F479469

General Info

Members Datasets Scaffolds Average Seq Length
759 394 1518 161

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101352214|Ga0070680_1013522141
Length 187
Sequence MPATSAGMMEMRMPPFESLPYRACAGMMVLNRDSLAFVGRRASGPEHIDATHVWQMPQGGIDDGEKPYPAALRELYEETNIKSVEKLGEIRGWLVYDIPKKIGSKAWSGKYRGQTQKWYALRFIGNDSEIDVENPAGGHKPEFIEWRWEPMENLPDLVVPFKRKTYERVAKAFSKPAQRKRKPRTKR

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
98 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
110 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
126 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
127 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
128 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
225 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
230 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
234 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
235 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
239 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
246 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
247 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
248 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
249 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
258 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
259 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
260 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
261 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
262 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
263 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
264 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
265 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
268 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
269 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
270 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
300 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
304 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
307 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
310 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
311 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
312 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
313 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
314 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
319 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
327 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
383 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
384 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
385 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
386 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
387 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
388 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 0
Rhizoplane 8.7
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101352214 3300005336 Bacteria 617
2 RicEn_FSXC51602_g1 2010549000 Bacteria 811
3 2214772984 2209111006 Bacteria 12351
4 ARcpr5oldR_c000376 3300000041 Bacteria 6277
5 ARSoilYngRDRAFT_c00377 3300000042 Bacteria 6077
6 ARcpr5yngRDRAFT_c000358 3300000043 Bacteria 6071
7 ARSoilOldRDRAFT_c000321 3300000044 Bacteria 6329
8 ARCol0oldRDRAFT_c00150 3300000045 Bacteria 6281
9 ARCol0yngRDRAFT_1000371 3300000652 Bacteria 6274
10 JGI24752J21851_1005564 3300001976 Bacteria 1644
11 JGI24746J21847_1001703 3300001977 Bacteria 3519
12 JGI24747J21853_1007109 3300001978 Bacteria 1071
13 JGI24737J22298_10004265 3300001990 Bacteria 4993
14 JGI24750J21931_1000505 3300002070 Bacteria 6123
15 JGI24745J21846_1001173 3300002073 Bacteria 2506
16 JGI24748J21848_1000728 3300002074 Bacteria 3562
17 JGI24738J21930_10000064 3300002075 Bacteria 22266
18 JGI24749J21850_1002851 3300002076 Bacteria 2420
19 JGI24749J21850_1004988 3300002076 Bacteria 1861
20 JGI24035J26624_1001283 3300002126 Bacteria 2383
21 JGI24033J26618_1001199 3300002155 Bacteria 2534
22 JGI24034J26672_10000317 3300002239 Bacteria 6267
23 JGI24742J22300_10000416 3300002244 Bacteria 6311
24 JGI24751J29686_10019620 3300002459 Bacteria 1400
25 JGI25153J46596_10003510 3300003215 Bacteria 8751
26 Ga0065712_10005081 3300005290 Bacteria 4890
27 Ga0065712_10013426 3300005290 Bacteria 2076
28 Ga0065712_10070998 3300005290 Bacteria 5527
29 Ga0065715_10004000 3300005293 Bacteria 6148
30 Ga0065707_10010312 3300005295 Bacteria 2878
31 Ga0070658_10846538 3300005327 Bacteria 795
32 Ga0070658_10863200 3300005327 Bacteria 787
33 Ga0070676_10011938 3300005328 Bacteria 4735
34 Ga0070676_10084734 3300005328 Bacteria 1930
35 Ga0070676_10096249 3300005328 Bacteria 1822
36 Ga0070683_100005169 3300005329 Bacteria 10858
37 Ga0070683_100093341 3300005329 Bacteria 2827
38 Ga0070683_100403563 3300005329 Bacteria 1304
39 Ga0070690_100088865 3300005330 Bacteria 2032
40 Ga0070690_100168693 3300005330 Bacteria 1505
41 Ga0070690_100193176 3300005330 Bacteria 1412
42 Ga0070670_100057070 3300005331 Bacteria 3352
43 Ga0070670_100088659 3300005331 Bacteria 2659
44 Ga0070670_100214371 3300005331 Bacteria 1674
45 Ga0070677_10019778 3300005333 Bacteria 2443
46 Ga0068869_100135127 3300005334 Bacteria 1899
47 Ga0070666_10010052 3300005335 Bacteria 5907
48 Ga0070666_10077373 3300005335 Bacteria 2271
49 Ga0070666_10696746 3300005335 Bacteria 745
50 Ga0070680_100045280 3300005336 Bacteria 3576
51 Ga0070680_100068338 3300005336 Bacteria 2916
52 Ga0070680_100261613 3300005336 Bacteria 1464
53 Ga0070682_100009542 3300005337 Bacteria 5492
54 Ga0070682_100056461 3300005337 Bacteria 2469
55 Ga0070682_100149371 3300005337 Bacteria 1602
56 Ga0070682_100287801 3300005337 Bacteria 1200
57 Ga0068868_100168843 3300005338 Bacteria 1810
58 Ga0068868_100313737 3300005338 Bacteria 1334
59 Ga0070660_100037330 3300005339 Bacteria 3683
60 Ga0070660_100087365 3300005339 Bacteria 2454
61 Ga0070689_100014470 3300005340 Bacteria 5731
62 Ga0070689_100037770 3300005340 Bacteria 3693
63 Ga0070691_10007611 3300005341 Bacteria 4965
64 Ga0070687_100012602 3300005343 Bacteria 3739
65 Ga0070687_100517771 3300005343 Bacteria 806
66 Ga0070661_100015266 3300005344 Bacteria 5420
67 Ga0070692_10000468 3300005345 Bacteria 12374
68 Ga0070668_100074575 3300005347 Bacteria 2647
69 Ga0070669_100011957 3300005353 Bacteria 6160
70 Ga0070675_100098935 3300005354 Bacteria 2454
71 Ga0070671_100002503 3300005355 Bacteria 14229
72 Ga0070671_100189049 3300005355 Bacteria 1745
73 Ga0070674_100007283 3300005356 Bacteria 6516
74 Ga0070673_100001494 3300005364 Bacteria 13725
75 Ga0070673_100156689 3300005364 Bacteria 1933
76 Ga0070688_100034590 3300005365 Bacteria 3062
77 Ga0070688_100194992 3300005365 Bacteria 1413
78 Ga0070659_100046147 3300005366 Bacteria 3415
79 Ga0070659_100164521 3300005366 Bacteria 1815
80 Ga0070667_100009726 3300005367 Bacteria 7971
81 Ga0070667_100075256 3300005367 Bacteria 2882
82 Ga0070667_100076055 3300005367 Bacteria 2866
83 Ga0070667_100158400 3300005367 Bacteria 1993
84 Ga0070709_10013606 3300005434 Bacteria 4578
85 Ga0070709_10561421 3300005434 Bacteria 875
86 Ga0070714_100204038 3300005435 Bacteria 1810
87 Ga0070714_100283485 3300005435 Bacteria 1540
88 Ga0070713_100006436 3300005436 Bacteria 8144
89 Ga0070713_101071481 3300005436 Bacteria 779
90 Ga0070710_10022863 3300005437 Bacteria 3277
91 Ga0070710_10716271 3300005437 Bacteria 707
92 Ga0070701_10041877 3300005438 Bacteria 2335
93 Ga0070701_10107437 3300005438 Bacteria 1554
