F479438

General Info

Members Datasets Scaffolds Average Seq Length
758 325 1516 200

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10143309|Ga0075365_101433092
Length 193
Sequence MAAHAEAAHHGPPVAHQSSRVSASVLGMLLFIASEIMLFGAFFTAYFFVRVVNGIEWPTPPFELPVFVAGVNTAILVTSSFTMHWALTSIKRGSRAGLLTFLMGLVFLLTQAREYSRVGFAPHDGAFGTIFYTLTGLHGAHVFVGLSILLFMTVRAFRGHFSPEHHHGVEIGGIYWHFVDVMWIVVYSTVYLI

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
210 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
213 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
214 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
215 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
235 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
236 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
258 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 13.06
Rhizosphere 85.49
Stem 0
Stem Tuber 0
Unclassified 3.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10143309 3300006038 Unclassified 1659
2 JGI24742J22300_10036924 3300002244 Bacteria 864
3 Ga0058862_12696819 3300004803 Bacteria 698
4 Ga0070658_10001923 3300005327 Bacteria 17483
5 Ga0070658_10009312 3300005327 Bacteria 7897
6 Ga0070658_10095904 3300005327 Bacteria 2449
7 Ga0070683_100003875 3300005329 Bacteria 12235
8 Ga0070683_100029564 3300005329 Bacteria 4963
9 Ga0070683_100179276 3300005329 Bacteria 2011
10 Ga0070683_100434320 3300005329 Bacteria 1253
11 Ga0070666_10128140 3300005335 Bacteria 1762
12 Ga0070680_100024898 3300005336 Bacteria 4783
13 Ga0070680_100025696 3300005336 Bacteria 4707
14 Ga0070680_100042832 3300005336 Bacteria 3675
15 Ga0070680_100054278 3300005336 Bacteria 3272
16 Ga0070680_100240828 3300005336 Bacteria 1529
17 Ga0070682_100012139 3300005337 Bacteria 4931
18 Ga0070682_100266621 3300005337 Bacteria 1242
19 Ga0070682_100693106 3300005337 Bacteria 816
20 Ga0070660_100014142 3300005339 Bacteria 5745
21 Ga0070660_100018143 3300005339 Bacteria 5136
22 Ga0070660_100018912 3300005339 Bacteria 5043
23 Ga0070660_100188861 3300005339 Bacteria 1668
24 Ga0070660_100533982 3300005339 Bacteria 978
25 Ga0070689_100012172 3300005340 Bacteria 6188
26 Ga0070691_10341651 3300005341 Bacteria 829
27 Ga0070687_100321358 3300005343 Bacteria 989
28 Ga0070661_100098331 3300005344 Bacteria 2174
29 Ga0070661_100101685 3300005344 Bacteria 2138
30 Ga0070661_100386906 3300005344 Bacteria 1104
31 Ga0070692_10247447 3300005345 Bacteria 1065
32 Ga0070668_100115670 3300005347 Bacteria 2138
33 Ga0070669_100347629 3300005353 Bacteria 1203
34 Ga0070675_100020633 3300005354 Bacteria 5258
35 Ga0070671_100186416 3300005355 Bacteria 1758
36 Ga0070671_100379438 3300005355 Bacteria 1208
37 Ga0070674_100005639 3300005356 Bacteria 7253
38 Ga0070673_100133517 3300005364 Bacteria 2086
39 Ga0070688_100016002 3300005365 Bacteria 4279
40 Ga0070659_100120632 3300005366 Bacteria 2123
