339 3300046648 Bacteria 1224
688 Ga0495625_0118844 3300046660 Bacteria 1801
689 Ga0495661_0612527 3300046665 Bacteria 511
690 Ga0495658_0945769 3300046683 Bacteria 551
691 Ga0495581_0903691 3300047315 Bacteria 504
692 Ga0495674_1254327 3300047319 Bacteria 558
693 Ga0495672_0008239 3300047320 Bacteria 7726
694 Ga0495685_090765 3300047447 Bacteria 1013
695 Ga0495686_0001370 3300047472 Bacteria 27175
696 Ga0496108_0707060 3300048911 Bacteria 874
697 Ga0496115_0926906 3300048918 Bacteria 670
698 Ga0496122_0006972 3300048925 Bacteria 12720
699 Ga0496123_0028687 3300048926 Bacteria 4113
700 Ga0496125_0028469 3300048928 Bacteria 5046
701 Ga0501034_0138376 3300049571 Bacteria 2415
702 Ga0501038_0090718 3300049574 Bacteria 2561
703 Ga0501039_0375002 3300049575 Bacteria 1118
704 Ga0501043_0311516 3300049579 Bacteria 1201
705 Ga0501073_0820270 3300049589 Bacteria 641
706 Ga0501198_105283 3300049649 Bacteria 577
707 Ga0501214_042452 3300049659 Bacteria 666
708 Ga0501217_164696 3300049661 Bacteria 671
709 Ga0501223_028400 3300049663 Bacteria 1089
710 Ga0501224_042369 3300049664 Bacteria 689
711 Ga0501233_148642 3300049668 Bacteria 652
712 Ga0501238_033146 3300049671 Bacteria 750
713 Ga0501250_060581 3300049680 Bacteria 603
714 Ga0501257_022697 3300049686 Bacteria 1486
715 Ga0501221_128947 3300049704 Bacteria 653
716 Ga0501234_052612 3300049707 Bacteria 680
717 Ga0501044_0205041 3300049823 Bacteria 1929
718 nmdc:mga0k408_116299_c1 3300050493 Bacteria 1582
719 nmdc:mga07m45_168367_c1 3300050496 Bacteria 1273
720 nmdc:mga08y16_945191_c1 3300050511 Bacteria 845
721 nmdc:mga08y16_97154_c1 3300050511 Bacteria 3067
722 Ga0500635_0000568 3300053080 Bacteria 9856
723 Ga0500578_0000024 3300053086 Bacteria 151503
724 Ga0500578_0295929 3300053086 Bacteria 961
725 Ga0500644_0000169 3300053088 Bacteria 41659
726 Ga0500644_0084978 3300053088 Bacteria 1172
727 Ga0500581_213282 3300053089 Bacteria 845
728 Ga0500581_237668 3300053089 Bacteria 776
729 Ga0500647_0179297 3300053091 Bacteria 973
730 Ga0500583_0506470 3300053092 Bacteria 566
731 Ga0500650_0176658 3300053098 Bacteria 980
732 Ga0500562_000078 3300053108 Bacteria 44915
733 Ga0500592_068298 3300053116 Bacteria 585
734 Ga0500607_025589 3300053121 Bacteria 3283
735 Ga0500608_095814 3300053122 Bacteria 1381
736 Ga0500618_000004 3300053125 Bacteria 293180
737 Ga0500642_0146371 3300053130 Bacteria 1109
738 Ga0500568_0028977 3300053139 Bacteria 2303
739 Ga0500568_0240949 3300053139 Bacteria 659
740 Ga0500577_0046752 3300053142 Bacteria 1605
741 Ga0500590_092581 3300053148 Bacteria 1465
742 Ga0500616_0000003 3300053153 Bacteria 1220687
743 Ga0500616_0004260 3300053153 Bacteria 10285
744 Ga0500616_0012071 3300053153 Bacteria 5070
745 Ga0500616_0102737 3300053153 Bacteria 1394
746 Ga0500616_0146391 3300053153 Bacteria 1098
747 Ga0500616_0219205 3300053153 Bacteria 831
748 Ga0500622_0000870 3300053156 Bacteria 25713
749 Ga0500622_0001076 3300053156 Bacteria 22701
750 Ga0500622_0243796 3300053156 Bacteria 792
751 Ga0500633_0003460 3300053160 Bacteria 3451
752 Ga0500634_0050744 3300053161 Bacteria 2234
753 Ga0500645_020997 3300053730 Bacteria 2017
754 Ga0500645_143683 3300053730 Bacteria 659
755 Ga0500552_034013 3300053733 Bacteria 800
756 Ga0466962_0058515 3300061719 Unclassified 1839