94 Ga0070711_100022460 3300005439 Bacteria 4090
95 Ga0070711_100022906 3300005439 Bacteria 4055
96 Ga0070711_100113378 3300005439 Bacteria 1993
97 Ga0070705_100008212 3300005440 Bacteria 5166
98 Ga0070705_100202163 3300005440 Bacteria 1363
99 Ga0070700_100054048 3300005441 Bacteria 2508
100 Ga0070694_100052810 3300005444 Bacteria 2748
101 Ga0070708_100380081 3300005445 Bacteria 1332
102 Ga0070663_100073108 3300005455 Bacteria 2500
103 Ga0070663_100099301 3300005455 Bacteria 2170
104 Ga0070663_100201542 3300005455 Bacteria 1553
105 Ga0070678_100104169 3300005456 Bacteria 2206
106 Ga0070678_100119184 3300005456 Bacteria 2078
107 Ga0070662_100743204 3300005457 Bacteria 832
108 Ga0070662_100903017 3300005457 Bacteria 754
109 Ga0070662_101308903 3300005457 Bacteria 624
110 Ga0070681_10014847 3300005458 Bacteria 7744
111 Ga0070681_10032350 3300005458 Bacteria 5248
112 Ga0070681_10086218 3300005458 Bacteria 3093
113 Ga0070681_10140281 3300005458 Bacteria 2347
114 Ga0070681_10302965 3300005458 Bacteria 1507
115 Ga0070681_10500089 3300005458 Bacteria 1129
116 Ga0070681_10508573 3300005458 Bacteria 1118
117 Ga0070685_10001432 3300005466 Bacteria 12514
118 Ga0070679_100030767 3300005530 Bacteria 5302
119 Ga0070679_100141727 3300005530 Bacteria 2383
120 Ga0070679_100484173 3300005530 Bacteria 1181
121 Ga0070684_100003138 3300005535 Bacteria 12335
122 Ga0070684_100177999 3300005535 Bacteria 1933
123 Ga0070672_100003940 3300005543 Bacteria 9678
124 Ga0070672_100310816 3300005543 Bacteria 1338
125 Ga0070686_100002212 3300005544 Bacteria 10746
126 Ga0070686_100008334 3300005544 Bacteria 5803
127 Ga0070686_100674657 3300005544 Bacteria 822
128 Ga0070695_100007770 3300005545 Bacteria 6353
129 Ga0070695_100012503 3300005545 Bacteria 5094
130 Ga0070695_100110250 3300005545 Bacteria 1866
131 Ga0070696_100496658 3300005546 Bacteria 970
132 Ga0070693_100073536 3300005547 Bacteria 2019
133 Ga0070693_100107953 3300005547 Bacteria 1707
134 Ga0070693_100162872 3300005547 Bacteria 1422
135 Ga0070693_100309571 3300005547 Bacteria 1067
136 Ga0070665_100151970 3300005548 Bacteria 2318
137 Ga0070704_100368800 3300005549 Bacteria 1217
138 Ga0070704_100488368 3300005549 Bacteria 1067
139 Ga0068855_100103562 3300005563 Bacteria 3274
140 Ga0068855_100458937 3300005563 Bacteria 1389
141 Ga0070664_100072303 3300005564 Bacteria 2957
142 Ga0068857_100001961 3300005577 Bacteria 16625
143 Ga0068857_100589513 3300005577 Bacteria 1050
144 Ga0068857_100669471 3300005577 Bacteria 984
145 Ga0068854_100015429 3300005578 Bacteria 5060
146 Ga0068854_100189976 3300005578 Bacteria 1609
147 Ga0068856_100004763 3300005614 Bacteria 13455
148 Ga0068856_100368091 3300005614 Bacteria 1456
149 Ga0068856_100371141 3300005614 Bacteria 1450
150 Ga0068856_100377075 3300005614 Bacteria 1437
151 Ga0068856_100615892 3300005614 Bacteria 1106
152 Ga0070702_100018099 3300005615 Bacteria 3647
153 Ga0070702_100034821 3300005615 Bacteria 2778
154 Ga0068852_100027031 3300005616 Bacteria 4671
155 Ga0068852_100391083 3300005616 Bacteria 1366
156 Ga0068859_100141732 3300005617 Bacteria 2477
157 Ga0068859_100163260 3300005617 Bacteria 2307
158 Ga0068859_100453541 3300005617 Bacteria 1379
159 Ga0068864_100030957 3300005618 Bacteria 4537
160 Ga0068864_100231142 3300005618 Bacteria 1710
161 Ga0068864_100410848 3300005618 Bacteria 1288
162 Ga0068864_100481877 3300005618 Bacteria 1191
163 Ga0068866_10043422 3300005718 Bacteria 2244
164 Ga0068861_100104928 3300005719 Bacteria 2256
165 Ga0068861_100436782 3300005719 Bacteria 1170
166 Ga0068870_10043436 3300005840 Bacteria 2344
167 Ga0068863_100054829 3300005841 Bacteria 3776
168 Ga0068858_100021010 3300005842 Bacteria 6099
169 Ga0068858_100023034 3300005842 Bacteria 5808
170 Ga0068858_100058578 3300005842 Bacteria 3562
171 Ga0068860_100035725 3300005843 Bacteria 4765
172 Ga0068860_100119160 3300005843 Bacteria 2527
173 Ga0068862_100040043 3300005844 Bacteria 3982
174 Ga0068862_100420603 3300005844 Bacteria 1254
175 Ga0081540_1009679 3300005983 Bacteria 6618
176 Ga0081540_1105744 3300005983 Bacteria 1201
177 Ga0070717_10042689 3300006028 Bacteria 3699
178 Ga0075368_10167727 3300006042 Bacteria 922
179 Ga0075363_100051109 3300006048 Bacteria 2203
180 Ga0075363_100081868 3300006048 Bacteria 1766
181 Ga0070716_100016548 3300006173 Bacteria 3809
182 Ga0070712_100057506 3300006175 Bacteria 2732
183 Ga0070712_100266508 3300006175 Bacteria 1374
184 Ga0075367_10084751 3300006178 Bacteria 1922
185 Ga0097621_100007980 3300006237 Bacteria 7596
186 Ga0097621_100041982 3300006237 Bacteria 3683
187 Ga0097621_100082098 3300006237 Bacteria 2683
188 Ga0075370_10122430 3300006353 Bacteria 1515
189 Ga0068871_100020252 3300006358 Bacteria 5093
190 Ga0068871_100073528 3300006358 Bacteria 2818
191 Ga0068871_100107394 3300006358 Bacteria 2344
192 Ga0075433_10505177 3300006852 Bacteria 1064
193 Ga0075434_100002891 3300006871 Bacteria 15241
194 Ga0075434_101362269 3300006871 Bacteria 720
195 Ga0068865_100002668 3300006881 Bacteria 10591
196 Ga0075436_100130867 3300006914 Bacteria 1759
197 Ga0097620_100141729 3300006931 Bacteria 2477
198 Ga0097620_100163263 3300006931 Bacteria 2307
199 Ga0097620_100453528 3300006931 Bacteria 1379
200 Ga0075435_100130523 3300007076 Bacteria 2102
201 Ga0105251_10008273 3300009011 Bacteria 6285
202 Ga0105251_10062902 3300009011 Bacteria 1742
203 Ga0105244_10080212 3300009036 Bacteria 1616
204 Ga0105250_10158623 3300009092 Bacteria 944
205 Ga0105240_10083366 3300009093 Bacteria 3923
206 Ga0105240_11809491 3300009093 Bacteria 636
207 Ga0111539_10002666 3300009094 Bacteria 23636
208 Ga0111539_10180804 3300009094 Bacteria 2463
209 Ga0111539_10397683 3300009094 Bacteria 1605
210 Ga0111539_10442753 3300009094 Bacteria 1513
211 Ga0105245_10005838 3300009098 Bacteria 10807
212 Ga0105245_11890167 3300009098 Bacteria 650
213 Ga0105247_10018150 3300009101 Bacteria 4219
214 Ga0105247_10042054 3300009101 Bacteria 2797
215 Ga0105247_10860423 3300009101 Bacteria 697
216 Ga0105243_10009397 3300009148 Bacteria 7452
217 Ga0105243_10010661 3300009148 Bacteria 6970
218 Ga0105243_10031006 3300009148 Bacteria 4121
219 Ga0105241_10039056 3300009174 Bacteria 3580
220 Ga0105241_10062361 3300009174 Bacteria 2874
221 Ga0105242_10003276 3300009176 Bacteria 12623
222 Ga0105242_10005721 3300009176 Bacteria 9585
223 Ga0105242_10593787 3300009176 Bacteria 1068
224 Ga0105242_11867882 3300009176 Bacteria 640
225 Ga0105248_10029352 3300009177 Bacteria 6136
226 Ga0105248_10079139 3300009177 Bacteria 3694
227 Ga0105248_10157605 3300009177 Bacteria 2561
228 Ga0105248_10452519 3300009177 Bacteria 1447
229 Ga0105248_11395621 3300009177 Bacteria 792
230 Ga0105237_10026078 3300009545 Bacteria 5973
231 Ga0105237_10073011 3300009545 Bacteria 3424
232 Ga0105238_10131786 3300009551 Bacteria 2478
233 Ga0105238_10189552 3300009551 Bacteria 2033
234 Ga0105238_10378586 3300009551 Bacteria 1406
235 Ga0105249_10003707 3300009553 Bacteria 13173
236 Ga0105249_10014965 3300009553 Bacteria 6861
237 Ga0105249_10073413 3300009553 Bacteria 3165
238 Ga0105239_10133814 3300010375 Bacteria 2759
239 Ga0105239_10586405 3300010375 Bacteria 1271
240 Ga0105239_12759614 3300010375 Bacteria 573
241 Ga0105246_10048292 3300011119 Bacteria 2909
242 Ga0105246_10081786 3300011119 Bacteria 2303
243 Ga0105246_10335642 3300011119 Bacteria 1233
244 Ga0157346_1000468 3300012480 Bacteria 1706