41 Ga0070659_100130918 3300005366 Bacteria 2037
42 Ga0070703_10033052 3300005406 Unclassified 1573
43 Ga0070709_10082455 3300005434 Bacteria 2101
44 Ga0070709_10293298 3300005434 Bacteria 1186
45 Ga0070714_100002694 3300005435 Bacteria 13092
46 Ga0070714_100026064 3300005435 Bacteria 4829
47 Ga0070714_100053814 3300005435 Bacteria 3437
48 Ga0070714_100079429 3300005435 Bacteria 2853
49 Ga0070714_100088596 3300005435 Bacteria 2708
50 Ga0070714_100373742 3300005435 Bacteria 1342
51 Ga0070714_100426407 3300005435 Bacteria 1257
52 Ga0070714_100769014 3300005435 Bacteria 932
53 Ga0070714_101370142 3300005435 Unclassified 691
54 Ga0070713_100092077 3300005436 Bacteria 2609
55 Ga0070713_100121751 3300005436 Bacteria 2289
56 Ga0070713_100253079 3300005436 Bacteria 1607
57 Ga0070713_100298897 3300005436 Bacteria 1482
58 Ga0070710_10003097 3300005437 Bacteria 7894
59 Ga0070710_10017692 3300005437 Bacteria 3653
60 Ga0070701_10011918 3300005438 Bacteria 3904
61 Ga0070711_100018012 3300005439 Bacteria 4503
62 Ga0070711_100174381 3300005439 Bacteria 1641
63 Ga0070705_100037737 3300005440 Bacteria 2728
64 Ga0070705_100040298 3300005440 Bacteria 2655
65 Ga0070694_100530083 3300005444 Bacteria 941
66 Ga0070708_100082016 3300005445 Unclassified 2921
67 Ga0070708_100213456 3300005445 Bacteria 1809
68 Ga0070708_100421996 3300005445 Bacteria 1258
69 Ga0070708_100642661 3300005445 Bacteria 1000
70 Ga0070678_100026628 3300005456 Bacteria 3913
71 Ga0070681_10112465 3300005458 Bacteria 2662
72 Ga0070681_10216014 3300005458 Bacteria 1833
73 Ga0068867_100006828 3300005459 Bacteria 8070
74 Ga0068867_100707062 3300005459 Bacteria 890
75 Ga0070706_100001401 3300005467 Bacteria 25477
76 Ga0070706_100027202 3300005467 Bacteria 5263
77 Ga0070706_100365752 3300005467 Bacteria 1344
78 Ga0070707_100006137 3300005468 Bacteria 11197
79 Ga0070707_100113886 3300005468 Bacteria 2624
80 Ga0070707_100168307 3300005468 Bacteria 2135
81 Ga0070707_100192445 3300005468 Bacteria 1989
82 Ga0070707_100277119 3300005468 Bacteria 1630
83 Ga0070707_100622783 3300005468 Bacteria 1042
84 Ga0070707_100975493 3300005468 Unclassified 813
85 Ga0070698_100017579 3300005471 Bacteria 7537
86 Ga0070698_100052946 3300005471 Bacteria 4126
87 Ga0070698_100095006 3300005471 Bacteria 2959
88 Ga0070698_100104128 3300005471 Bacteria 2808
89 Ga0070698_100182083 3300005471 Bacteria 2039
90 Ga0070698_100229687 3300005471 Bacteria 1789
91 Ga0070698_100451864 3300005471 Bacteria 1221
92 Ga0070698_100532516 3300005471 Unclassified 1113
93 Ga0070699_100104381 3300005518 Bacteria 2486
94 Ga0070699_100169661 3300005518 Bacteria 1933
95 Ga0070679_100150570 3300005530 Bacteria 2303
96 Ga0070679_100215791 3300005530 Bacteria 1881
97 Ga0070679_100242752 3300005530 Unclassified 1758
98 Ga0070679_100810250 3300005530 Bacteria 879
99 Ga0070684_100013215 3300005535 Bacteria 6648
100 Ga0070684_100164585 3300005535 Bacteria 2013