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10581194 Ga0070666_105811942 85
2 3300005331 Ga0070670_100070797 Ga0070670_1000707972 102
3 iso_pu_bacteria 2898713307 2898715615 102
4 iso_pu_bacteria 2910245624 2910249359 102
5 3300003320 rootH2_10009258 rootH2_1000925810 103
6 3300005438 Ga0070701_10194353 Ga0070701_101943532 103
7 iso_pu_bacteria 2919437846 2919438741 103
8 3300003320 rootH2_10148392 rootH2_101483925 104
9 3300005289 Ga0065704_10409115 Ga0065704_104091152 104
10 3300005290 Ga0065712_10101133 Ga0065712_101011331 104
11 3300005295 Ga0065707_10023401 Ga0065707_100234012 104
12 3300005334 Ga0068869_100312382 Ga0068869_1003123822 104
13 3300005338 Ga0068868_101268854 Ga0068868_1012688542 104
14 3300005353 Ga0070669_100029435 Ga0070669_1000294355 104
15 3300005354 Ga0070675_100969052 Ga0070675_1009690522 104
16 3300005355 Ga0070671_101423470 Ga0070671_1014234701 104
17 3300005367 Ga0070667_100674097 Ga0070667_1006740972 104
18 3300005367 Ga0070667_101093882 Ga0070667_1010938822 104
19 3300005438 Ga0070701_10164206 Ga0070701_101642062 104
20 3300005441 Ga0070700_100047956 Ga0070700_1000479563 104
21 3300005445 Ga0070708_100520848 Ga0070708_1005208482 104
22 3300005456 Ga0070678_100436965 Ga0070678_1004369652 104
23 3300005456 Ga0070678_101199434 Ga0070678_1011994341 104
24 3300005459 Ga0068867_100015064 Ga0068867_1000150643 104
25 3300005466 Ga0070685_10375181 Ga0070685_103751812 104
26 3300005471 Ga0070698_100075760 Ga0070698_1000757603 104
27 3300005536 Ga0070697_100051518 Ga0070697_1000515182 104
28 3300005539 Ga0068853_100627999 Ga0068853_1006279991 104
29 3300005543 Ga0070672_100218129 Ga0070672_1002181292 104
30 3300005577 Ga0068857_100507361 Ga0068857_1005073611 104
31 3300005578 Ga0068854_100343443 Ga0068854_1003434432 104
32 3300005615 Ga0070702_100310442 Ga0070702_1003104422 104
33 3300005616 Ga0068852_101924310 Ga0068852_1019243102 104
34 3300005617 Ga0068859_100000128 Ga0068859_1000001284 104
35 3300005617 Ga0068859_100118149 Ga0068859_1001181494 104
36 3300005617 Ga0068859_100340743 Ga0068859_1003407433 104
37 3300005618 Ga0068864_100079795 Ga0068864_1000797952 104
38 3300005719 Ga0068861_100483931 Ga0068861_1004839312 104
39 3300005840 Ga0068870_10828419 Ga0068870_108284192 104
40 3300005841 Ga0068863_100194564 Ga0068863_1001945642 104
41 3300005844 Ga0068862_101404166 Ga0068862_1014041662 104
42 3300006358 Ga0068871_100674003 Ga0068871_1006740032 104
43 3300006358 Ga0068871_102233885 Ga0068871_1022338851 104
44 3300006881 Ga0068865_100016853 Ga0068865_1000168532 104
45 3300006931 Ga0097620_100000128 Ga0097620_10000012855 104
46 3300006931 Ga0097620_100118146 Ga0097620_1001181463 104
47 3300009093 Ga0105240_10142389 Ga0105240_101423893 104
48 3300009093 Ga0105240_10151322 Ga0105240_101513224 104
49 3300009148 Ga0105243_10833104 Ga0105243_108331041 104
50 3300009174 Ga0105241_10230152 Ga0105241_102301521 104
51 3300009174 Ga0105241_10704680 Ga0105241_107046802 104
52 3300009176 Ga0105242_10860977 Ga0105242_108609772 104
53 3300009177 Ga0105248_10018721 Ga0105248_100187212 104
54 3300009177 Ga0105248_13043361 Ga0105248_130433612 104
55 3300009545 Ga0105237_10022652 Ga0105237_100226528 104
56 3300009545 Ga0105237_12764956 Ga0105237_127649561 104
57 3300009553 Ga0105249_10004971 Ga0105249_100049714 104
58 3300010375 Ga0105239_10014883 Ga0105239_1001488311 104
59 3300010375 Ga0105239_10863001 Ga0105239_108630012 104
60 3300010375 Ga0105239_10878842 Ga0105239_108788421 104
61 3300013296 Ga0157374_10361113 Ga0157374_103611132 104
62 3300013296 Ga0157374_10411884 Ga0157374_104118843 104
63 3300013297 Ga0157378_10192612 Ga0157378_101926122 104
64 3300013297 Ga0157378_10271550 Ga0157378_102715502 104
65 3300013297 Ga0157378_11064786 Ga0157378_110647862 104
66 3300013306 Ga0163162_10118800 Ga0163162_101188004 104
67 3300013306 Ga0163162_10790887 Ga0163162_107908872 104
68 3300013308 Ga0157375_10639859 Ga0157375_106398592 104
69 3300014325 Ga0163163_11027084 Ga0163163_110270842 104
70 3300014745 Ga0157377_10107275 Ga0157377_101072751 104
71 3300025272 Ga0209455_1003239 Ga0209455_10032392 104
72 3300025893 Ga0207682_10349708 Ga0207682_103497082 104
73 3300025899 Ga0207642_10019317 Ga0207642_100193174 104
74 3300025904 Ga0207647_10158900 Ga0207647_101589003 104
75 3300025913 Ga0207695_10068845 Ga0207695_100688453 104
76 3300025914 Ga0207671_10132417 Ga0207671_101324171 104
77 3300025917 Ga0207660_10367560 Ga0207660_103675601 104
78 3300025918 Ga0207662_10035006 Ga0207662_100350061 104
79 3300025922 Ga0207646_10120519 Ga0207646_101205192 104
80 3300025923 Ga0207681_10367529 Ga0207681_103675292 104
81 3300025926 Ga0207659_10534496 Ga0207659_105344962 104
82 3300025934 Ga0207686_10309192 Ga0207686_103091922 104
83 3300025935 Ga0207709_10205784 Ga0207709_102057844 104
84 3300025937 Ga0207669_10354074 Ga0207669_103540741 104
85 3300025938 Ga0207704_10359608 Ga0207704_103596081 104
86 3300025940 Ga0207691_10007611 Ga0207691_100076115 104
87 3300025941 Ga0207711_10058541 Ga0207711_100585414 104
88 3300025941 Ga0207711_11791947 Ga0207711_117919471 104
89 3300025961 Ga0207712_10170480 Ga0207712_101704803 104
90 3300025986 Ga0207658_10137113 Ga0207658_101371134 104
91 3300026023 Ga0207677_10553218 Ga0207677_105532182 104
92 3300026023 Ga0207677_11779838 Ga0207677_117798381 104
93 3300026041 Ga0207639_10130457 Ga0207639_101304574 104
94 3300026067 Ga0207678_10201899 Ga0207678_102018992 104
95 3300026075 Ga0207708_10017604 Ga0207708_100176044 104
96 3300026088 Ga0207641_10233935 Ga0207641_102339352 104
97 3300026088 Ga0207641_10541959 Ga0207641_105419592 104
98 3300026095 Ga0207676_10352943 Ga0207676_103529431 104
99 3300026121 Ga0207683_10240671 Ga0207683_102406713 104
100 3300026142 Ga0207698_10728534 Ga0207698_107285342 104
101 3300028380 Ga0268265_10286163 Ga0268265_102861632 104
102 3300028381 Ga0268264_10601952 Ga0268264_106019522 104
103 3300035207 Ga0373942_0025117 Ga0373942_0025117_933_1259 104
104 3300037312 Ga0395899_0115190 Ga0395899_0115190_669_986 104
105 3300037471 Ga0395905_0030285 Ga0395905_0030285_4539_4856 104
106 3300038443 Ga0395901_0054362 Ga0395901_0054362_291_608 104
107 3300042876 Ga0451577_0027814 Ga0451577_0027814_1372_1686 104
108 3300042876 Ga0451577_0202605 Ga0451577_0202605_830_1156 104
109 3300044712 Ga0453684_0517563 Ga0453684_0517563_531_845 104
110 3300045049 Ga0466959_0077269 Ga0466959_0077269_1545_1871 104
111 3300045051 Ga0451576_1787248 Ga0451576_1787248_91_417 104
112 3300053142 Ga0500577_0046752 Ga0500577_0046752_264_584 104
113 3300005341 Ga0070691_10110364 Ga0070691_101103643 105
114 3300005545 Ga0070695_100813774 Ga0070695_1008137741 105