245 Ga0157335_1000431 3300012492 Bacteria 1890
246 Ga0157341_1026071 3300012494 Bacteria 606
247 Ga0157326_1079323 3300012513 Unclassified 534
248 Ga0157373_10143510 3300013100 Bacteria 1679
249 Ga0157371_10106981 3300013102 Bacteria 1985
250 Ga0157369_10637697 3300013105 Bacteria 1099
251 Ga0157374_10045399 3300013296 Bacteria 4067
252 Ga0157378_10082090 3300013297 Bacteria 2914
253 Ga0157378_10330926 3300013297 Bacteria 1482
254 Ga0157378_10334752 3300013297 Bacteria 1474
255 Ga0163162_10035395 3300013306 Bacteria 4974
256 Ga0163162_10128488 3300013306 Bacteria 2642
257 Ga0157372_10125587 3300013307 Bacteria 2950
258 Ga0157372_10387219 3300013307 Bacteria 1629
259 Ga0157372_10721404 3300013307 Bacteria 1160
260 Ga0157375_10005918 3300013308 Bacteria 10659
261 Ga0157375_10224963 3300013308 Bacteria 2035
262 Ga0157375_10487787 3300013308 Bacteria 1397
263 Ga0163163_10004653 3300014325 Bacteria 11731
264 Ga0163163_10052605 3300014325 Bacteria 4018
265 Ga0163163_10384875 3300014325 Bacteria 1460
266 Ga0157380_10058175 3300014326 Bacteria 3081
267 Ga0157380_10074370 3300014326 Bacteria 2758
268 Ga0157380_11060035 3300014326 Bacteria 847
269 Ga0157380_11167585 3300014326 Bacteria 812
270 Ga0157377_10008866 3300014745 Bacteria 4920
271 Ga0157379_10002897 3300014968 Bacteria 14477
272 Ga0157379_10047707 3300014968 Bacteria 3822
273 Ga0157379_10238966 3300014968 Bacteria 1647
274 Ga0157376_10010022 3300014969 Bacteria 6913
275 Ga0163161_10523841 3300017792 Bacteria 968
276 Ga0207666_1000393 3300025271 Bacteria 5770
277 Ga0207673_1002171 3300025290 Bacteria 2212
278 Ga0209758_1000240 3300025297 Bacteria 114169
279 Ga0207426_1034247 3300025302 Bacteria 1630
280 Ga0207697_10001423 3300025315 Bacteria 13083
281 Ga0207682_10000011 3300025893 Bacteria 85533
282 Ga0207692_10244853 3300025898 Bacteria 1072
283 Ga0207692_10728438 3300025898 Bacteria 645
284 Ga0207642_10075287 3300025899 Bacteria 1621
285 Ga0207710_10023260 3300025900 Bacteria 2663
286 Ga0207710_10100784 3300025900 Bacteria 1362
287 Ga0207710_10146567 3300025900 Bacteria 1143
288 Ga0207688_10001874 3300025901 Bacteria 11255
289 Ga0207688_10331255 3300025901 Bacteria 935
290 Ga0207680_10299806 3300025903 Bacteria 1120
291 Ga0207647_10004915 3300025904 Bacteria 9863
292 Ga0207647_10178658 3300025904 Bacteria 1234
293 Ga0207685_10018827 3300025905 Bacteria 2263
294 Ga0207699_10066149 3300025906 Bacteria 2193
295 Ga0207645_10002566 3300025907 Bacteria 14176
296 Ga0207645_10660246 3300025907 Bacteria 710
297 Ga0207643_10000475 3300025908 Bacteria 25958
298 Ga0207705_10643527 3300025909 Bacteria 824
299 Ga0207684_10356439 3300025910 Bacteria 1259
300 Ga0207654_10069113 3300025911 Bacteria 2092
301 Ga0207707_10123847 3300025912 Bacteria 2261
302 Ga0207707_10221767 3300025912 Bacteria 1646
303 Ga0207707_10598375 3300025912 Bacteria 933
304 Ga0207707_10810993 3300025912 Bacteria 779
305 Ga0207707_10958722 3300025912 Bacteria 704
306 Ga0207695_10230195 3300025913 Bacteria 1758
307 Ga0207695_10337156 3300025913 Bacteria 1396
308 Ga0207695_10429995 3300025913 Bacteria 1204
309 Ga0207671_10157554 3300025914 Bacteria 1757
310 Ga0207693_10003988 3300025915 Bacteria 12543
311 Ga0207693_10049708 3300025915 Bacteria 3293
312 Ga0207663_10005887 3300025916 Bacteria 6219
313 Ga0207663_10434224 3300025916 Bacteria 1010
314 Ga0207660_10027932 3300025917 Bacteria 3856
315 Ga0207660_10217698 3300025917 Unclassified 1497
316 Ga0207662_10006977 3300025918 Bacteria 6130
317 Ga0207662_10086559 3300025918 Bacteria 1921
318 Ga0207657_10006965 3300025919 Bacteria 11645
319 Ga0207657_10027564 3300025919 Bacteria 5202
320 Ga0207657_10052820 3300025919 Bacteria 3525
321 Ga0207649_10015935 3300025920 Bacteria 4230
322 Ga0207649_10133878 3300025920 Bacteria 1687
323 Ga0207649_10657703 3300025920 Bacteria 810
324 Ga0207649_10922024 3300025920 Bacteria 685
325 Ga0207652_10211033 3300025921 Bacteria 1748
326 Ga0207652_10294926 3300025921 Bacteria 1463
327 Ga0207681_10008142 3300025923 Bacteria 6411
328 Ga0207694_10130079 3300025924 Bacteria 2017
329 Ga0207694_11028622 3300025924 Bacteria 697
330 Ga0207650_10044585 3300025925 Bacteria 3260
331 Ga0207650_10046166 3300025925 Bacteria 3207
332 Ga0207650_10572834 3300025925 Bacteria 948
333 Ga0207659_10069004 3300025926 Bacteria 2573
334 Ga0207687_10008357 3300025927 Bacteria 6772
335 Ga0207687_10023979 3300025927 Bacteria 4071
336 Ga0207687_10215322 3300025927 Bacteria 1509
337 Ga0207687_10344324 3300025927 Bacteria 1213
338 Ga0207700_10000590 3300025928 Bacteria 21178
339 Ga0207700_10040115 3300025928 Bacteria 3414
340 Ga0207664_10671939 3300025929 Bacteria 931
341 Ga0207644_10361185 3300025931 Bacteria 1181
342 Ga0207690_10029129 3300025932 Bacteria 3507
343 Ga0207690_10037107 3300025932 Bacteria 3162
344 Ga0207706_10003321 3300025933 Bacteria 15400
345 Ga0207706_10006855 3300025933 Bacteria 10533
346 Ga0207706_10597341 3300025933 Bacteria 948
347 Ga0207706_10682885 3300025933 Bacteria 878
348 Ga0207686_10002829 3300025934 Bacteria 9373
349 Ga0207686_10011825 3300025934 Bacteria 4788
350 Ga0207686_10039069 3300025934 Bacteria 2877
351 Ga0207709_10111121 3300025935 Bacteria 1833
352 Ga0207709_10754196 3300025935 Bacteria 783
353 Ga0207670_10009269 3300025936 Bacteria 5605
354 Ga0207669_10019856 3300025937 Bacteria 3508
355 Ga0207704_10021370 3300025938 Bacteria 3445
356 Ga0207704_10029365 3300025938 Bacteria 3065
357 Ga0207665_10004273 3300025939 Bacteria 9495
358 Ga0207691_10006103 3300025940 Bacteria 11645
359 Ga0207711_10009205 3300025941 Bacteria 8248
360 Ga0207711_10033714 3300025941 Bacteria 4334
361 Ga0207711_10067491 3300025941 Bacteria 3096
362 Ga0207711_10101789 3300025941 Bacteria 2542
363 Ga0207689_10010443 3300025942 Bacteria 7995
364 Ga0207661_10034548 3300025944 Bacteria 3933
365 Ga0207679_10000026 3300025945 Bacteria 200073
366 Ga0207679_10185234 3300025945 Bacteria 1725
367 Ga0207667_10140896 3300025949 Bacteria 2483
368 Ga0207667_10358306 3300025949 Bacteria 1487
369 Ga0207651_10010879 3300025960 Bacteria 5063
370 Ga0207651_10094902 3300025960 Bacteria 2195
371 Ga0207712_10052692 3300025961 Bacteria 2851
372 Ga0207712_10194674 3300025961 Bacteria 1603
373 Ga0207668_10033737 3300025972 Bacteria 3392
374 Ga0207640_10349579 3300025981 Bacteria 1187
375 Ga0207658_10005999 3300025986 Bacteria 8304
376 Ga0207658_10034072 3300025986 Bacteria 3636
377 Ga0207658_10097309 3300025986 Bacteria 2297
378 Ga0207658_10115156 3300025986 Bacteria 2133
379 Ga0207658_10813914 3300025986 Bacteria 848
380 Ga0207677_10021431 3300026023 Bacteria 3948
381 Ga0207677_10112586 3300026023 Bacteria 2030
382 Ga0207703_10007676 3300026035 Bacteria 8549
383 Ga0207703_10047591 3300026035 Bacteria 3458
384 Ga0207703_10048609 3300026035 Bacteria 3425
385 Ga0207703_10198411 3300026035 Bacteria 1782
386 Ga0207703_10801430 3300026035 Bacteria 899
387 Ga0207639_10675756 3300026041 Bacteria 957
388 Ga0207678_10010041 3300026067 Bacteria 8309
389 Ga0207678_10035632 3300026067 Bacteria 4332
390 Ga0207678_10057236 3300026067 Bacteria 3354
391 Ga0207702_10041304 3300026078 Bacteria 3867
392 Ga0207702_10292993 3300026078 Bacteria 1542
393 Ga0207702_10316925 3300026078 Bacteria 1484
394 Ga0207702_10521995 3300026078 Bacteria 1159
395 Ga0207702_11099417 3300026078 Bacteria 789
396 Ga0207641_10049153 3300026088 Bacteria 3562
397 Ga0207641_10751769 3300026088 Bacteria 962