101 Ga0070684_100184024 3300005535 Bacteria 1900
102 Ga0070684_100374003 3300005535 Bacteria 1312
103 Ga0070697_100164103 3300005536 Bacteria 1878
104 Ga0070697_100679517 3300005536 Bacteria 908
105 Ga0068853_100015612 3300005539 Bacteria 6238
106 Ga0070686_100004382 3300005544 Bacteria 7782
107 Ga0070695_100000231 3300005545 Bacteria 27675
108 Ga0070695_100134934 3300005545 Bacteria 1705
109 Ga0070696_100027249 3300005546 Bacteria 3892
110 Ga0070696_100456771 3300005546 Bacteria 1009
111 Ga0070665_100041443 3300005548 Bacteria 4628
112 Ga0070704_100106063 3300005549 Bacteria 2129
113 Ga0070704_100396386 3300005549 Bacteria 1177
114 Ga0068855_100146496 3300005563 Bacteria 2688
115 Ga0068855_100208575 3300005563 Bacteria 2197
116 Ga0068855_100870205 3300005563 Bacteria 954
117 Ga0068857_100322506 3300005577 Bacteria 1427
118 Ga0068854_100377789 3300005578 Bacteria 1167
119 Ga0068856_100014707 3300005614 Bacteria 7553
120 Ga0068856_100261502 3300005614 Bacteria 1746
121 Ga0068856_100558113 3300005614 Bacteria 1166
122 Ga0070702_100072626 3300005615 Bacteria 2036
123 Ga0068852_100038086 3300005616 Bacteria 4038
124 Ga0068852_100308027 3300005616 Bacteria 1535
125 Ga0068852_100577094 3300005616 Bacteria 1127
126 Ga0068866_10006032 3300005718 Bacteria 5042
127 Ga0068866_10230547 3300005718 Bacteria 1123
128 Ga0068861_100038498 3300005719 Bacteria 3562
129 Ga0068861_100752330 3300005719 Bacteria 910
130 Ga0068860_100896937 3300005843 Bacteria 902
131 Ga0068862_100221613 3300005844 Unclassified 1713
132 Ga0081539_10005968 3300005985 Bacteria 12002
133 Ga0081539_10300689 3300005985 Bacteria 690
134 Ga0070717_10018317 3300006028 Bacteria 5463
135 Ga0070717_10139346 3300006028 Bacteria 2091
136 Ga0070717_10287812 3300006028 Bacteria 1458
137 Ga0070717_11094532 3300006028 Bacteria 726
138 Ga0070715_10010063 3300006163 Bacteria 3358
139 Ga0070716_100015237 3300006173 Bacteria 3946
140 Ga0070716_100073723 3300006173 Bacteria 2014
141 Ga0070716_100109187 3300006173 Bacteria 1711
142 Ga0070712_100004431 3300006175 Bacteria 8665
143 Ga0070712_100032500 3300006175 Bacteria 3525
144 Ga0070712_100072705 3300006175 Bacteria 2464
145 Ga0070712_100289136 3300006175 Bacteria 1323
146 Ga0070712_100329624 3300006175 Bacteria 1243
147 Ga0097621_100005052 3300006237 Bacteria 9267
148 Ga0068871_100245974 3300006358 Bacteria 1556
149 Ga0075434_100036046 3300006871 Bacteria 4891
150 Ga0075429_101004048 3300006880 Bacteria 729
151 Ga0068865_100001717 3300006881 Bacteria 12852
152 Ga0075436_100328533 3300006914 Bacteria 1099
153 Ga0075436_100452488 3300006914 Unclassified 935
154 Ga0075435_100084580 3300007076 Bacteria 2611
155 Ga0099795_10274692 3300007788 Bacteria 734
156 Ga0105240_10019802 3300009093 Bacteria 8987
157 Ga0105240_10029533 3300009093 Bacteria 7141
158 Ga0105240_10917342 3300009093 Bacteria 941