115 3300025936 Ga0207670_11886993 Ga0207670_118869931 105
116 3300028794 Ga0307515_10000061 Ga0307515_10000061169 105
117 3300028794 Ga0307515_10629754 Ga0307515_106297541 105
118 3300031507 Ga0307509_10178754 Ga0307509_101787543 105
119 3300031649 Ga0307514_10433042 Ga0307514_104330422 105
120 3300031901 Ga0307406_10038111 Ga0307406_100381113 105
121 3300041460 Ga0451802_1188741 Ga0451802_1188741_127_444 105
122 3300046507 Ga0495606_0482368 Ga0495606_0482368_13_330 105
123 2162886007 SwRhRL2b_contig_1761633 SwRhRL2b_0391.00006420 106
124 3300001991 JGI24743J22301_10037794 JGI24743J22301_100377942 106
125 3300002737 JGI25162J39368_1000881 JGI25162J39368_10008815 106
126 3300002773 JGI25152J39213_1050914 JGI25152J39213_10509142 106
127 3300003215 JGI25153J46596_10011436 JGI25153J46596_100114362 106
128 3300003316 rootH1_10040117 rootH1_100401175 106
129 3300003320 rootH2_10075751 rootH2_100757513 106
130 3300003322 rootL2_10228164 rootL2_102281642 106
131 3300003323 rootH1_10041130 rootH1_100411301 106
132 3300003323 rootH1_10121882 rootH1_101218825 106
133 3300003354 JGI25160J50197_1002465 JGI25160J50197_10024653 106
134 3300003761 Ga0055535_1002560 Ga0055535_10025606 106
135 3300003762 Ga0055542_1015957 Ga0055542_10159573 106
136 3300003771 Ga0055526_1007155 Ga0055526_10071556 106
137 3300003771 Ga0055526_1013227 Ga0055526_10132274 106
138 3300003790 Ga0055528_1000314 Ga0055528_100031432 106
139 3300003791 Ga0055530_10000619 Ga0055530_1000061910 106
140 3300003794 Ga0055531_10048271 Ga0055531_100482712 106
141 3300004625 Ga0055543_1014328 Ga0055543_10143282 106
142 3300005262 Ga0065165_1000182 Ga0065165_100018247 106
143 3300005289 Ga0065704_10000195 Ga0065704_10000195114 106
144 3300005289 Ga0065704_10074748 Ga0065704_100747485 106
145 3300005289 Ga0065704_10077797 Ga0065704_100777977 106
146 3300005327 Ga0070658_10004280 Ga0070658_1000428010 106
147 3300005327 Ga0070658_10020569 Ga0070658_100205692 106
148 3300005327 Ga0070658_10070911 Ga0070658_100709112 106
149 3300005327 Ga0070658_10503165 Ga0070658_105031652 106
150 3300005327 Ga0070658_11923110 Ga0070658_119231101 106
151 3300005328 Ga0070676_10000015 Ga0070676_1000001546 106
152 3300005328 Ga0070676_10025476 Ga0070676_100254763 106
153 3300005328 Ga0070676_10180861 Ga0070676_101808611 106
154 3300005331 Ga0070670_101463292 Ga0070670_1014632921 106
155 3300005331 Ga0070670_101972507 Ga0070670_1019725071 106
156 3300005333 Ga0070677_10234154 Ga0070677_102341542 106
157 3300005334 Ga0068869_100079027 Ga0068869_1000790272 106
158 3300005334 Ga0068869_100079473 Ga0068869_1000794732 106
159 3300005334 Ga0068869_100132816 Ga0068869_1001328161 106
160 3300005334 Ga0068869_100434166 Ga0068869_1004341661 106
161 3300005334 Ga0068869_100820125 Ga0068869_1008201251 106
162 3300005335 Ga0070666_10000042 Ga0070666_1000004219 106
163 3300005335 Ga0070666_10026174 Ga0070666_100261743 106
164 3300005335 Ga0070666_11103400 Ga0070666_111034002 106
165 3300005336 Ga0070680_100003917 Ga0070680_10000391712 106
166 3300005336 Ga0070680_100035400 Ga0070680_1000354006 106
167 3300005338 Ga0068868_100012254 Ga0068868_10001225410 106
168 3300005338 Ga0068868_100060336 Ga0068868_1000603363 106
169 3300005338 Ga0068868_100120710 Ga0068868_1001207102 106
170 3300005338 Ga0068868_100367921 Ga0068868_1003679212 106
171 3300005339 Ga0070660_100028681 Ga0070660_1000286812 106
172 3300005339 Ga0070660_100044533 Ga0070660_1000445334 106
173 3300005339 Ga0070660_100169934 Ga0070660_1001699342 106
174 3300005339 Ga0070660_100432358 Ga0070660_1004323581 106
175 3300005339 Ga0070660_100588345 Ga0070660_1005883452 106
176 3300005339 Ga0070660_101461093 Ga0070660_1014610931 106
177 3300005340 Ga0070689_100747958 Ga0070689_1007479581 106
178 3300005343 Ga0070687_100131270 Ga0070687_1001312702 106
179 3300005344 Ga0070661_101832669 Ga0070661_1018326692 106
180 3300005345 Ga0070692_10516515 Ga0070692_105165152 106
181 3300005354 Ga0070675_100208280 Ga0070675_1002082801 106
182 3300005354 Ga0070675_100709224 Ga0070675_1007092241 106
183 3300005355 Ga0070671_100062516 Ga0070671_1000625162 106
184 3300005355 Ga0070671_100213561 Ga0070671_1002135614 106
185 3300005356 Ga0070674_101515989 Ga0070674_1015159891 106
186 3300005356 Ga0070674_101552583 Ga0070674_1015525831 106
187 3300005364 Ga0070673_100008611 Ga0070673_1000086114 106
188 3300005364 Ga0070673_100399007 Ga0070673_1003990072 106
189 3300005364 Ga0070673_100578329 Ga0070673_1005783291 106
190 3300005365 Ga0070688_100087821 Ga0070688_1000878212 106
191 3300005365 Ga0070688_100281550 Ga0070688_1002815503 106
192 3300005366 Ga0070659_100077889 Ga0070659_1000778892 106
193 3300005366 Ga0070659_100228350 Ga0070659_1002283502 106
194 3300005366 Ga0070659_100521248 Ga0070659_1005212482 106
195 3300005366 Ga0070659_100672469 Ga0070659_1006724691 106
196 3300005367 Ga0070667_100287451 Ga0070667_1002874512 106
197 3300005367 Ga0070667_100502390 Ga0070667_1005023901 106
198 3300005367 Ga0070667_100636892 Ga0070667_1006368922 106
199 3300005367 Ga0070667_100830050 Ga0070667_1008300501 106
200 3300005367 Ga0070667_101094853 Ga0070667_1010948532 106
201 3300005367 Ga0070667_102231714 Ga0070667_1022317141 106
202 3300005435 Ga0070714_100946217 Ga0070714_1009462172 106
203 3300005438 Ga0070701_10088579 Ga0070701_100885792 106
204 3300005441 Ga0070700_100059909 Ga0070700_1000599092 106
205 3300005456 Ga0070678_100007585 Ga0070678_1000075854 106
206 3300005456 Ga0070678_101047122 Ga0070678_1010471221 106
207 3300005457 Ga0070662_100000020 Ga0070662_1000000206 106
208 3300005457 Ga0070662_100127121 Ga0070662_1001271212 106
209 3300005458 Ga0070681_10066604 Ga0070681_100666042 106
210 3300005458 Ga0070681_10178869 Ga0070681_101788693 106
211 3300005458 Ga0070681_10329484 Ga0070681_103294842 106
212 3300005458 Ga0070681_10789987 Ga0070681_107899872 106
213 3300005459 Ga0068867_100005742 Ga0068867_1000057426 106
214 3300005459 Ga0068867_100034465 Ga0068867_1000344654 106
215 3300005459 Ga0068867_100270581 Ga0068867_1002705813 106
216 3300005459 Ga0068867_101069628 Ga0068867_1010696281 106
217 3300005459 Ga0068867_102256935 Ga0068867_1022569352 106
218 3300005466 Ga0070685_10731758 Ga0070685_107317582 106
219 3300005466 Ga0070685_11462197 Ga0070685_114621971 106
220 3300005471 Ga0070698_100000282 Ga0070698_10000028244 106
221 3300005471 Ga0070698_100045076 Ga0070698_1000450762 106
222 3300005530 Ga0070679_100121395 Ga0070679_1001213955 106
223 3300005530 Ga0070679_101000312 Ga0070679_1010003122 106
224 3300005535 Ga0070684_101435525 Ga0070684_1014355251 106
225 3300005539 Ga0068853_100024000 Ga0068853_1000240007 106
226 3300005539 Ga0068853_100025264 Ga0068853_1000252643 106