398 Ga0207648_10012087 3300026089 Bacteria 8097
399 Ga0207648_10344303 3300026089 Bacteria 1343
400 Ga0207676_10035528 3300026095 Bacteria 3783
401 Ga0207676_10068453 3300026095 Bacteria 2839
402 Ga0207674_10003206 3300026116 Bacteria 20153
403 Ga0207675_100008845 3300026118 Bacteria 9448
404 Ga0207675_100370534 3300026118 Bacteria 1407
405 Ga0207683_10001717 3300026121 Bacteria 19589
406 Ga0207683_10004174 3300026121 Bacteria 12505
407 Ga0207683_10116057 3300026121 Bacteria 2400
408 Ga0207683_10598116 3300026121 Bacteria 1021
409 Ga0210000_1005857 3300027462 Bacteria 1787
410 Ga0210002_1001290 3300027617 Bacteria 3500
411 Ga0210002_1014260 3300027617 Bacteria 1245
412 Ga0209983_1004354 3300027665 Bacteria 2977
413 Ga0209971_1043088 3300027682 Bacteria 1087
414 Ga0209998_10004421 3300027717 Bacteria 2988
415 Ga0209998_10005538 3300027717 Bacteria 2639
416 Ga0209974_10098760 3300027876 Bacteria 1019
417 Ga0207428_10003417 3300027907 Bacteria 15429
418 Ga0268266_10074102 3300028379 Bacteria 2955
419 Ga0268265_10319927 3300028380 Bacteria 1404
420 Ga0268264_10073734 3300028381 Bacteria 2898
421 Ga0268264_11263590 3300028381 Bacteria 748
422 Ga0265337_1000345 3300028556 Bacteria 24838
423 Ga0265313_10077818 3300031595 Bacteria 1513
424 Ga0265313_10230212 3300031595 Bacteria 761
425 Ga0316579_10006996 3300031691 Bacteria 4636
426 Ga0307405_10315655 3300031731 Bacteria 1192
427 Ga0307407_10738881 3300031903 Bacteria 744
428 Ga0316583_10012243 3300032133 Bacteria 3095
429 Ga0373930_0006379 3300034816 Bacteria 1993
430 Ga0373948_0000025 3300034817 Bacteria 18190
431 Ga0373948_0203608 3300034817 Bacteria 517
432 Ga0373950_0000146 3300034818 Bacteria 11191
433 Ga0373958_0000142 3300034819 Bacteria 8033
434 Ga0373958_0016691 3300034819 Bacteria 1311
435 Ga0373959_0000072 3300034820 Bacteria 22681
436 Ga0373959_0137033 3300034820 Bacteria 610
437 Ga0373938_0006570 3300034957 Bacteria 2015
438 Ga0373938_0057177 3300034957 Bacteria 904
439 Ga0373938_0057478 3300034957 Bacteria 903
440 Ga0373926_0030537 3300035083 Bacteria 1897
441 Ga0373928_0000402 3300035084 Bacteria 8604
442 Ga0373928_0008517 3300035084 Bacteria 1992
443 Ga0373929_0000222 3300035085 Bacteria 10370
444 Ga0373929_0020429 3300035085 Bacteria 1335
445 Ga0373940_0000232 3300035088 Bacteria 7934
446 Ga0373940_0038039 3300035088 Bacteria 1312
447 Ga0373944_0023114 3300035089 Unclassified 1811
448 Ga0373944_0036878 3300035089 Bacteria 1495
449 Ga0373949_0006489 3300035090 Bacteria 2571
450 Ga0373949_0126817 3300035090 Bacteria 721
451 Ga0373951_0000275 3300035091 Bacteria 16405
452 Ga0373951_0009495 3300035091 Bacteria 2190
453 Ga0373952_0001098 3300035092 Bacteria 4936
454 Ga0373923_0222038 3300035111 Bacteria 878
455 Ga0373932_0000059 3300035112 Bacteria 27206
456 Ga0373932_0004242 3300035112 Bacteria 3404
457 Ga0373932_0208561 3300035112 Bacteria 698
458 Ga0373936_0008188 3300035113 Bacteria 3929
459 Ga0373936_0012745 3300035113 Bacteria 3202
460 Ga0373939_0000508 3300035114 Bacteria 9753
461 Ga0373939_0001841 3300035114 Bacteria 5100
462 Ga0373941_0000727 3300035115 Bacteria 6760
463 Ga0373941_0016442 3300035115 Bacteria 2011
464 Ga0373945_0020472 3300035116 Bacteria 2264
465 Ga0373945_0030798 3300035116 Bacteria 1892
466 Ga0373953_0014506 3300035117 Bacteria 2836
467 Ga0373954_0030337 3300035118 Bacteria 2493
468 Ga0373954_0102561 3300035118 Bacteria 1381
469 Ga0373956_0025571 3300035119 Bacteria 2553
470 Ga0373956_0113264 3300035119 Bacteria 1264
471 Ga0373957_0409563 3300035120 Bacteria 584
472 Ga0373960_0000038 3300035121 Bacteria 16959
473 Ga0373960_0017899 3300035121 Bacteria 1841
474 Ga0373960_0031290 3300035121 Bacteria 1488
475 Ga0373943_0027129 3300035170 Bacteria 2688
476 Ga0373943_0088183 3300035170 Bacteria 1602
477 Ga0373946_0104228 3300035171 Bacteria 1275
478 Ga0373942_0001035 3300035207 Bacteria 7543
479 Ga0373942_0091181 3300035207 Bacteria 919
480 Ga0373961_0000773 3300035241 Bacteria 10979
481 Ga0373961_0247763 3300035241 Bacteria 644
482 Ga0373962_0000191 3300035242 Bacteria 12940
483 Ga0373962_0001541 3300035242 Bacteria 5452
484 Ga0373924_0003454 3300035410 Bacteria 5438
485 Ga0373931_0001217 3300035691 Bacteria 11011
486 Ga0373931_0005504 3300035691 Bacteria 5865
487 Ga0373931_0311633 3300035691 Bacteria 975
488 Ga0373935_0133625 3300035692 Unclassified 1669
489 Ga0373927_0023827 3300035695 Bacteria 4005
490 Ga0373933_0275084 3300035724 Bacteria 1087
491 Ga0373947_0172126 3300035725 Bacteria 1405
492 Ga0373937_0003774 3300036401 Bacteria 12809
493 Ga0373937_0043428 3300036401 Bacteria 4103
494 Ga0373937_0191791 3300036401 Bacteria 1920
495 Ga0373925_0169642 3300037068 Bacteria 1722
496 Ga0373925_0505891 3300037068 Bacteria 992
497 Ga0436365_0885430 3300039437 Bacteria 1290
498 Ga0436361_0378388 3300039447 Bacteria 634
499 Ga0436363_0476894 3300039450 Bacteria 878
500 Ga0439448_0017401 3300042005 Bacteria 2195
501 Ga0439448_0300247 3300042005 Bacteria 570
502 Ga0439455_0010687 3300042012 Bacteria 2025
503 Ga0439460_0026548 3300042461 Bacteria 1621
504 Ga0450893_0034290 3300042532 Bacteria 913
505 Ga0451577_0384126 3300042876 Bacteria 1274
506 Ga0439440_0179598 3300042993 Bacteria 619
507 Ga0453683_0081209 3300044673 Bacteria 2031
508 Ga0466963_0003493 3300044694 Bacteria 9017
509 Ga0453684_0477926 3300044712 Bacteria 1383
510 Ga0466957_0435855 3300044842 Bacteria 901
511 Ga0466959_0900489 3300045049 Bacteria 590
512 Ga0451576_0078873 3300045051 Bacteria 3426
513 Ga0466958_0290473 3300045836 Bacteria 1049
514 Ga0466967_0011150 3300045976 Bacteria 6790
515 Ga0495592_0086374 3300046454 Bacteria 2259
516 Ga0495592_0197083 3300046454 Bacteria 1361
517 Ga0495603_0067902 3300046455 Bacteria 2097
518 Ga0495603_0241402 3300046455 Bacteria 1040
519 Ga0495591_046063 3300046458 Bacteria 1213
520 Ga0495629_0027900 3300046459 Bacteria 4010
521 Ga0495629_0169699 3300046459 Bacteria 1514
522 Ga0495629_0586707 3300046459 Bacteria 746
523 Ga0495641_0008018 3300046461 Bacteria 6506
524 Ga0495651_0069688 3300046462 Bacteria 2677
525 Ga0495651_0217468 3300046462 Bacteria 1325
526 Ga0495651_0291102 3300046462 Bacteria 1099
527 Ga0495653_0033378 3300046463 Bacteria 4078
528 Ga0495653_0083333 3300046463 Bacteria 2358
529 Ga0495580_0257959 3300046472 Bacteria 1192
530 Ga0495580_0562254 3300046472 Bacteria 756
531 Ga0495582_0010682 3300046473 Bacteria 5050
532 Ga0495582_0059947 3300046473 Bacteria 2099
533 Ga0495605_0035610 3300046474 Bacteria 2515
534 Ga0495639_0003352 3300046475 Bacteria 6946
535 Ga0495662_0000578 3300046476 Bacteria 16874
536 Ga0495662_0075874 3300046476 Bacteria 1631
537 Ga0495664_0003834 3300046477 Bacteria 8207
538 Ga0495584_0033241 3300046491 Bacteria 2609
539 Ga0495584_0093800 3300046491 Bacteria 1515
540 Ga0495585_0011808 3300046492 Bacteria 5159
541 Ga0495594_0024579 3300046499 Bacteria 3237
542 Ga0495594_0073205 3300046499 Bacteria 1906
543 Ga0495607_0026320 3300046501 Bacteria 3609
544 Ga0495608_0022303 3300046511 Bacteria 4341
545 Ga0495608_0444341 3300046511 Bacteria 790
546 Ga0495618_0025224 3300046514 Bacteria 3688
547 Ga0495618_0052178 3300046514 Bacteria 2584
548 Ga0495628_0017184 3300046516 Bacteria 6026
549 Ga0495630_0106302 3300046517 Bacteria 2125
550 Ga0495644_0000776 3300046523 Bacteria 13153
551 Ga0495663_0130503 3300046525 Bacteria 847
552 Ga0495666_0004514 3300046526 Bacteria 7032