159 Ga0105245_10061036 3300009098 Bacteria 3397
160 Ga0114129_10018315 3300009147 Bacteria 9976
161 Ga0114129_10740169 3300009147 Bacteria 1260
162 Ga0105243_10237005 3300009148 Bacteria 1622
163 Ga0105241_10324730 3300009174 Bacteria 1328
164 Ga0105248_10052205 3300009177 Bacteria 4588
165 Ga0105237_10064534 3300009545 Bacteria 3658
166 Ga0105237_10166645 3300009545 Bacteria 2202
167 Ga0105237_10283278 3300009545 Bacteria 1660
168 Ga0105237_10784657 3300009545 Bacteria 959
169 Ga0105238_10047776 3300009551 Bacteria 4314
170 Ga0105238_10840990 3300009551 Bacteria 935
171 Ga0105249_10003715 3300009553 Bacteria 13162
172 Ga0105239_10034604 3300010375 Bacteria 5548
173 Ga0105239_10907455 3300010375 Bacteria 1011
174 Ga0157373_10125051 3300013100 Bacteria 1808
175 Ga0157373_10228250 3300013100 Bacteria 1314
176 Ga0157373_10694818 3300013100 Bacteria 745
177 Ga0157371_10165728 3300013102 Bacteria 1578
178 Ga0157370_10011840 3300013104 Bacteria 9099
179 Ga0157370_10019665 3300013104 Bacteria 6763
180 Ga0157370_10618200 3300013104 Bacteria 991
181 Ga0157369_10024176 3300013105 Bacteria 6762
182 Ga0157369_10024611 3300013105 Bacteria 6694
183 Ga0157369_10047050 3300013105 Bacteria 4686
184 Ga0157369_10174803 3300013105 Bacteria 2261
185 Ga0157369_10231407 3300013105 Bacteria 1932
186 Ga0157369_10246375 3300013105 Bacteria 1866
187 Ga0157369_10912525 3300013105 Bacteria 901
188 Ga0157369_11083658 3300013105 Bacteria 819
189 Ga0163162_10194925 3300013306 Bacteria 2154
190 Ga0157372_10115289 3300013307 Bacteria 3080
191 Ga0157372_11234272 3300013307 Bacteria 863
192 Ga0157375_10423229 3300013308 Bacteria 1498
193 Ga0163163_10198505 3300014325 Bacteria 2054
194 Ga0182008_10051097 3300014497 Bacteria 2051
195 Ga0157376_10011995 3300014969 Bacteria 6412
196 Ga0182006_1019266 3300015261 Bacteria 2873
197 Ga0197907_11164713 3300020069 Bacteria 3466
198 Ga0206356_10660088 3300020070 Bacteria 2942
199 Ga0206349_1260290 3300020075 Bacteria 1619
200 Ga0206352_10452862 3300020078 Bacteria 962
201 Ga0206350_11368982 3300020080 Bacteria 1434
202 Ga0206354_10459876 3300020081 Bacteria 1365
203 Ga0224712_10015343 3300022467 Bacteria 2491
204 Ga0224712_10047466 3300022467 Bacteria 1653
205 Ga0207656_10443165 3300025321 Bacteria 656
206 Ga0207692_10088678 3300025898 Bacteria 1672
207 Ga0207692_10363578 3300025898 Bacteria 895
208 Ga0207642_10018124 3300025899 Bacteria 2695
209 Ga0207710_10154886 3300025900 Bacteria 1113
210 Ga0207688_10021149 3300025901 Bacteria 3553
211 Ga0207680_10021008 3300025903 Bacteria 3526
212 Ga0207685_10004620 3300025905 Bacteria 3530
213 Ga0207699_10019352 3300025906 Bacteria 3628
214 Ga0207699_10239027 3300025906 Bacteria 1247
215 Ga0207705_10017839 3300025909 Bacteria 5075
216 Ga0207705_10020415 3300025909 Bacteria 4734
217 Ga0207705_10133328 3300025909 Bacteria 1850
218 Ga0207705_10149880 3300025909 Bacteria 1747