227 3300005539 Ga0068853_100056937 Ga0068853_1000569373 106
228 3300005539 Ga0068853_100071038 Ga0068853_1000710385 106
229 3300005539 Ga0068853_100661437 Ga0068853_1006614372 106
230 3300005539 Ga0068853_100935982 Ga0068853_1009359822 106
231 3300005539 Ga0068853_101555170 Ga0068853_1015551702 106
232 3300005539 Ga0068853_101860645 Ga0068853_1018606451 106
233 3300005543 Ga0070672_100379391 Ga0070672_1003793912 106
234 3300005543 Ga0070672_100511937 Ga0070672_1005119372 106
235 3300005543 Ga0070672_101942610 Ga0070672_1019426101 106
236 3300005544 Ga0070686_100061045 Ga0070686_1000610451 106
237 3300005548 Ga0070665_100000125 Ga0070665_10000012565 106
238 3300005549 Ga0070704_100517376 Ga0070704_1005173762 106
239 3300005563 Ga0068855_100068805 Ga0068855_1000688056 106
240 3300005563 Ga0068855_100102831 Ga0068855_1001028312 106
241 3300005563 Ga0068855_100127897 Ga0068855_1001278975 106
242 3300005563 Ga0068855_100354440 Ga0068855_1003544403 106
243 3300005563 Ga0068855_100443475 Ga0068855_1004434752 106
244 3300005563 Ga0068855_100527701 Ga0068855_1005277011 106
245 3300005563 Ga0068855_100820970 Ga0068855_1008209702 106
246 3300005563 Ga0068855_100840388 Ga0068855_1008403882 106
247 3300005563 Ga0068855_100951509 Ga0068855_1009515091 106
248 3300005563 Ga0068855_101322690 Ga0068855_1013226902 106
249 3300005564 Ga0070664_100001016 Ga0070664_10000101614 106
250 3300005564 Ga0070664_100723412 Ga0070664_1007234122 106
251 3300005564 Ga0070664_100810250 Ga0070664_1008102502 106
252 3300005564 Ga0070664_101233430 Ga0070664_1012334302 106
253 3300005577 Ga0068857_100517758 Ga0068857_1005177582 106
254 3300005577 Ga0068857_100822873 Ga0068857_1008228732 106
255 3300005577 Ga0068857_102373572 Ga0068857_1023735722 106
256 3300005578 Ga0068854_100028379 Ga0068854_1000283795 106
257 3300005578 Ga0068854_100502831 Ga0068854_1005028312 106
258 3300005614 Ga0068856_100187239 Ga0068856_1001872393 106
259 3300005614 Ga0068856_101713242 Ga0068856_1017132421 106
260 3300005615 Ga0070702_100010581 Ga0070702_1000105816 106
261 3300005616 Ga0068852_100002994 Ga0068852_1000029948 106
262 3300005616 Ga0068852_100078108 Ga0068852_1000781085 106
263 3300005616 Ga0068852_100558452 Ga0068852_1005584522 106
264 3300005616 Ga0068852_101208348 Ga0068852_1012083482 106
265 3300005616 Ga0068852_102428643 Ga0068852_1024286431 106
266 3300005617 Ga0068859_100000768 Ga0068859_10000076817 106
267 3300005617 Ga0068859_100162120 Ga0068859_1001621204 106
268 3300005617 Ga0068859_100353678 Ga0068859_1003536782 106
269 3300005617 Ga0068859_101191439 Ga0068859_1011914392 106
270 3300005618 Ga0068864_100026441 Ga0068864_1000264414 106
271 3300005618 Ga0068864_100366918 Ga0068864_1003669183 106
272 3300005718 Ga0068866_10036252 Ga0068866_100362524 106
273 3300005719 Ga0068861_100453396 Ga0068861_1004533961 106
274 3300005719 Ga0068861_100829985 Ga0068861_1008299852 106
275 3300005719 Ga0068861_101316228 Ga0068861_1013162281 106
276 3300005840 Ga0068870_10085772 Ga0068870_100857723 106
277 3300005840 Ga0068870_10110453 Ga0068870_101104532 106
278 3300005841 Ga0068863_100016956 Ga0068863_10001695610 106
279 3300005841 Ga0068863_100654900 Ga0068863_1006549003 106
280 3300005842 Ga0068858_100057422 Ga0068858_1000574222 106
281 3300005842 Ga0068858_100162391 Ga0068858_1001623912 106
282 3300005842 Ga0068858_100520777 Ga0068858_1005207772 106
283 3300005842 Ga0068858_100621735 Ga0068858_1006217351 106
284 3300005842 Ga0068858_101200109 Ga0068858_1012001091 106
285 3300005842 Ga0068858_102029529 Ga0068858_1020295292 106
286 3300005843 Ga0068860_100000059 Ga0068860_100000059161 106
287 3300005843 Ga0068860_100009276 Ga0068860_1000092764 106
288 3300005843 Ga0068860_100181649 Ga0068860_1001816491 106
289 3300005843 Ga0068860_100472368 Ga0068860_1004723681 106
290 3300005843 Ga0068860_101496403 Ga0068860_1014964032 106
291 3300005843 Ga0068860_102529530 Ga0068860_1025295301 106
292 3300005844 Ga0068862_100009951 Ga0068862_1000099515 106
293 3300005844 Ga0068862_101901888 Ga0068862_1019018882 106
294 3300005844 Ga0068862_102080960 Ga0068862_1020809602 106
295 3300005985 Ga0081539_10144985 Ga0081539_101449852 106
296 3300006195 Ga0075366_10233851 Ga0075366_102338512 106
297 3300006195 Ga0075366_10382866 Ga0075366_103828662 106
298 3300006237 Ga0097621_100000714 Ga0097621_1000007143 106
299 3300006237 Ga0097621_100016633 Ga0097621_1000166334 106
300 3300006237 Ga0097621_100426646 Ga0097621_1004266461 106
301 3300006237 Ga0097621_102401101 Ga0097621_1024011011 106
302 3300006358 Ga0068871_100000046 Ga0068871_10000004610 106
303 3300006358 Ga0068871_100032967 Ga0068871_1000329674 106
304 3300006358 Ga0068871_100083877 Ga0068871_1000838774 106
305 3300006881 Ga0068865_100000041 Ga0068865_10000004127 106
306 3300006931 Ga0097620_100000768 Ga0097620_10000076817 106
307 3300006931 Ga0097620_100162125 Ga0097620_1001621252 106
308 3300006931 Ga0097620_100353680 Ga0097620_1003536802 106
309 3300006931 Ga0097620_101191459 Ga0097620_1011914592 106
310 3300009092 Ga0105250_10578428 Ga0105250_105784281 106
311 3300009093 Ga0105240_10000692 Ga0105240_1000069214 106
312 3300009093 Ga0105240_10091827 Ga0105240_100918273 106
313 3300009093 Ga0105240_10228824 Ga0105240_102288243 106
314 3300009093 Ga0105240_10275776 Ga0105240_102757762 106
315 3300009093 Ga0105240_10377563 Ga0105240_103775633 106
316 3300009093 Ga0105240_11192892 Ga0105240_111928921 106
317 3300009098 Ga0105245_12352170 Ga0105245_123521701 106
318 3300009098 Ga0105245_12489654 Ga0105245_124896542 106
319 3300009101 Ga0105247_10012983 Ga0105247_100129838 106
320 3300009174 Ga0105241_10000217 Ga0105241_100002179 106
321 3300009174 Ga0105241_10000853 Ga0105241_1000085314 106
322 3300009174 Ga0105241_10014129 Ga0105241_100141292 106
323 3300009174 Ga0105241_11081115 Ga0105241_110811152 106
324 3300009176 Ga0105242_10012349 Ga0105242_100123493 106
325 3300009177 Ga0105248_13390872 Ga0105248_133908722 106
326 3300009545 Ga0105237_10001818 Ga0105237_1000181812 106
327 3300009545 Ga0105237_10005378 Ga0105237_100053782 106
328 3300009545 Ga0105237_10064143 Ga0105237_100641436 106
329 3300009545 Ga0105237_10100775 Ga0105237_101007752 106
330 3300009545 Ga0105237_10100974 Ga0105237_101009741 106
331 3300009545 Ga0105237_10174509 Ga0105237_101745093 106
332 3300009545 Ga0105237_11804019 Ga0105237_118040191 106
333 3300009551 Ga0105238_10002068 Ga0105238_100020685 106
334 3300009551 Ga0105238_10049554 Ga0105238_100495542 106
335 3300009553 Ga0105249_10001650 Ga0105249_100016506 106
336 3300009553 Ga0105249_10127295 Ga0105249_101272954 106
337 3300009553 Ga0105249_10354681 Ga0105249_103546811 106
338 3300010375 Ga0105239_10003770 Ga0105239_1000377016 106