553 Ga0495666_0166818 3300046526 Bacteria 1019
554 Ga0495652_0014455 3300046529 Bacteria 7084
555 Ga0495652_0185619 3300046529 Bacteria 1591
556 Ga0495652_0821605 3300046529 Unclassified 617
557 Ga0495665_0136576 3300046531 Bacteria 1282
558 Ga0495640_0009413 3300046533 Bacteria 7608
559 Ga0495640_0171449 3300046533 Bacteria 1386
560 Ga0495586_0029328 3300046535 Bacteria 2944
561 Ga0495598_0251748 3300046537 Bacteria 654
562 Ga0495645_0068680 3300046543 Bacteria 2558
563 Ga0495622_0113728 3300046557 Bacteria 1238
564 Ga0495622_0220909 3300046557 Bacteria 839
565 Ga0495633_0005403 3300046558 Bacteria 7825
566 Ga0495667_0022920 3300046559 Bacteria 4207
567 Ga0495667_0082836 3300046559 Bacteria 2084
568 Ga0495656_0000457 3300046615 Bacteria 13306
569 Ga0495634_0051631 3300046642 Bacteria 2758
570 Ga0495611_0001107 3300046648 Bacteria 14194
571 Ga0495635_0001404 3300046663 Bacteria 16066
572 Ga0495635_0094721 3300046663 Bacteria 2041
573 Ga0495661_0044082 3300046665 Bacteria 2737
574 Ga0495588_0001852 3300046674 Bacteria 9006
575 Ga0495588_0376546 3300046674 Bacteria 745
576 Ga0495647_0404306 3300046681 Bacteria 627
577 Ga0495658_0007083 3300046683 Bacteria 5537
578 Ga0495658_0013538 3300046683 Bacteria 4153
579 Ga0495669_0116493 3300046684 Bacteria 1250
580 Ga0495613_0096940 3300046689 Bacteria 2132
581 Ga0495613_0465923 3300046689 Bacteria 854
582 Ga0495624_0008145 3300046690 Bacteria 7334
583 Ga0495670_0000732 3300046691 Bacteria 15674
584 Ga0495589_0223553 3300046794 Bacteria 884
585 Ga0495600_0041357 3300046809 Bacteria 3003
586 Ga0495600_0118616 3300046809 Bacteria 1721
587 Ga0495600_0284027 3300046809 Bacteria 1047
588 Ga0495581_0004004 3300047315 Bacteria 8485
589 Ga0495581_0197867 3300047315 Bacteria 1175
590 Ga0495604_0016396 3300047317 Bacteria 5923
591 Ga0495604_0070465 3300047317 Bacteria 2647
592 Ga0495674_0080595 3300047319 Bacteria 2793
593 Ga0495674_0086794 3300047319 Bacteria 2678
594 Ga0495676_0755323 3300047321 Bacteria 627
595 Ga0495680_0003293 3300047322 Bacteria 16010
596 Ga0495680_0021036 3300047322 Bacteria 5467
597 Ga0495680_0115361 3300047322 Bacteria 1987
598 Ga0495675_0383247 3300047444 Bacteria 822
599 Ga0495684_0000443 3300047471 Bacteria 33877
600 Ga0495684_0103007 3300047471 Bacteria 2157
601 Ga0495684_0274011 3300047471 Bacteria 1220
602 Ga0495593_0001302 3300047673 Bacteria 14635
603 Ga0495593_0088268 3300047673 Bacteria 1598
604 Ga0495614_0099988 3300048089 Bacteria 1266
605 Ga0495614_0265808 3300048089 Bacteria 787
606 Ga0496100_0022202 3300048903 Bacteria 3837
607 Ga0496100_0099905 3300048903 Bacteria 1997
608 Ga0496100_0305398 3300048903 Bacteria 1192
609 Ga0496100_0790983 3300048903 Bacteria 743
610 Ga0496101_0003602 3300048904 Bacteria 9669
611 Ga0496101_0015188 3300048904 Bacteria 5183
612 Ga0496101_0820378 3300048904 Bacteria 733
613 Ga0496102_0053554 3300048905 Bacteria 3677
614 Ga0496102_0075563 3300048905 Bacteria 3097
615 Ga0496102_0088262 3300048905 Bacteria 2866
616 Ga0496103_0013538 3300048906 Bacteria 4837
617 Ga0496103_0016090 3300048906 Bacteria 4462
618 Ga0496103_0033766 3300048906 Bacteria 3126
619 Ga0496103_0676215 3300048906 Bacteria 655
620 Ga0496104_0035743 3300048907 Bacteria 4640
621 Ga0496104_0131011 3300048907 Bacteria 2408
622 Ga0496104_0178743 3300048907 Bacteria 2032
623 Ga0496104_0221308 3300048907 Bacteria 1805
624 Ga0496104_0236757 3300048907 Bacteria 1737
625 Ga0496104_0385651 3300048907 Bacteria 1313
626 Ga0496105_0047769 3300048908 Bacteria 3532
627 Ga0496105_0241119 3300048908 Bacteria 1467
628 Ga0496105_0746909 3300048908 Bacteria 747
629 Ga0496106_0025546 3300048909 Bacteria 4396
630 Ga0496106_0035468 3300048909 Bacteria 3729
631 Ga0496106_0042856 3300048909 Bacteria 3394
632 Ga0496107_0006223 3300048910 Bacteria 8206
633 Ga0496107_0020388 3300048910 Bacteria 4682
634 Ga0496107_0066391 3300048910 Bacteria 2615
635 Ga0496107_0146151 3300048910 Bacteria 1748
636 Ga0496107_0198119 3300048910 Bacteria 1492
637 Ga0496107_0240160 3300048910 Bacteria 1348
638 Ga0496108_0073444 3300048911 Bacteria 2887
639 Ga0496108_0086761 3300048911 Bacteria 2657
640 Ga0496108_0167932 3300048911 Bacteria 1897
641 Ga0496108_0175207 3300048911 Bacteria 1856
642 Ga0496108_0282842 3300048911 Bacteria 1444
643 Ga0496108_0318726 3300048911 Bacteria 1355
644 Ga0496109_0003538 3300048912 Bacteria 13036
645 Ga0496109_0006194 3300048912 Bacteria 10055
646 Ga0496109_0021801 3300048912 Bacteria 5670
647 Ga0496109_0109427 3300048912 Bacteria 2568
648 Ga0496109_0213983 3300048912 Bacteria 1812
649 Ga0496110_0041064 3300048913 Bacteria 4035
650 Ga0496110_0050483 3300048913 Bacteria 3652
651 Ga0496110_0124450 3300048913 Bacteria 2325
652 Ga0496110_0322827 3300048913 Bacteria 1406
653 Ga0496111_0064785 3300048914 Bacteria 2651
654 Ga0496111_0127819 3300048914 Bacteria 1879
655 Ga0496111_0228722 3300048914 Bacteria 1381
656 Ga0496111_0869946 3300048914 Bacteria 650
657 Ga0496112_0011049 3300048915 Bacteria 8226
658 Ga0496112_0129321 3300048915 Bacteria 2496
659 Ga0496112_0268046 3300048915 Bacteria 1656
660 Ga0496113_0002940 3300048916 Bacteria 10064
661 Ga0496113_0017669 3300048916 Bacteria 4957
662 Ga0496113_0097856 3300048916 Bacteria 2270
663 Ga0496113_0114186 3300048916 Bacteria 2105
664 Ga0496114_0060812 3300048917 Bacteria 3157
665 Ga0496114_0771493 3300048917 Bacteria 839
666 Ga0496115_0081209 3300048918 Bacteria 2640
667 Ga0496115_0083031 3300048918 Bacteria 2611
668 Ga0496115_0117213 3300048918 Bacteria 2190
669 Ga0496115_0124987 3300048918 Bacteria 2118
670 Ga0496115_0213288 3300048918 Bacteria 1594
671 Ga0496115_0284309 3300048918 Bacteria 1357
672 Ga0496125_0306648 3300048928 Bacteria 970
673 Ga0496126_1257026 3300048929 Bacteria 541
674 Ga0501032_0039649 3300049569 Bacteria 3203
675 Ga0501032_0151865 3300049569 Bacteria 1522
676 Ga0501033_0104642 3300049570 Bacteria 2063
677 Ga0501033_0124594 3300049570 Bacteria 1868
678 Ga0501033_0338750 3300049570 Bacteria 1055
679 Ga0501033_0407271 3300049570 Bacteria 948
680 Ga0501034_0092030 3300049571 Bacteria 3030
681 Ga0501034_0655091 3300049571 Bacteria 951
682 Ga0501034_0904147 3300049571 Bacteria 770
683 Ga0501036_0026744 3300049572 Bacteria 4873
684 Ga0501036_0252595 3300049572 Bacteria 1477
685 Ga0501037_0071301 3300049573 Bacteria 2527
686 Ga0501037_0109189 3300049573 Bacteria 1993
687 Ga0501038_0165582 3300049574 Bacteria 1793
688 Ga0501039_0025905 3300049575 Bacteria 4509
689 Ga0501043_0059478 3300049579 Bacteria 2999
690 Ga0501043_0284997 3300049579 Bacteria 1265
691 Ga0501046_0023011 3300049580 Bacteria 5130
692 Ga0501047_0112672 3300049581 Bacteria 2602
693 Ga0501047_0144054 3300049581 Bacteria 2260
694 Ga0501047_0197429 3300049581 Bacteria 1874
695 Ga0501047_0518750 3300049581 Bacteria 1017
696 Ga0501047_0519532 3300049581 Bacteria 1016
697 Ga0501048_0008134 3300049582 Bacteria 7933
698 Ga0501067_0026595 3300049583 Bacteria 3204
699 Ga0501067_0162735 3300049583 Bacteria 1243
700 Ga0501068_0021458 3300049584 Bacteria 3771
701 Ga0501068_0553333 3300049584 Bacteria 748
702 Ga0501069_0031715 3300049585 Bacteria 2908
703 Ga0501069_0102345 3300049585 Bacteria 1626
704 Ga0501070_0002742 3300049586 Bacteria 15368
705 Ga0501070_0179546 3300049586 Bacteria 1742
706 Ga0501070_0233660 3300049586 Bacteria 1506
707 Ga0501070_0522124 3300049586 Bacteria 952
708 Ga0501070_0523088 3300049586 Bacteria 951
709 Ga0501071_0051731 3300049587 Bacteria 2961