219 Ga0207684_10055395 3300025910 Bacteria 3364
220 Ga0207684_10158073 3300025910 Bacteria 1951
221 Ga0207654_10389029 3300025911 Bacteria 967
222 Ga0207707_10008036 3300025912 Bacteria 9163
223 Ga0207707_10228226 3300025912 Bacteria 1620
224 Ga0207707_10758944 3300025912 Bacteria 811
225 Ga0207695_10231931 3300025913 Bacteria 1750
226 Ga0207671_10705680 3300025914 Bacteria 802
227 Ga0207693_10005025 3300025915 Bacteria 11103
228 Ga0207693_10011729 3300025915 Bacteria 7087
229 Ga0207693_10029818 3300025915 Bacteria 4306
230 Ga0207693_10064467 3300025915 Bacteria 2870
231 Ga0207693_10065011 3300025915 Bacteria 2857
232 Ga0207693_10083222 3300025915 Bacteria 2506
233 Ga0207663_10046061 3300025916 Bacteria 2685
234 Ga0207660_10047622 3300025917 Bacteria 3032
235 Ga0207660_10063661 3300025917 Bacteria 2660
236 Ga0207660_10104481 3300025917 Bacteria 2121
237 Ga0207660_10276212 3300025917 Bacteria 1332
238 Ga0207660_10359939 3300025917 Bacteria 1167
239 Ga0207662_10048967 3300025918 Bacteria 2506
240 Ga0207657_10009553 3300025919 Bacteria 9734
241 Ga0207657_10011660 3300025919 Bacteria 8713
242 Ga0207657_10017180 3300025919 Bacteria 6950
243 Ga0207657_10017602 3300025919 Bacteria 6846
244 Ga0207657_10052448 3300025919 Bacteria 3539
245 Ga0207657_10183201 3300025919 Bacteria 1692
246 Ga0207649_10157319 3300025920 Bacteria 1571
247 Ga0207652_10131820 3300025921 Bacteria 2229
248 Ga0207652_10141314 3300025921 Bacteria 2153
249 Ga0207652_10183923 3300025921 Bacteria 1879
250 Ga0207652_10294272 3300025921 Bacteria 1465
251 Ga0207646_10004153 3300025922 Bacteria 15887
252 Ga0207646_10010342 3300025922 Bacteria 9126
253 Ga0207646_10029650 3300025922 Bacteria 4969
254 Ga0207646_10058728 3300025922 Bacteria 3436
255 Ga0207646_10141736 3300025922 Bacteria 2165
256 Ga0207646_10522294 3300025922 Bacteria 1069
257 Ga0207646_10615033 3300025922 Bacteria 975
258 Ga0207694_10090186 3300025924 Bacteria 2418
259 Ga0207694_10427900 3300025924 Bacteria 1103
260 Ga0207694_10781466 3300025924 Bacteria 806
261 Ga0207687_10137205 3300025927 Bacteria 1851
262 Ga0207700_10115533 3300025928 Bacteria 2167
263 Ga0207700_10335360 3300025928 Bacteria 1313
264 Ga0207664_10067406 3300025929 Bacteria 2872
265 Ga0207664_10076139 3300025929 Bacteria 2715
266 Ga0207664_10090443 3300025929 Bacteria 2508
267 Ga0207664_10138080 3300025929 Bacteria 2059
268 Ga0207664_10287249 3300025929 Bacteria 1445
269 Ga0207664_10295451 3300025929 Bacteria 1424
270 Ga0207664_10637324 3300025929 Bacteria 958
271 Ga0207664_10789333 3300025929 Bacteria 854
272 Ga0207644_10413328 3300025931 Bacteria 1104
273 Ga0207644_10855923 3300025931 Bacteria 761
274 Ga0207690_10286506 3300025932 Bacteria 1284
275 Ga0207706_10082059 3300025933 Unclassified 2833
276 Ga0207686_10980104 3300025934 Bacteria 685
277 Ga0207709_10001561 3300025935 Bacteria 15707
278 Ga0207709_10063893 3300025935 Bacteria 2309