339 3300010375 Ga0105239_10004595 Ga0105239_100045955 106
340 3300010375 Ga0105239_10020326 Ga0105239_100203265 106
341 3300010375 Ga0105239_10131045 Ga0105239_101310454 106
342 3300010375 Ga0105239_10230797 Ga0105239_102307973 106
343 3300010375 Ga0105239_10323232 Ga0105239_103232324 106
344 3300010375 Ga0105239_10368999 Ga0105239_103689992 106
345 3300010375 Ga0105239_10369001 Ga0105239_103690012 106
346 3300010375 Ga0105239_12443028 Ga0105239_124430281 106
347 3300011119 Ga0105246_10030380 Ga0105246_100303803 106
348 3300012482 Ga0157318_1010462 Ga0157318_10104621 106
349 3300013100 Ga0157373_10018201 Ga0157373_100182013 106
350 3300013100 Ga0157373_10115049 Ga0157373_101150492 106
351 3300013100 Ga0157373_10451993 Ga0157373_104519931 106
352 3300013100 Ga0157373_10734773 Ga0157373_107347732 106
353 3300013102 Ga0157371_10001084 Ga0157371_100010845 106
354 3300013102 Ga0157371_10005892 Ga0157371_1000589211 106
355 3300013102 Ga0157371_10117844 Ga0157371_101178442 106
356 3300013102 Ga0157371_10200008 Ga0157371_102000083 106
357 3300013102 Ga0157371_10226730 Ga0157371_102267303 106
358 3300013102 Ga0157371_10655107 Ga0157371_106551071 106
359 3300013104 Ga0157370_10004729 Ga0157370_1000472912 106
360 3300013104 Ga0157370_10005230 Ga0157370_100052309 106
361 3300013104 Ga0157370_10007942 Ga0157370_100079429 106
362 3300013104 Ga0157370_10741662 Ga0157370_107416622 106
363 3300013104 Ga0157370_10856618 Ga0157370_108566181 106
364 3300013104 Ga0157370_11746082 Ga0157370_117460821 106
365 3300013105 Ga0157369_10710310 Ga0157369_107103101 106
366 3300013296 Ga0157374_10024480 Ga0157374_100244806 106
367 3300013296 Ga0157374_10120999 Ga0157374_101209994 106
368 3300013296 Ga0157374_10180122 Ga0157374_101801224 106
369 3300013296 Ga0157374_10764166 Ga0157374_107641661 106
370 3300013296 Ga0157374_11519916 Ga0157374_115199162 106
371 3300013297 Ga0157378_10002500 Ga0157378_1000250010 106
372 3300013297 Ga0157378_10010592 Ga0157378_100105925 106
373 3300013297 Ga0157378_10039612 Ga0157378_100396123 106
374 3300013297 Ga0157378_10100133 Ga0157378_101001335 106
375 3300013297 Ga0157378_10438265 Ga0157378_104382652 106
376 3300013297 Ga0157378_10522041 Ga0157378_105220413 106
377 3300013297 Ga0157378_12967902 Ga0157378_129679022 106
378 3300013306 Ga0163162_10000005 Ga0163162_1000000575 106
379 3300013306 Ga0163162_10004176 Ga0163162_100041762 106
380 3300013306 Ga0163162_10025120 Ga0163162_100251203 106
381 3300013306 Ga0163162_10162723 Ga0163162_101627235 106
382 3300013306 Ga0163162_11089836 Ga0163162_110898362 106
383 3300013306 Ga0163162_12934557 Ga0163162_129345571 106
384 3300013307 Ga0157372_10067142 Ga0157372_100671423 106
385 3300013307 Ga0157372_10147956 Ga0157372_101479565 106
386 3300013307 Ga0157372_10279148 Ga0157372_102791485 106
387 3300013307 Ga0157372_10357598 Ga0157372_103575983 106
388 3300013307 Ga0157372_10946520 Ga0157372_109465203 106
389 3300013307 Ga0157372_11516755 Ga0157372_115167551 106
390 3300013307 Ga0157372_11860707 Ga0157372_118607072 106
391 3300013308 Ga0157375_10056217 Ga0157375_100562174 106
392 3300013308 Ga0157375_10076765 Ga0157375_100767654 106
393 3300013308 Ga0157375_10136908 Ga0157375_101369083 106
394 3300013308 Ga0157375_10190225 Ga0157375_101902252 106
395 3300013308 Ga0157375_10327155 Ga0157375_103271552 106
396 3300013308 Ga0157375_12856259 Ga0157375_128562591 106
397 3300013308 Ga0157375_13298652 Ga0157375_132986521 106
398 3300014325 Ga0163163_10044636 Ga0163163_100446362 106
399 3300014325 Ga0163163_10209269 Ga0163163_102092691 106
400 3300014325 Ga0163163_10522091 Ga0163163_105220911 106
401 3300014325 Ga0163163_10933780 Ga0163163_109337801 106
402 3300014326 Ga0157380_10760117 Ga0157380_107601172 106
403 3300014326 Ga0157380_12632947 Ga0157380_126329471 106
404 3300014497 Ga0182008_10000108 Ga0182008_1000010852 106
405 3300014745 Ga0157377_10002130 Ga0157377_100021304 106
406 3300014745 Ga0157377_10013404 Ga0157377_100134043 106
407 3300014745 Ga0157377_10456364 Ga0157377_104563642 106
408 3300014968 Ga0157379_10927927 Ga0157379_109279272 106
409 3300014968 Ga0157379_12485608 Ga0157379_124856082 106
410 3300014969 Ga0157376_10328573 Ga0157376_103285732 106
411 3300014969 Ga0157376_10386112 Ga0157376_103861123 106
412 3300014969 Ga0157376_11477504 Ga0157376_114775042 106
413 3300014969 Ga0157376_12559847 Ga0157376_125598472 106
414 3300015261 Ga0182006_1000109 Ga0182006_10001099 106
415 3300015262 Ga0182007_10037805 Ga0182007_100378053 106
416 3300017792 Ga0163161_10001003 Ga0163161_100010037 106
417 3300017792 Ga0163161_10036486 Ga0163161_100364862 106
418 3300017792 Ga0163161_10168620 Ga0163161_101686203 106
419 3300017792 Ga0163161_10203301 Ga0163161_102033014 106
420 3300017792 Ga0163161_10463349 Ga0163161_104633492 106
421 3300017792 Ga0163161_12065873 Ga0163161_120658731 106
422 3300021361 Ga0213872_10029500 Ga0213872_100295004 106
423 3300021384 Ga0213876_10000722 Ga0213876_1000072213 106
424 3300025233 Ga0209437_100528 Ga0209437_10052824 106
425 3300025242 Ga0209258_100029 Ga0209258_10002947 106
426 3300025246 Ga0209646_1016800 Ga0209646_10168002 106
427 3300025250 Ga0209026_1000890 Ga0209026_10008904 106
428 3300025254 Ga0209148_1000163 Ga0209148_100016320 106
429 3300025258 Ga0209129_1009318 Ga0209129_10093184 106
430 3300025273 Ga0209673_1000016 Ga0209673_100001616 106
431 3300025295 Ga0209564_1005465 Ga0209564_10054652 106
432 3300025297 Ga0209758_1006613 Ga0209758_10066139 106
433 3300025298 Ga0209050_1000124 Ga0209050_1000124162 106
434 3300025302 Ga0207426_1000157 Ga0207426_1000157118 106
435 3300025302 Ga0207426_1000925 Ga0207426_100092517 106
436 3300025303 Ga0209051_1023842 Ga0209051_10238424 106
437 3300025304 Ga0209257_1001535 Ga0209257_100153519 106
438 3300025315 Ga0207697_10354971 Ga0207697_103549712 106
439 3300025893 Ga0207682_10399046 Ga0207682_103990462 106
440 3300025899 Ga0207642_10289659 Ga0207642_102896592 106
441 3300025900 Ga0207710_10043471 Ga0207710_100434713 106
442 3300025901 Ga0207688_10005502 Ga0207688_100055024 106
443 3300025901 Ga0207688_10747440 Ga0207688_107474402 106
444 3300025903 Ga0207680_10000448 Ga0207680_1000044819 106
445 3300025904 Ga0207647_10000117 Ga0207647_1000011720 106
446 3300025904 Ga0207647_10045721 Ga0207647_100457214 106
447 3300025904 Ga0207647_10086213 Ga0207647_100862132 106
448 3300025905 Ga0207685_10314334 Ga0207685_103143342 106
449 3300025907 Ga0207645_10009683 Ga0207645_100096835 106
450 3300025907 Ga0207645_10013933 Ga0207645_100139331 106
451 3300025907 Ga0207645_10088067 Ga0207645_100880674 106
452 3300025908 Ga0207643_10045067 Ga0207643_100450672 106