710 Ga0501072_0283735 3300049588 Bacteria 1317
711 Ga0501072_0558572 3300049588 Bacteria 904
712 Ga0501073_0040298 3300049589 Bacteria 3306
713 Ga0501073_0048220 3300049589 Bacteria 2990
714 Ga0501074_0157395 3300049590 Bacteria 1622
715 Ga0501074_0283383 3300049590 Bacteria 1178
716 Ga0501074_0647562 3300049590 Bacteria 746
717 Ga0501077_0028997 3300049593 Bacteria 3518
718 Ga0501079_0071314 3300049741 Bacteria 2684
719 Ga0501080_0174110 3300049742 Bacteria 1983
720 Ga0501080_0283756 3300049742 Bacteria 1505
721 Ga0501080_0949671 3300049742 Bacteria 747
722 Ga0501083_0237267 3300049744 Bacteria 1187
723 Ga0501035_0144738 3300049822 Bacteria 2064
724 Ga0501035_0180544 3300049822 Bacteria 1818
725 Ga0501035_0708071 3300049822 Bacteria 811
726 Ga0501044_0000398 3300049823 Bacteria 53733
727 Ga0501044_0641745 3300049823 Bacteria 951
728 Ga0501045_0004946 3300049824 Bacteria 9234
729 nmdc:mga0yw44_910607_c1 3300050492 Bacteria 596
730 nmdc:mga04h51_160441_c1 3300050495 Bacteria 865
731 nmdc:mga07m45_40742_c2 3300050496 Bacteria 2164
732 nmdc:mga07m45_551106_c1 3300050496 Bacteria 667
733 nmdc:mga08y16_1017016_c1 3300050511 Bacteria 808
734 nmdc:mga08y16_17011_c1 3300050511 Bacteria 7658
735 nmdc:mga08y16_4379_c1 3300050511 Bacteria 14755
736 nmdc:mga0n895_1165764_c1 3300050512 Bacteria 746
737 nmdc:mga0n895_1189353_c1 3300050512 Bacteria 737
738 nmdc:mga0n895_217896_c1 3300050512 Bacteria 1938
739 nmdc:mga0n895_228991_c1 3300050512 Bacteria 1887
740 nmdc:mga0rr50_108616_c1 3300050513 Bacteria 2192
741 nmdc:mga0rr50_40426_c1 3300050513 Bacteria 3391
742 nmdc:mga08x19_152741_c1 3300050514 Bacteria 1564
743 nmdc:mga08x19_506470_c1 3300050514 Bacteria 853
744 nmdc:mga0a205_14489_c1 3300050515 Bacteria 7355
745 Ga0495601_0006640 3300053077 Bacteria 6770
746 Ga0495601_0057686 3300053077 Bacteria 2459
747 Ga0495601_0096433 3300053077 Bacteria 1907
748 Ga0495612_0001373 3300053078 Bacteria 10039
749 Ga0495612_0010159 3300053078 Bacteria 3807
750 Ga0495612_0103558 3300053078 Unclassified 1213
751 Ga0495595_0001279 3300053084 Bacteria 9806
752 Ga0495595_0022045 3300053084 Bacteria 2791
753 Ga0495619_0000052 3300053085 Bacteria 98882
754 Ga0495619_0008288 3300053085 Bacteria 6573
755 Ga0495619_0011964 3300053085 Bacteria 5466
756 Ga0495619_0046725 3300053085 Bacteria 2848
757 Ga0495619_0179160 3300053085 Bacteria 1466
758 Ga0501082_0266612 3300060353 Bacteria 1490
759 2643758275 2643221547 Bacteria 4740017
760 Ga0070680_101352214
761 RicEn_FSXC51602_g1
762 2214772984
763 ARcpr5oldR_c000376
764 ARSoilYngRDRAFT_c00377
765 ARcpr5yngRDRAFT_c000358
766 ARSoilOldRDRAFT_c000321
767 ARCol0oldRDRAFT_c00150
768 ARCol0yngRDRAFT_1000371
769 JGI24752J21851_1005564
770 JGI24746J21847_1001703
771 JGI24747J21853_1007109
772 JGI24737J22298_10004265
773 JGI24750J21931_1000505
774 JGI24745J21846_1001173
775 JGI24748J21848_1000728
776 JGI24738J21930_10000064
777 JGI24749J21850_1002851
778 JGI24749J21850_1004988
779 JGI24035J26624_1001283
780 JGI24033J26618_1001199
781 JGI24034J26672_10000317
782 JGI24742J22300_10000416
783 JGI24751J29686_10019620
784 JGI25153J46596_10003510
785 Ga0065712_10005081
786 Ga0065712_10013426
787 Ga0065712_10070998
788 Ga0065715_10004000
789 Ga0065707_10010312
790 Ga0070658_10846538
791 Ga0070658_10863200
792 Ga0070676_10011938
793 Ga0070676_10084734
794 Ga0070676_10096249
795 Ga0070683_100005169
796 Ga0070683_100093341
797 Ga0070683_100403563
798 Ga0070690_100088865
799 Ga0070690_100168693
800 Ga0070690_100193176
801 Ga0070670_100057070
802 Ga0070670_100088659
803 Ga0070670_100214371
804 Ga0070677_10019778
805 Ga0068869_100135127
806 Ga0070666_10010052
807 Ga0070666_10077373
808 Ga0070666_10696746
809 Ga0070680_100045280
810 Ga0070680_100068338
811 Ga0070680_100261613
812 Ga0070682_100009542
813 Ga0070682_100056461
814 Ga0070682_100149371
815 Ga0070682_100287801
816 Ga0068868_100168843
817 Ga0068868_100313737
818 Ga0070660_100037330
819 Ga0070660_100087365
820 Ga0070689_100014470
821 Ga0070689_100037770
822 Ga0070691_10007611
823 Ga0070687_100012602
824 Ga0070687_100517771
825 Ga0070661_100015266
826 Ga0070692_10000468
827 Ga0070668_100074575
828 Ga0070669_100011957
829 Ga0070675_100098935
830 Ga0070671_100002503
831 Ga0070671_100189049
832 Ga0070674_100007283
833 Ga0070673_100001494
834 Ga0070673_100156689
835 Ga0070688_100034590
836 Ga0070688_100194992
837 Ga0070659_100046147
838 Ga0070659_100164521
839 Ga0070667_100009726
840 Ga0070667_100075256
841 Ga0070667_100076055
842 Ga0070667_100158400
843 Ga0070709_10013606
844 Ga0070709_10561421
845 Ga0070714_100204038
846 Ga0070714_100283485
847 Ga0070713_100006436
848 Ga0070713_101071481
849 Ga0070710_10022863
850 Ga0070710_10716271
851 Ga0070701_10041877
852 Ga0070701_10107437
853 Ga0070711_100022460
854 Ga0070711_100022906
855 Ga0070711_100113378
856 Ga0070705_100008212
857 Ga0070705_100202163
858 Ga0070700_100054048
859 Ga0070694_100052810
860 Ga0070708_100380081
861 Ga0070663_100073108
862 Ga0070663_100099301
863 Ga0070663_100201542
864 Ga0070678_100104169
865 Ga0070678_100119184
866 Ga0070662_100743204
867 Ga0070662_100903017
868 Ga0070662_101308903
869 Ga0070681_10014847
870 Ga0070681_10032350
871 Ga0070681_10086218
872 Ga0070681_10140281
873 Ga0070681_10302965
874 Ga0070681_10500089
875 Ga0070681_10508573
876 Ga0070685_10001432
877 Ga0070679_100030767
878 Ga0070679_100141727
879 Ga0070679_100484173
880 Ga0070684_100003138
881 Ga0070684_100177999
882 Ga0070672_100003940
883 Ga0070672_100310816
884 Ga0070686_100002212
885 Ga0070686_100008334
886 Ga0070686_100674657
887 Ga0070695_100007770
888 Ga0070695_100012503
889 Ga0070695_100110250
890 Ga0070696_100496658
891 Ga0070693_100073536
892 Ga0070693_100107953
893 Ga0070693_100162872
894 Ga0070693_100309571
895 Ga0070665_100151970
896 Ga0070704_100368800
897 Ga0070704_100488368
898 Ga0068855_100103562
899 Ga0068855_100458937
900 Ga0070664_100072303
901 Ga0068857_100001961
902 Ga0068857_100589513
903 Ga0068857_100669471
904 Ga0068854_100015429
905 Ga0068854_100189976
906 Ga0068856_100004763
907 Ga0068856_100368091
908 Ga0068856_100371141
909 Ga0068856_100377075
910 Ga0068856_100615892
911 Ga0070702_100018099
912 Ga0070702_100034821
913 Ga0068852_100027031
914 Ga0068852_100391083
915 Ga0068859_100141732
916 Ga0068859_100163260
917 Ga0068859_100453541
918 Ga0068864_100030957
919 Ga0068864_100231142
920 Ga0068864_100410848
921 Ga0068864_100481877
922 Ga0068866_10043422
923 Ga0068861_100104928
924 Ga0068861_100436782
925 Ga0068870_10043436
926 Ga0068863_100054829
927 Ga0068858_100021010
928 Ga0068858_100023034
929 Ga0068858_100058578
930 Ga0068860_100035725
931 Ga0068860_100119160
932 Ga0068862_100040043
933 Ga0068862_100420603
934 Ga0081540_1009679
935 Ga0081540_1105744
936 Ga0070717_10042689
937 Ga0075368_10167727
938 Ga0075363_100051109
939 Ga0075363_100081868
940 Ga0070716_100016548
941 Ga0070712_100057506
942 Ga0070712_100266508
943 Ga0075367_10084751
944 Ga0097621_100007980
945 Ga0097621_100041982
946 Ga0097621_100082098
947 Ga0075370_10122430
948 Ga0068871_100020252
949 Ga0068871_100073528
950 Ga0068871_100107394
951 Ga0075433_10505177
952 Ga0075434_100002891
953 Ga0075434_101362269
954 Ga0068865_100002668
955 Ga0075436_100130867
956 Ga0097620_100141729
957 Ga0097620_100163263
958 Ga0097620_100453528
959 Ga0075435_100130523
960 Ga0105251_10008273
961 Ga0105251_10062902
962 Ga0105244_10080212