279 Ga0207670_10005360 3300025936 Bacteria 7034
280 Ga0207704_10009209 3300025938 Bacteria 4753
281 Ga0207665_10009523 3300025939 Bacteria 6379
282 Ga0207665_10023818 3300025939 Bacteria 4032
283 Ga0207665_10257846 3300025939 Bacteria 1291
284 Ga0207691_10010135 3300025940 Bacteria 9046
285 Ga0207691_10104108 3300025940 Bacteria 2530
286 Ga0207711_10097885 3300025941 Bacteria 2591
287 Ga0207689_10113478 3300025942 Bacteria 2227
288 Ga0207689_10318000 3300025942 Unclassified 1291
289 Ga0207661_10044940 3300025944 Bacteria 3493
290 Ga0207661_10087757 3300025944 Bacteria 2584
291 Ga0207661_10187130 3300025944 Bacteria 1813
292 Ga0207661_10248030 3300025944 Bacteria 1582
293 Ga0207667_10017450 3300025949 Bacteria 8076
294 Ga0207667_10447586 3300025949 Bacteria 1313
295 Ga0207651_10131115 3300025960 Bacteria 1919
296 Ga0207668_10020001 3300025972 Bacteria 4246
297 Ga0207703_10454760 3300026035 Bacteria 1196
298 Ga0207639_10015422 3300026041 Bacteria 5392
299 Ga0207702_10628261 3300026078 Bacteria 1055
300 Ga0207648_10003432 3300026089 Bacteria 16631
301 Ga0207675_100012469 3300026118 Bacteria 7940
302 Ga0207675_100061283 3300026118 Bacteria 3512
303 Ga0207683_10000262 3300026121 Bacteria 47039
304 Ga0207698_10493449 3300026142 Bacteria 1190
305 Ga0268265_10548852 3300028380 Bacteria 1097
306 Ga0268264_10219178 3300028381 Bacteria 1751
307 Ga0265319_1001400 3300028563 Bacteria 14462
308 Ga0265319_1001726 3300028563 Bacteria 12581
309 Ga0265319_1015462 3300028563 Bacteria 2959
310 Ga0265334_10000531 3300028573 Bacteria 19440
311 Ga0265334_10047221 3300028573 Bacteria 1662
312 Ga0265318_10000197 3300028577 Bacteria 52920
313 Ga0265318_10001153 3300028577 Bacteria 16417
314 Ga0265318_10026984 3300028577 Bacteria 2260
315 Ga0265322_10011001 3300028654 Bacteria 2624
316 Ga0265322_10081164 3300028654 Bacteria 920
317 Ga0265336_10010191 3300028666 Bacteria 3221
318 Ga0265336_10015563 3300028666 Bacteria 2498
319 Ga0265336_10039696 3300028666 Bacteria 1442
320 Ga0265336_10075535 3300028666 Bacteria 1007
321 Ga0265336_10129762 3300028666 Bacteria 750
322 Ga0265338_10001136 3300028800 Bacteria 44077
323 Ga0265338_10005668 3300028800 Bacteria 16194
324 Ga0265338_10013542 3300028800 Bacteria 9194
325 Ga0265338_10098155 3300028800 Bacteria 2397
326 Ga0265338_10236190 3300028800 Bacteria 1356
327 Ga0265338_10293118 3300028800 Bacteria 1185
328 Ga0265324_10091769 3300029957 Bacteria 1033
329 Ga0265330_10000626 3300031235 Bacteria 22841
330 Ga0265330_10014950 3300031235 Bacteria 3595
331 Ga0265332_10017312 3300031238 Bacteria 3181
332 Ga0265328_10007120 3300031239 Bacteria 4686
333 Ga0265325_10002011 3300031241 Bacteria 13964
334 Ga0265325_10053981 3300031241 Bacteria 2059
335 Ga0265329_10001354 3300031242 Bacteria 11887
336 Ga0265340_10007159 3300031247 Bacteria 6076
337 Ga0265340_10037920 3300031247 Bacteria 2386