453 3300025908 Ga0207643_10138292 Ga0207643_101382923 106
454 3300025909 Ga0207705_10000623 Ga0207705_100006237 106
455 3300025909 Ga0207705_10078920 Ga0207705_100789204 106
456 3300025909 Ga0207705_10085635 Ga0207705_100856355 106
457 3300025909 Ga0207705_10179389 Ga0207705_101793893 106
458 3300025909 Ga0207705_11286318 Ga0207705_112863181 106
459 3300025911 Ga0207654_10000524 Ga0207654_1000052419 106
460 3300025911 Ga0207654_10008858 Ga0207654_100088588 106
461 3300025911 Ga0207654_10011575 Ga0207654_100115754 106
462 3300025912 Ga0207707_10343059 Ga0207707_103430593 106
463 3300025912 Ga0207707_11427569 Ga0207707_114275691 106
464 3300025913 Ga0207695_10000020 Ga0207695_1000002015 106
465 3300025913 Ga0207695_10008260 Ga0207695_1000826013 106
466 3300025913 Ga0207695_10048139 Ga0207695_100481393 106
467 3300025913 Ga0207695_10895876 Ga0207695_108958762 106
468 3300025914 Ga0207671_10002893 Ga0207671_1000289312 106
469 3300025914 Ga0207671_10005501 Ga0207671_100055014 106
470 3300025914 Ga0207671_10008195 Ga0207671_100081959 106
471 3300025914 Ga0207671_10022597 Ga0207671_100225975 106
472 3300025914 Ga0207671_10027556 Ga0207671_100275561 106
473 3300025914 Ga0207671_10119370 Ga0207671_101193703 106
474 3300025914 Ga0207671_10244524 Ga0207671_102445242 106
475 3300025914 Ga0207671_11239614 Ga0207671_112396142 106
476 3300025916 Ga0207663_10540253 Ga0207663_105402531 106
477 3300025917 Ga0207660_10035604 Ga0207660_100356046 106
478 3300025918 Ga0207662_10041489 Ga0207662_100414896 106
479 3300025919 Ga0207657_10012327 Ga0207657_1001232710 106
480 3300025919 Ga0207657_10268913 Ga0207657_102689133 106
481 3300025919 Ga0207657_10535440 Ga0207657_105354402 106
482 3300025919 Ga0207657_10800976 Ga0207657_108009761 106
483 3300025919 Ga0207657_10912900 Ga0207657_109129001 106
484 3300025921 Ga0207652_11877545 Ga0207652_118775451 106
485 3300025922 Ga0207646_11096909 Ga0207646_110969092 106
486 3300025923 Ga0207681_10585725 Ga0207681_105857252 106
487 3300025923 Ga0207681_11587396 Ga0207681_115873962 106
488 3300025924 Ga0207694_10035339 Ga0207694_100353392 106
489 3300025924 Ga0207694_10072542 Ga0207694_100725422 106
490 3300025926 Ga0207659_10239400 Ga0207659_102394002 106
491 3300025927 Ga0207687_11720539 Ga0207687_117205392 106
492 3300025929 Ga0207664_10954863 Ga0207664_109548632 106
493 3300025931 Ga0207644_10072589 Ga0207644_100725893 106
494 3300025931 Ga0207644_10186173 Ga0207644_101861734 106
495 3300025931 Ga0207644_10600633 Ga0207644_106006331 106
496 3300025932 Ga0207690_10220436 Ga0207690_102204361 106
497 3300025932 Ga0207690_10320013 Ga0207690_103200131 106
498 3300025932 Ga0207690_10401022 Ga0207690_104010223 106
499 3300025932 Ga0207690_10619021 Ga0207690_106190212 106
500 3300025933 Ga0207706_10000044 Ga0207706_1000004429 106
501 3300025933 Ga0207706_10020437 Ga0207706_100204371 106
502 3300025934 Ga0207686_10082882 Ga0207686_100828823 106
503 3300025937 Ga0207669_11404192 Ga0207669_114041922 106
504 3300025938 Ga0207704_10000061 Ga0207704_1000006145 106
505 3300025939 Ga0207665_10693511 Ga0207665_106935111 106
506 3300025940 Ga0207691_10009816 Ga0207691_100098167 106
507 3300025940 Ga0207691_10195375 Ga0207691_101953752 106
508 3300025940 Ga0207691_10240574 Ga0207691_102405743 106
509 3300025941 Ga0207711_11112052 Ga0207711_111120521 106
510 3300025942 Ga0207689_10064946 Ga0207689_100649462 106
511 3300025942 Ga0207689_10095465 Ga0207689_100954652 106
512 3300025942 Ga0207689_10164130 Ga0207689_101641304 106
513 3300025942 Ga0207689_10350892 Ga0207689_103508922 106
514 3300025942 Ga0207689_10356690 Ga0207689_103566902 106
515 3300025944 Ga0207661_10656543 Ga0207661_106565431 106
516 3300025945 Ga0207679_10267921 Ga0207679_102679213 106
517 3300025945 Ga0207679_10670249 Ga0207679_106702491 106
518 3300025945 Ga0207679_11258831 Ga0207679_112588311 106
519 3300025949 Ga0207667_10081641 Ga0207667_100816415 106
520 3300025949 Ga0207667_10129790 Ga0207667_101297903 106
521 3300025949 Ga0207667_10187634 Ga0207667_101876342 106
522 3300025949 Ga0207667_10798120 Ga0207667_107981201 106
523 3300025949 Ga0207667_11339039 Ga0207667_113390391 106
524 3300025960 Ga0207651_10004446 Ga0207651_100044464 106
525 3300025960 Ga0207651_10689755 Ga0207651_106897551 106
526 3300025961 Ga0207712_10065033 Ga0207712_100650333 106
527 3300025961 Ga0207712_10114889 Ga0207712_101148893 106
528 3300025961 Ga0207712_10196649 Ga0207712_101966493 106
529 3300025961 Ga0207712_10449328 Ga0207712_104493283 106
530 3300025961 Ga0207712_12000853 Ga0207712_120008531 106
531 3300025972 Ga0207668_11703580 Ga0207668_117035801 106
532 3300025972 Ga0207668_11836933 Ga0207668_118369332 106
533 3300025972 Ga0207668_11994339 Ga0207668_119943392 106
534 3300025981 Ga0207640_10072546 Ga0207640_100725465 106
535 3300025981 Ga0207640_10628518 Ga0207640_106285182 106
536 3300025986 Ga0207658_10067979 Ga0207658_100679793 106
537 3300025986 Ga0207658_10154262 Ga0207658_101542623 106
538 3300025986 Ga0207658_10303417 Ga0207658_103034172 106
539 3300025986 Ga0207658_10390442 Ga0207658_103904423 106
540 3300025986 Ga0207658_11345465 Ga0207658_113454652 106
541 3300025986 Ga0207658_11621991 Ga0207658_116219911 106
542 3300025986 Ga0207658_11873631 Ga0207658_118736311 106
543 3300026023 Ga0207677_10037202 Ga0207677_100372026 106
544 3300026023 Ga0207677_10057504 Ga0207677_100575042 106
545 3300026023 Ga0207677_10077911 Ga0207677_100779112 106
546 3300026035 Ga0207703_10006254 Ga0207703_100062549 106
547 3300026035 Ga0207703_10331355 Ga0207703_103313553 106
548 3300026035 Ga0207703_10484819 Ga0207703_104848192 106
549 3300026035 Ga0207703_10786046 Ga0207703_107860462 106
550 3300026035 Ga0207703_10926305 Ga0207703_109263052 106
551 3300026035 Ga0207703_11666769 Ga0207703_116667692 106
552 3300026035 Ga0207703_11719022 Ga0207703_117190222 106
553 3300026035 Ga0207703_11837569 Ga0207703_118375691 106
554 3300026035 Ga0207703_12207335 Ga0207703_122073351 106
555 3300026041 Ga0207639_10010963 Ga0207639_100109638 106
556 3300026041 Ga0207639_10012012 Ga0207639_100120125 106
557 3300026041 Ga0207639_10115885 Ga0207639_101158852 106
558 3300026041 Ga0207639_10166030 Ga0207639_101660301 106
559 3300026041 Ga0207639_10329602 Ga0207639_103296023 106
560 3300026041 Ga0207639_10331843 Ga0207639_103318432 106
561 3300026067 Ga0207678_11809054 Ga0207678_118090542 106
562 3300026075 Ga0207708_10079070 Ga0207708_100790703 106
563 3300026075 Ga0207708_11173679 Ga0207708_111736791 106
564 3300026075 Ga0207708_11552873 Ga0207708_115528732 106
565 3300026075 Ga0207708_11909248 Ga0207708_119092481 106
566 3300026078 Ga0207702_11095342 Ga0207702_110953421 106
567 3300026078 Ga0207702_12052422 Ga0207702_120524222 106