963 Ga0105250_10158623
964 Ga0105240_10083366
965 Ga0105240_11809491
966 Ga0111539_10002666
967 Ga0111539_10180804
968 Ga0111539_10397683
969 Ga0111539_10442753
970 Ga0105245_10005838
971 Ga0105245_11890167
972 Ga0105247_10018150
973 Ga0105247_10042054
974 Ga0105247_10860423
975 Ga0105243_10009397
976 Ga0105243_10010661
977 Ga0105243_10031006
978 Ga0105241_10039056
979 Ga0105241_10062361
980 Ga0105242_10003276
981 Ga0105242_10005721
982 Ga0105242_10593787
983 Ga0105242_11867882
984 Ga0105248_10029352
985 Ga0105248_10079139
986 Ga0105248_10157605
987 Ga0105248_10452519
988 Ga0105248_11395621
989 Ga0105237_10026078
990 Ga0105237_10073011
991 Ga0105238_10131786
992 Ga0105238_10189552
993 Ga0105238_10378586
994 Ga0105249_10003707
995 Ga0105249_10014965
996 Ga0105249_10073413
997 Ga0105239_10133814
998 Ga0105239_10586405
999 Ga0105239_12759614
1000 Ga0105246_10048292
1001 Ga0105246_10081786
1002 Ga0105246_10335642
1003 Ga0157346_1000468
1004 Ga0157335_1000431
1005 Ga0157341_1026071
1006 Ga0157326_1079323
1007 Ga0157373_10143510
1008 Ga0157371_10106981
1009 Ga0157369_10637697
1010 Ga0157374_10045399
1011 Ga0157378_10082090
1012 Ga0157378_10330926
1013 Ga0157378_10334752
1014 Ga0163162_10035395
1015 Ga0163162_10128488
1016 Ga0157372_10125587
1017 Ga0157372_10387219
1018 Ga0157372_10721404
1019 Ga0157375_10005918
1020 Ga0157375_10224963
1021 Ga0157375_10487787
1022 Ga0163163_10004653
1023 Ga0163163_10052605
1024 Ga0163163_10384875
1025 Ga0157380_10058175
1026 Ga0157380_10074370
1027 Ga0157380_11060035
1028 Ga0157380_11167585
1029 Ga0157377_10008866
1030 Ga0157379_10002897
1031 Ga0157379_10047707
1032 Ga0157379_10238966
1033 Ga0157376_10010022
1034 Ga0163161_10523841
1035 Ga0207666_1000393
1036 Ga0207673_1002171
1037 Ga0209758_1000240
1038 Ga0207426_1034247
1039 Ga0207697_10001423
1040 Ga0207682_10000011
1041 Ga0207692_10244853
1042 Ga0207692_10728438
1043 Ga0207642_10075287
1044 Ga0207710_10023260
1045 Ga0207710_10100784
1046 Ga0207710_10146567
1047 Ga0207688_10001874
1048 Ga0207688_10331255
1049 Ga0207680_10299806
1050 Ga0207647_10004915
1051 Ga0207647_10178658
1052 Ga0207685_10018827
1053 Ga0207699_10066149
1054 Ga0207645_10002566
1055 Ga0207645_10660246
1056 Ga0207643_10000475
1057 Ga0207705_10643527
1058 Ga0207684_10356439
1059 Ga0207654_10069113
1060 Ga0207707_10123847
1061 Ga0207707_10221767
1062 Ga0207707_10598375
1063 Ga0207707_10810993
1064 Ga0207707_10958722
1065 Ga0207695_10230195
1066 Ga0207695_10337156
1067 Ga0207695_10429995
1068 Ga0207671_10157554
1069 Ga0207693_10003988
1070 Ga0207693_10049708
1071 Ga0207663_10005887
1072 Ga0207663_10434224
1073 Ga0207660_10027932
1074 Ga0207660_10217698
1075 Ga0207662_10006977
1076 Ga0207662_10086559
1077 Ga0207657_10006965
1078 Ga0207657_10027564
1079 Ga0207657_10052820
1080 Ga0207649_10015935
1081 Ga0207649_10133878
1082 Ga0207649_10657703
1083 Ga0207649_10922024
1084 Ga0207652_10211033
1085 Ga0207652_10294926
1086 Ga0207681_10008142
1087 Ga0207694_10130079
1088 Ga0207694_11028622
1089 Ga0207650_10044585
1090 Ga0207650_10046166
1091 Ga0207650_10572834
1092 Ga0207659_10069004
1093 Ga0207687_10008357
1094 Ga0207687_10023979
1095 Ga0207687_10215322
1096 Ga0207687_10344324
1097 Ga0207700_10000590
1098 Ga0207700_10040115
1099 Ga0207664_10671939
1100 Ga0207644_10361185
1101 Ga0207690_10029129
1102 Ga0207690_10037107
1103 Ga0207706_10003321
1104 Ga0207706_10006855
1105 Ga0207706_10597341
1106 Ga0207706_10682885
1107 Ga0207686_10002829
1108 Ga0207686_10011825
1109 Ga0207686_10039069
1110 Ga0207709_10111121
1111 Ga0207709_10754196
1112 Ga0207670_10009269
1113 Ga0207669_10019856
1114 Ga0207704_10021370
1115 Ga0207704_10029365
1116 Ga0207665_10004273
1117 Ga0207691_10006103
1118 Ga0207711_10009205
1119 Ga0207711_10033714
1120 Ga0207711_10067491
1121 Ga0207711_10101789
1122 Ga0207689_10010443
1123 Ga0207661_10034548
1124 Ga0207679_10000026
1125 Ga0207679_10185234
1126 Ga0207667_10140896
1127 Ga0207667_10358306
1128 Ga0207651_10010879
1129 Ga0207651_10094902
1130 Ga0207712_10052692
1131 Ga0207712_10194674
1132 Ga0207668_10033737
1133 Ga0207640_10349579
1134 Ga0207658_10005999
1135 Ga0207658_10034072
1136 Ga0207658_10097309
1137 Ga0207658_10115156
1138 Ga0207658_10813914
1139 Ga0207677_10021431
1140 Ga0207677_10112586
1141 Ga0207703_10007676
1142 Ga0207703_10047591
1143 Ga0207703_10048609
1144 Ga0207703_10198411
1145 Ga0207703_10801430
1146 Ga0207639_10675756
1147 Ga0207678_10010041
1148 Ga0207678_10035632
1149 Ga0207678_10057236
1150 Ga0207702_10041304
1151 Ga0207702_10292993
1152 Ga0207702_10316925
1153 Ga0207702_10521995
1154 Ga0207702_11099417
1155 Ga0207641_10049153
1156 Ga0207641_10751769
1157 Ga0207648_10012087
1158 Ga0207648_10344303
1159 Ga0207676_10035528
1160 Ga0207676_10068453
1161 Ga0207674_10003206
1162 Ga0207675_100008845
1163 Ga0207675_100370534
1164 Ga0207683_10001717
1165 Ga0207683_10004174
1166 Ga0207683_10116057
1167 Ga0207683_10598116
1168 Ga0210000_1005857
1169 Ga0210002_1001290
1170 Ga0210002_1014260
1171 Ga0209983_1004354
1172 Ga0209971_1043088
1173 Ga0209998_10004421
1174 Ga0209998_10005538
1175 Ga0209974_10098760
1176 Ga0207428_10003417
1177 Ga0268266_10074102
1178 Ga0268265_10319927
1179 Ga0268264_10073734
1180 Ga0268264_11263590
1181 Ga0265337_1000345
1182 Ga0265313_10077818
1183 Ga0265313_10230212
1184 Ga0316579_10006996
1185 Ga0307405_10315655
1186 Ga0307407_10738881
1187 Ga0316583_10012243
1188 Ga0373930_0006379
1189 Ga0373948_0000025
1190 Ga0373948_0203608
1191 Ga0373950_0000146
1192 Ga0373958_0000142
1193 Ga0373958_0016691
1194 Ga0373959_0000072
1195 Ga0373959_0137033
1196 Ga0373938_0006570
1197 Ga0373938_0057177
1198 Ga0373938_0057478
1199 Ga0373926_0030537
1200 Ga0373928_0000402
1201 Ga0373928_0008517
1202 Ga0373929_0000222
1203 Ga0373929_0020429
1204 Ga0373940_0000232
1205 Ga0373940_0038039
1206 Ga0373944_0023114
1207 Ga0373944_0036878
1208 Ga0373949_0006489
1209 Ga0373949_0126817
1210 Ga0373951_0000275
1211 Ga0373951_0009495
1212 Ga0373952_0001098
1213 Ga0373923_0222038
1214 Ga0373932_0000059
1215 Ga0373932_0004242
1216 Ga0373932_0208561
1217 Ga0373936_0008188
1218 Ga0373936_0012745
1219 Ga0373939_0000508
1220 Ga0373939_0001841
1221 Ga0373941_0000727
1222 Ga0373941_0016442
1223 Ga0373945_0020472
1224 Ga0373945_0030798
1225 Ga0373953_0014506
1226 Ga0373954_0030337
1227 Ga0373954_0102561
1228 Ga0373956_0025571
1229 Ga0373956_0113264
1230 Ga0373957_0409563
1231 Ga0373960_0000038
1232 Ga0373960_0017899
1233 Ga0373960_0031290
1234 Ga0373943_0027129
1235 Ga0373943_0088183
1236 Ga0373946_0104228
1237 Ga0373942_0001035
1238 Ga0373942_0091181
1239 Ga0373961_0000773
1240 Ga0373961_0247763
1241 Ga0373962_0000191
1242 Ga0373962_0001541
1243 Ga0373924_0003454
1244 Ga0373931_0001217
1245 Ga0373931_0005504
1246 Ga0373931_0311633
1247 Ga0373935_0133625
1248 Ga0373927_0023827
1249 Ga0373933_0275084
1250 Ga0373947_0172126
1251 Ga0373937_0003774
1252 Ga0373937_0043428
1253 Ga0373937_0191791
1254 Ga0373925_0169642
1255 Ga0373925_0505891
1256 Ga0436365_0885430
1257 Ga0436361_0378388
1258 Ga0436363_0476894
1259 Ga0439448_0017401
1260 Ga0439448_0300247
1261 Ga0439455_0010687
1262 Ga0439460_0026548
1263 Ga0450893_0034290
1264 Ga0451577_0384126
1265 Ga0439440_0179598
1266 Ga0453683_0081209
1267 Ga0466963_0003493
1268 Ga0453684_0477926
1269 Ga0466957_0435855
1270 Ga0466959_0900489
1271 Ga0451576_0078873
1272 Ga0466958_0290473
1273 Ga0466967_0011150