338 Ga0265339_10003320 3300031249 Bacteria 11270
339 Ga0265339_10007751 3300031249 Bacteria 6902
340 Ga0265331_10000942 3300031250 Bacteria 23214
341 Ga0265331_10025154 3300031250 Bacteria 3007
342 Ga0265331_10086654 3300031250 Bacteria 1451
343 Ga0265327_10002175 3300031251 Bacteria 21560
344 Ga0265327_10020769 3300031251 Bacteria 3988
345 Ga0265327_10028630 3300031251 Bacteria 3182
346 Ga0265327_10039170 3300031251 Bacteria 2577
347 Ga0265316_10006881 3300031344 Bacteria 10789
348 Ga0265316_10308802 3300031344 Bacteria 1151
349 Ga0307408_100229703 3300031548 Bacteria 1519
350 Ga0265313_10020753 3300031595 Bacteria 3615
351 Ga0265313_10069995 3300031595 Bacteria 1618
352 Ga0265313_10125470 3300031595 Bacteria 1116
353 Ga0265314_10012157 3300031711 Bacteria 7049
354 Ga0265314_10017534 3300031711 Bacteria 5617
355 Ga0265342_10004117 3300031712 Bacteria 11588
356 Ga0265342_10007045 3300031712 Bacteria 8289
357 Ga0265342_10042406 3300031712 Bacteria 2749
358 Ga0307416_100146948 3300032002 Bacteria 2154
359 Ga0307415_100024667 3300032126 Bacteria 3760
360 Ga0373948_0004226 3300034817 Bacteria 2257
361 Ga0373958_0011107 3300034819 Bacteria 1515
362 Ga0373959_0021327 3300034820 Bacteria 1243
363 Ga0373926_0019053 3300035083 Bacteria 2365
364 Ga0373928_0014516 3300035084 Bacteria 1594
365 Ga0373929_0003618 3300035085 Bacteria 2776
366 Ga0373949_0012980 3300035090 Bacteria 1846
367 Ga0373951_0005542 3300035091 Bacteria 2928
368 Ga0373952_0007264 3300035092 Bacteria 2071
369 Ga0373932_0005667 3300035112 Bacteria 2937
370 Ga0373939_0002231 3300035114 Bacteria 4590
371 Ga0373945_0289164 3300035116 Bacteria 700
372 Ga0373954_0249559 3300035118 Bacteria 874
373 Ga0373956_0199299 3300035119 Bacteria 949
374 Ga0373960_0005256 3300035121 Bacteria 2991
375 Ga0373961_0037687 3300035241 Bacteria 1382
376 Ga0373962_0012258 3300035242 Bacteria 2157
377 Ga0373924_0131466 3300035410 Bacteria 1089
378 Ga0373931_0007745 3300035691 Bacteria 5071
379 Ga0373931_0496876 3300035691 Bacteria 786
380 Ga0373927_0031585 3300035695 Bacteria 3451
381 Ga0373933_0072794 3300035724 Bacteria 2093
382 Ga0373947_0004274 3300035725 Bacteria 8385
383 Ga0373947_0082048 3300035725 Bacteria 1998
384 Ga0373937_0084688 3300036401 Bacteria 2933
385 Ga0373925_0005302 3300037068 Bacteria 9625
386 Ga0373925_0354680 3300037068 Bacteria 1191
387 Ga0395899_0005387 3300037312 Bacteria 9940
388 Ga0395899_0016691 3300037312 Bacteria 5598
389 Ga0395899_0024326 3300037312 Bacteria 4579
390 Ga0395899_0107372 3300037312 Bacteria 2009
391 Ga0395899_0140139 3300037312 Bacteria 1721
392 Ga0395899_0251332 3300037312 Bacteria 1213
393 Ga0395900_0005706 3300037418 Bacteria 13012
394 Ga0395900_0012562 3300037418 Bacteria 8665
395 Ga0395900_0023819 3300037418 Bacteria 6264
396 Ga0395900_0047537 3300037418 Bacteria 4418
397 Ga0395900_0054326 3300037418 Bacteria 4124