568 3300026088 Ga0207641_10005736 Ga0207641_100057362 106
569 3300026088 Ga0207641_12612183 Ga0207641_126121831 106
570 3300026089 Ga0207648_10002338 Ga0207648_1000233813 106
571 3300026089 Ga0207648_10052614 Ga0207648_100526145 106
572 3300026089 Ga0207648_10286460 Ga0207648_102864602 106
573 3300026089 Ga0207648_11950885 Ga0207648_119508852 106
574 3300026095 Ga0207676_10004483 Ga0207676_100044839 106
575 3300026095 Ga0207676_11291134 Ga0207676_112911341 106
576 3300026116 Ga0207674_10023607 Ga0207674_100236071 106
577 3300026116 Ga0207674_10156717 Ga0207674_101567174 106
578 3300026116 Ga0207674_10353023 Ga0207674_103530233 106
579 3300026116 Ga0207674_10497460 Ga0207674_104974601 106
580 3300026116 Ga0207674_11042722 Ga0207674_110427221 106
581 3300026118 Ga0207675_100339515 Ga0207675_1003395153 106
582 3300026118 Ga0207675_100937586 Ga0207675_1009375862 106
583 3300026118 Ga0207675_101417037 Ga0207675_1014170372 106
584 3300026118 Ga0207675_101789605 Ga0207675_1017896052 106
585 3300026121 Ga0207683_10031283 Ga0207683_100312832 106
586 3300026121 Ga0207683_10215435 Ga0207683_102154354 106
587 3300026121 Ga0207683_10613569 Ga0207683_106135692 106
588 3300026142 Ga0207698_10121920 Ga0207698_101219202 106
589 3300026142 Ga0207698_10820847 Ga0207698_108208471 106
590 3300026142 Ga0207698_10834298 Ga0207698_108342982 106
591 3300026142 Ga0207698_10910885 Ga0207698_109108852 106
592 3300026142 Ga0207698_12099353 Ga0207698_120993532 106
593 3300028379 Ga0268266_10000132 Ga0268266_1000013253 106
594 3300028379 Ga0268266_10637558 Ga0268266_106375581 106
595 3300028380 Ga0268265_10013493 Ga0268265_100134931 106
596 3300028380 Ga0268265_11442638 Ga0268265_114426381 106
597 3300028381 Ga0268264_10000015 Ga0268264_10000015312 106
598 3300028381 Ga0268264_10383701 Ga0268264_103837011 106
599 3300028381 Ga0268264_10945203 Ga0268264_109452031 106
600 3300028381 Ga0268264_11342442 Ga0268264_113424422 106
601 3300028573 Ga0265334_10159572 Ga0265334_101595722 106
602 3300028653 Ga0265323_10000512 Ga0265323_100005129 106
603 3300028786 Ga0307517_10007381 Ga0307517_100073816 106
604 3300028794 Ga0307515_10064321 Ga0307515_100643212 106
605 3300028800 Ga0265338_10084234 Ga0265338_100842343 106
606 3300028800 Ga0265338_10517135 Ga0265338_105171351 106
607 3300030744 Ga0316181_1087376 Ga0316181_10873762 106
608 3300031235 Ga0265330_10104767 Ga0265330_101047671 106
609 3300031251 Ga0265327_10000055 Ga0265327_1000005525 106
610 3300031251 Ga0265327_10064368 Ga0265327_100643681 106
611 3300031251 Ga0265327_10070414 Ga0265327_100704141 106
612 3300031344 Ga0265316_10001184 Ga0265316_1000118417 106
613 3300031507 Ga0307509_10228133 Ga0307509_102281333 106
614 3300031507 Ga0307509_10420174 Ga0307509_104201743 106
615 3300031507 Ga0307509_10492518 Ga0307509_104925182 106
616 3300031711 Ga0265314_10046768 Ga0265314_100467684 106
617 3300031852 Ga0307410_11479517 Ga0307410_114795171 106
618 3300031901 Ga0307406_10611011 Ga0307406_106110112 106
619 3300031911 Ga0307412_11208901 Ga0307412_112089012 106
620 3300031911 Ga0307412_12098833 Ga0307412_120988331 106
621 3300031995 Ga0307409_101429972 Ga0307409_1014299721 106
622 3300032002 Ga0307416_100224981 Ga0307416_1002249814 106
623 3300032002 Ga0307416_101593428 Ga0307416_1015934282 106
624 3300032004 Ga0307414_10084723 Ga0307414_100847232 106
625 3300032004 Ga0307414_10286507 Ga0307414_102865072 106
626 3300032005 Ga0307411_11966865 Ga0307411_119668652 106
627 3300033180 Ga0307510_10013796 Ga0307510_100137967 106
628 3300035113 Ga0373936_0230431 Ga0373936_0230431_426_749 106
629 3300035114 Ga0373939_0215478 Ga0373939_0215478_324_644 106
630 3300035115 Ga0373941_0232872 Ga0373941_0232872_203_526 106
631 3300037312 Ga0395899_0000021 Ga0395899_0000021_223364_223684 106
632 3300037312 Ga0395899_0009228 Ga0395899_0009228_5582_5905 106
633 3300037312 Ga0395899_0026616 Ga0395899_0026616_1750_2073 106
634 3300037418 Ga0395900_0000494 Ga0395900_0000494_4944_5267 106
635 3300037418 Ga0395900_0003517 Ga0395900_0003517_15745_16065 106
636 3300037418 Ga0395900_0004982 Ga0395900_0004982_6399_6722 106
637 3300037418 Ga0395900_0279390 Ga0395900_0279390_463_783 106
638 3300037466 Ga0395898_0004102 Ga0395898_0004102_11411_11731 106
639 3300037466 Ga0395898_0080656 Ga0395898_0080656_203_526 106
640 3300037471 Ga0395905_0000757 Ga0395905_0000757_24133_24456 106
641 3300037471 Ga0395905_0004960 Ga0395905_0004960_10727_11050 106
642 3300037471 Ga0395905_0017163 Ga0395905_0017163_5468_5788 106
643 3300037471 Ga0395905_0485689 Ga0395905_0485689_168_491 106
644 3300038443 Ga0395901_0002107 Ga0395901_0002107_19039_19362 106
645 3300038443 Ga0395901_0003012 Ga0395901_0003012_11294_11617 106
646 3300038443 Ga0395901_0021304 Ga0395901_0021304_2973_3293 106
647 3300039437 Ga0436365_1664331 Ga0436365_1664331_11018_11341 106
648 3300039447 Ga0436361_0635236 Ga0436361_0635236_3070_3399 106
649 3300041406 Ga0439439_0214470 Ga0439439_0214470_109_432 106
650 3300041411 Ga0439466_0139579 Ga0439466_0139579_137_484 106
651 3300041452 Ga0451793_0462005 Ga0451793_0462005_32_352 106
652 3300041463 Ga0451804_0543671 Ga0451804_0543671_81_404 106
653 3300041486 Ga0451807_1973634 Ga0451807_1973634_107_430 106
654 3300041491 Ga0451833_0971787 Ga0451833_0971787_159_485 106
655 3300041494 Ga0451837_0256521 Ga0451837_0256521_165_488 106
656 3300041498 Ga0451841_1049833 Ga0451841_1049833_55_375 106
657 3300041501 Ga0451845_0572086 Ga0451845_0572086_118_450 106
658 3300041507 Ga0451851_0947342 Ga0451851_0947342_53_376 106
659 3300041507 Ga0451851_1259567 Ga0451851_1259567_181_501 106
660 3300041512 Ga0451853_0174956 Ga0451853_0174956_612_938 106
661 3300042002 Ga0439442_026011 Ga0439442_026011_63_386 106
662 3300042006 Ga0439432_128270 Ga0439432_128270_337_684 106
663 3300042007 Ga0439449_0126557 Ga0439449_0126557_246_569 106
664 3300042014 Ga0439457_044691 Ga0439457_044691_174_521 106
665 3300042128 Ga0450897_050347 Ga0450897_050347_71_418 106
666 3300042134 Ga0450898_005402 Ga0450898_005402_107_454 106
667 3300042135 Ga0450899_009235 Ga0450899_009235_483_830 106
668 3300042876 Ga0451577_0023194 Ga0451577_0023194_4591_4917 106
669 3300044658 Ga0466972_0301302 Ga0466972_0301302_367_693 106
670 3300044658 Ga0466972_0554611 Ga0466972_0554611_44_382 106
671 3300044712 Ga0453684_0002051 Ga0453684_0002051_17170_17496 106
672 3300044712 Ga0453684_0055025 Ga0453684_0055025_3575_3898 106
673 3300044765 Ga0466970_0128696 Ga0466970_0128696_738_1064 106
674 3300045049 Ga0466959_0018495 Ga0466959_0018495_465_788 106
675 3300045049 Ga0466959_0288998 Ga0466959_0288998_391_714 106
676 3300045051 Ga0451576_0015476 Ga0451576_0015476_5931_6257 106