1274 Ga0495592_0086374
1275 Ga0495592_0197083
1276 Ga0495603_0067902
1277 Ga0495603_0241402
1278 Ga0495591_046063
1279 Ga0495629_0027900
1280 Ga0495629_0169699
1281 Ga0495629_0586707
1282 Ga0495641_0008018
1283 Ga0495651_0069688
1284 Ga0495651_0217468
1285 Ga0495651_0291102
1286 Ga0495653_0033378
1287 Ga0495653_0083333
1288 Ga0495580_0257959
1289 Ga0495580_0562254
1290 Ga0495582_0010682
1291 Ga0495582_0059947
1292 Ga0495605_0035610
1293 Ga0495639_0003352
1294 Ga0495662_0000578
1295 Ga0495662_0075874
1296 Ga0495664_0003834
1297 Ga0495584_0033241
1298 Ga0495584_0093800
1299 Ga0495585_0011808
1300 Ga0495594_0024579
1301 Ga0495594_0073205
1302 Ga0495607_0026320
1303 Ga0495608_0022303
1304 Ga0495608_0444341
1305 Ga0495618_0025224
1306 Ga0495618_0052178
1307 Ga0495628_0017184
1308 Ga0495630_0106302
1309 Ga0495644_0000776
1310 Ga0495663_0130503
1311 Ga0495666_0004514
1312 Ga0495666_0166818
1313 Ga0495652_0014455
1314 Ga0495652_0185619
1315 Ga0495652_0821605
1316 Ga0495665_0136576
1317 Ga0495640_0009413
1318 Ga0495640_0171449
1319 Ga0495586_0029328
1320 Ga0495598_0251748
1321 Ga0495645_0068680
1322 Ga0495622_0113728
1323 Ga0495622_0220909
1324 Ga0495633_0005403
1325 Ga0495667_0022920
1326 Ga0495667_0082836
1327 Ga0495656_0000457
1328 Ga0495634_0051631
1329 Ga0495611_0001107
1330 Ga0495635_0001404
1331 Ga0495635_0094721
1332 Ga0495661_0044082
1333 Ga0495588_0001852
1334 Ga0495588_0376546
1335 Ga0495647_0404306
1336 Ga0495658_0007083
1337 Ga0495658_0013538
1338 Ga0495669_0116493
1339 Ga0495613_0096940
1340 Ga0495613_0465923
1341 Ga0495624_0008145
1342 Ga0495670_0000732
1343 Ga0495589_0223553
1344 Ga0495600_0041357
1345 Ga0495600_0118616
1346 Ga0495600_0284027
1347 Ga0495581_0004004
1348 Ga0495581_0197867
1349 Ga0495604_0016396
1350 Ga0495604_0070465
1351 Ga0495674_0080595
1352 Ga0495674_0086794
1353 Ga0495676_0755323
1354 Ga0495680_0003293
1355 Ga0495680_0021036
1356 Ga0495680_0115361
1357 Ga0495675_0383247
1358 Ga0495684_0000443
1359 Ga0495684_0103007
1360 Ga0495684_0274011
1361 Ga0495593_0001302
1362 Ga0495593_0088268
1363 Ga0495614_0099988
1364 Ga0495614_0265808
1365 Ga0496100_0022202
1366 Ga0496100_0099905
1367 Ga0496100_0305398
1368 Ga0496100_0790983
1369 Ga0496101_0003602
1370 Ga0496101_0015188
1371 Ga0496101_0820378
1372 Ga0496102_0053554
1373 Ga0496102_0075563
1374 Ga0496102_0088262
1375 Ga0496103_0013538
1376 Ga0496103_0016090
1377 Ga0496103_0033766
1378 Ga0496103_0676215
1379 Ga0496104_0035743
1380 Ga0496104_0131011
1381 Ga0496104_0178743
1382 Ga0496104_0221308
1383 Ga0496104_0236757
1384 Ga0496104_0385651
1385 Ga0496105_0047769
1386 Ga0496105_0241119
1387 Ga0496105_0746909
1388 Ga0496106_0025546
1389 Ga0496106_0035468
1390 Ga0496106_0042856
1391 Ga0496107_0006223
1392 Ga0496107_0020388
1393 Ga0496107_0066391
1394 Ga0496107_0146151
1395 Ga0496107_0198119
1396 Ga0496107_0240160
1397 Ga0496108_0073444
1398 Ga0496108_0086761
1399 Ga0496108_0167932
1400 Ga0496108_0175207
1401 Ga0496108_0282842
1402 Ga0496108_0318726
1403 Ga0496109_0003538
1404 Ga0496109_0006194
1405 Ga0496109_0021801
1406 Ga0496109_0109427
1407 Ga0496109_0213983
1408 Ga0496110_0041064
1409 Ga0496110_0050483
1410 Ga0496110_0124450
1411 Ga0496110_0322827
1412 Ga0496111_0064785
1413 Ga0496111_0127819
1414 Ga0496111_0228722
1415 Ga0496111_0869946
1416 Ga0496112_0011049
1417 Ga0496112_0129321
1418 Ga0496112_0268046
1419 Ga0496113_0002940
1420 Ga0496113_0017669
1421 Ga0496113_0097856
1422 Ga0496113_0114186
1423 Ga0496114_0060812
1424 Ga0496114_0771493
1425 Ga0496115_0081209
1426 Ga0496115_0083031
1427 Ga0496115_0117213
1428 Ga0496115_0124987
1429 Ga0496115_0213288
1430 Ga0496115_0284309
1431 Ga0496125_0306648
1432 Ga0496126_1257026
1433 Ga0501032_0039649
1434 Ga0501032_0151865
1435 Ga0501033_0104642
1436 Ga0501033_0124594
1437 Ga0501033_0338750
1438 Ga0501033_0407271
1439 Ga0501034_0092030
1440 Ga0501034_0655091
1441 Ga0501034_0904147
1442 Ga0501036_0026744
1443 Ga0501036_0252595
1444 Ga0501037_0071301
1445 Ga0501037_0109189
1446 Ga0501038_0165582
1447 Ga0501039_0025905
1448 Ga0501043_0059478
1449 Ga0501043_0284997
1450 Ga0501046_0023011
1451 Ga0501047_0112672
1452 Ga0501047_0144054
1453 Ga0501047_0197429
1454 Ga0501047_0518750
1455 Ga0501047_0519532
1456 Ga0501048_0008134
1457 Ga0501067_0026595
1458 Ga0501067_0162735
1459 Ga0501068_0021458
1460 Ga0501068_0553333
1461 Ga0501069_0031715
1462 Ga0501069_0102345
1463 Ga0501070_0002742
1464 Ga0501070_0179546
1465 Ga0501070_0233660
1466 Ga0501070_0522124
1467 Ga0501070_0523088
1468 Ga0501071_0051731
1469 Ga0501072_0283735
1470 Ga0501072_0558572
1471 Ga0501073_0040298
1472 Ga0501073_0048220
1473 Ga0501074_0157395
1474 Ga0501074_0283383
1475 Ga0501074_0647562
1476 Ga0501077_0028997
1477 Ga0501079_0071314
1478 Ga0501080_0174110
1479 Ga0501080_0283756
1480 Ga0501080_0949671
1481 Ga0501083_0237267
1482 Ga0501035_0144738
1483 Ga0501035_0180544
1484 Ga0501035_0708071
1485 Ga0501044_0000398
1486 Ga0501044_0641745
1487 Ga0501045_0004946
1488 nmdc:mga0yw44_910607_c1
1489 nmdc:mga04h51_160441_c1
1490 nmdc:mga07m45_40742_c2
1491 nmdc:mga07m45_551106_c1
1492 nmdc:mga08y16_1017016_c1
1493 nmdc:mga08y16_17011_c1
1494 nmdc:mga08y16_4379_c1
1495 nmdc:mga0n895_1165764_c1
1496 nmdc:mga0n895_1189353_c1
1497 nmdc:mga0n895_217896_c1
1498 nmdc:mga0n895_228991_c1
1499 nmdc:mga0rr50_108616_c1
1500 nmdc:mga0rr50_40426_c1
1501 nmdc:mga08x19_152741_c1
1502 nmdc:mga08x19_506470_c1
1503 nmdc:mga0a205_14489_c1
1504 Ga0495601_0006640
1505 Ga0495601_0057686
1506 Ga0495601_0096433
1507 Ga0495612_0001373
1508 Ga0495612_0010159
1509 Ga0495612_0103558
1510 Ga0495595_0001279
1511 Ga0495595_0022045
1512 Ga0495619_0000052
1513 Ga0495619_0008288
1514 Ga0495619_0011964
1515 Ga0495619_0046725
1516 Ga0495619_0179160
1517 Ga0501082_0266612
1518 2643758275

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

20

169

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4s2y-assembly1.cif.gz_A structure of e. coli rpph bound to rna and three magnesium ions 0.909 2 150
7sp3-assembly1.cif.gz_A e. coli rpph bound to ap4a 0.8986 2 150
4s2w-assembly1.cif.gz_A structure of e. coli rpph bound to sulfate ions 0.8921 2 150
4s2x-assembly1.cif.gz_A structure of e. coli rpph bound to rna and two magnesium ions 0.8891 2 150
6vcn-assembly1.cif.gz_A crystal structure of e.coli rpph in complex with ppcpg 0.8855 2 150
ID Description Score Start End Superfamily
4s2yA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.909 2 150 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8629 2 151 3.90.79.10
af_A0A0R0I796_20_164_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8615 8 151 3.90.79.10
af_C6SXU5_1_159_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8194 2 151 3.90.79.10
4s2vA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8179 2 149 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A257ZH96-F1-model_v4 RNA pyrophosphohydrolase 0.9325 24 151 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A529K4I9-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) 0.9273 29 150 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A1M5YV49-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9271 1 151 GO:0006753
GO:0008893
GO:0019693
GO:0034432
AF-A0A7Y9P8J0-F1-model_v4 deleted 0.9237 2 150
AF-A0A4Y9ELT3-F1-model_v4 RNA pyrophosphohydrolase (EC 3.6.1.-) ((Di)nucleoside polyphosphate hydrolase) 0.9227 1 145 GO:0006753
GO:0008893
GO:0019693
GO:0034432

Map