677 3300045051 Ga0451576_0189687 Ga0451576_0189687_1159_1479 106
678 3300045051 Ga0451576_2609771 Ga0451576_2609771_124_447 106
679 3300045836 Ga0466958_0386462 Ga0466958_0386462_310_633 106
680 3300046460 Ga0495638_0000008 Ga0495638_0000008_129276_129608 106
681 3300046460 Ga0495638_0414301 Ga0495638_0414301_358_681 106
682 3300046462 Ga0495651_0468027 Ga0495651_0468027_23_343 106
683 3300046471 Ga0495650_0019537 Ga0495650_0019537_1522_1845 106
684 3300046507 Ga0495606_0058371 Ga0495606_0058371_1836_2159 106
685 3300046514 Ga0495618_0850045 Ga0495618_0850045_132_455 106
686 3300046523 Ga0495644_0096453 Ga0495644_0096453_83_403 106
687 3300046529 Ga0495652_0901129 Ga0495652_0901129_190_513 106
688 3300046557 Ga0495622_0211461 Ga0495622_0211461_203_523 106
689 3300046616 Ga0495668_0001373 Ga0495668_0001373_11155_11478 106
690 3300046642 Ga0495634_0502991 Ga0495634_0502991_103_453 106
691 3300046648 Ga0495611_0120339 Ga0495611_0120339_154_477 106
692 3300046660 Ga0495625_0118844 Ga0495625_0118844_604_927 106
693 3300046665 Ga0495661_0612527 Ga0495661_0612527_118_441 106
694 3300046683 Ga0495658_0945769 Ga0495658_0945769_158_481 106
695 3300047315 Ga0495581_0903691 Ga0495581_0903691_78_407 106
696 3300047319 Ga0495674_1254327 Ga0495674_1254327_224_547 106
697 3300047320 Ga0495672_0008239 Ga0495672_0008239_2755_3078 106
698 3300047447 Ga0495685_090765 Ga0495685_090765_644_967 106
699 3300047472 Ga0495686_0001370 Ga0495686_0001370_24611_24931 106
700 3300048911 Ga0496108_0707060 Ga0496108_0707060_461_784 106
701 3300048918 Ga0496115_0926906 Ga0496115_0926906_292_615 106
702 3300048925 Ga0496122_0006972 Ga0496122_0006972_2135_2455 106
703 3300048926 Ga0496123_0028687 Ga0496123_0028687_3337_3657 106
704 3300048928 Ga0496125_0028469 Ga0496125_0028469_2563_2883 106
705 3300049571 Ga0501034_0138376 Ga0501034_0138376_404_727 106
706 3300049574 Ga0501038_0090718 Ga0501038_0090718_1490_1813 106
707 3300049575 Ga0501039_0375002 Ga0501039_0375002_457_780 106
708 3300049579 Ga0501043_0311516 Ga0501043_0311516_568_891 106
709 3300049589 Ga0501073_0820270 Ga0501073_0820270_265_591 106
710 3300049649 Ga0501198_105283 Ga0501198_105283_45_365 106
711 3300049659 Ga0501214_042452 Ga0501214_042452_172_492 106
712 3300049661 Ga0501217_164696 Ga0501217_164696_319_639 106
713 3300049663 Ga0501223_028400 Ga0501223_028400_723_1043 106
714 3300049664 Ga0501224_042369 Ga0501224_042369_185_505 106
715 3300049668 Ga0501233_148642 Ga0501233_148642_275_595 106
716 3300049671 Ga0501238_033146 Ga0501238_033146_35_358 106
717 3300049680 Ga0501250_060581 Ga0501250_060581_151_471 106
718 3300049686 Ga0501257_022697 Ga0501257_022697_573_893 106
719 3300049704 Ga0501221_128947 Ga0501221_128947_110_430 106
720 3300049707 Ga0501234_052612 Ga0501234_052612_342_662 106
721 3300049823 Ga0501044_0205041 Ga0501044_0205041_787_1110 106
722 3300050493 nmdc:mga0k408_116299_c1 nmdc:mga0k408_116299_c1_431_760 106
723 3300050496 nmdc:mga07m45_168367_c1 nmdc:mga07m45_168367_c1_137_463 106
724 3300050511 nmdc:mga08y16_945191_c1 nmdc:mga08y16_945191_c1_242_565 106
725 3300050511 nmdc:mga08y16_97154_c1 nmdc:mga08y16_97154_c1_160_513 106
726 3300053080 Ga0500635_0000568 Ga0500635_0000568_5285_5605 106
727 3300053086 Ga0500578_0000024 Ga0500578_0000024_68332_68652 106
728 3300053086 Ga0500578_0295929 Ga0500578_0295929_516_836 106
729 3300053088 Ga0500644_0000169 Ga0500644_0000169_34465_34785 106
730 3300053088 Ga0500644_0084978 Ga0500644_0084978_402_728 106
731 3300053089 Ga0500581_213282 Ga0500581_213282_161_484 106
732 3300053089 Ga0500581_237668 Ga0500581_237668_347_670 106
733 3300053091 Ga0500647_0179297 Ga0500647_0179297_617_940 106
734 3300053092 Ga0500583_0506470 Ga0500583_0506470_144_464 106
735 3300053098 Ga0500650_0176658 Ga0500650_0176658_307_639 106
736 3300053108 Ga0500562_000078 Ga0500562_000078_80_403 106
737 3300053116 Ga0500592_068298 Ga0500592_068298_107_427 106
738 3300053121 Ga0500607_025589 Ga0500607_025589_1037_1357 106
739 3300053122 Ga0500608_095814 Ga0500608_095814_287_610 106
740 3300053125 Ga0500618_000004 Ga0500618_000004_155435_155758 106
741 3300053130 Ga0500642_0146371 Ga0500642_0146371_738_1064 106
742 3300053139 Ga0500568_0028977 Ga0500568_0028977_697_1020 106
743 3300053139 Ga0500568_0240949 Ga0500568_0240949_20_343 106
744 3300053148 Ga0500590_092581 Ga0500590_092581_496_816 106
745 3300053153 Ga0500616_0000003 Ga0500616_0000003_408551_408883 106
746 3300053153 Ga0500616_0004260 Ga0500616_0004260_7654_7977 106
747 3300053153 Ga0500616_0012071 Ga0500616_0012071_2537_2863 106
748 3300053153 Ga0500616_0102737 Ga0500616_0102737_539_859 106
749 3300053153 Ga0500616_0146391 Ga0500616_0146391_660_983 106
750 3300053153 Ga0500616_0219205 Ga0500616_0219205_376_696 106
751 3300053156 Ga0500622_0000870 Ga0500622_0000870_22939_23262 106
752 3300053156 Ga0500622_0001076 Ga0500622_0001076_18314_18640 106
753 3300053156 Ga0500622_0243796 Ga0500622_0243796_46_378 106
754 3300053160 Ga0500633_0003460 Ga0500633_0003460_2049_2369 106
755 3300053161 Ga0500634_0050744 Ga0500634_0050744_1251_1571 106
756 3300053730 Ga0500645_020997 Ga0500645_020997_666_989 106
757 3300053730 Ga0500645_143683 Ga0500645_143683_215_538 106
758 3300053733 Ga0500552_034013 Ga0500552_034013_251_574 106
759 3300061719 Ga0466962_0058515 Ga0466962_0058515_1131_1454 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

32

78

0.98

PF12840

HTH_20

Helix-turn-helix domain

30

79

0.96

PF12802

MarR_2

MarR family

32

83

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9358 6 79
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9319 8 88
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.924 8 82
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9156 8 82
6j0e-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9151 6 79
ID Description Score Start End Superfamily
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9838 8 83 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9573 13 69 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9428 8 84 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 8 80 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9257 13 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A524QVP0-F1-model_v4 ArsR family transcriptional regulator 0.9872 8 79 GO:0003700
AF-Q9A415-F1-model_v4 Transcriptional regulator, ArsR family 0.979 7 88 GO:0003700
AF-A0A6N4EDV7-F1-model_v4 deleted 0.9788 1 78
AF-A0A147DX53-F1-model_v4 deleted 0.9762 7 85
AF-A0A089HR62-F1-model_v4 ArsR family transcriptional regulator 0.9748 8 86 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
90.87 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map