398 Ga0395900_0073002 3300037418 Bacteria 3527
399 Ga0395900_0131871 3300037418 Bacteria 2560
400 Ga0395900_0213670 3300037418 Bacteria 1947
401 Ga0395900_0240632 3300037418 Bacteria 1816
402 Ga0395900_0302161 3300037418 Bacteria 1586
403 Ga0395900_0513986 3300037418 Bacteria 1146
404 Ga0395898_0002053 3300037466 Bacteria 25121
405 Ga0395898_0002193 3300037466 Bacteria 23839
406 Ga0395898_0013859 3300037466 Bacteria 8285
407 Ga0395898_0015806 3300037466 Bacteria 7735
408 Ga0395898_0045267 3300037466 Bacteria 4326
409 Ga0395898_0073780 3300037466 Bacteria 3296
410 Ga0395898_0083930 3300037466 Bacteria 3070
411 Ga0395898_0231248 3300037466 Bacteria 1763
412 Ga0395898_0302807 3300037466 Bacteria 1525
413 Ga0395898_0506861 3300037466 Bacteria 1148
414 Ga0395898_0683473 3300037466 Bacteria 968
415 Ga0395898_1003219 3300037466 Bacteria 771
416 Ga0395905_0010295 3300037471 Bacteria 9104
417 Ga0395905_0019755 3300037471 Bacteria 6387
418 Ga0395905_0055519 3300037471 Bacteria 3706
419 Ga0395905_0067615 3300037471 Bacteria 3347
420 Ga0395905_0079329 3300037471 Bacteria 3077
421 Ga0395905_0112488 3300037471 Bacteria 2557
422 Ga0395905_0137223 3300037471 Bacteria 2301
423 Ga0395905_0377801 3300037471 Unclassified 1310
424 Ga0395905_0394254 3300037471 Bacteria 1279
425 Ga0395905_0576827 3300037471 Unclassified 1026
426 Ga0395905_0841048 3300037471 Bacteria 821
427 Ga0395905_1110672 3300037471 Bacteria 694
428 Ga0395901_0002380 3300038443 Bacteria 19130
429 Ga0395901_0007531 3300038443 Bacteria 10995
430 Ga0395901_0014202 3300038443 Bacteria 8107
431 Ga0395901_0024354 3300038443 Bacteria 6211
432 Ga0395901_0034604 3300038443 Bacteria 5217
433 Ga0395901_0121799 3300038443 Bacteria 2741
434 Ga0395901_0172582 3300038443 Bacteria 2268
435 Ga0395901_0182190 3300038443 Unclassified 2203
436 Ga0395901_0210537 3300038443 Bacteria 2035
437 Ga0395901_0244598 3300038443 Bacteria 1870
438 Ga0395901_0592013 3300038443 Bacteria 1119
439 Ga0395901_0784483 3300038443 Bacteria 943
440 Ga0242420_026687 3300038996 Bacteria 1055
441 Ga0436360_0640321 3300039438 Bacteria 23023
442 Ga0436360_1349107 3300039438 Unclassified 3217
443 Ga0436363_0236899 3300039450 Bacteria 991
444 Ga0451787_845750 3300041441 Unclassified 1043
445 Ga0451793_1037934 3300041452 Bacteria 3714
446 Ga0451798_0070554 3300041458 Unclassified 937
447 Ga0451802_1348883 3300041460 Bacteria 689
448 Ga0451802_1818341 3300041460 Unclassified 1287
449 Ga0451835_0953254 3300041492 Unclassified 1740
450 Ga0451839_0669733 3300041496 Bacteria 1591
451 Ga0451841_0048648 3300041498 Unclassified 987
452 Ga0451845_0185107 3300041501 Bacteria 2333
453 Ga0451847_0728326 3300041503 Unclassified 1117
454 Ga0451849_0784089 3300041505 Unclassified 1101
455 Ga0451851_0387679 3300041507 Bacteria 2245
456 Ga0439458_0093195 3300042157 Bacteria 777
457 Ga0466969_0162874 3300044656 Bacteria 1025
458 Ga0453683_0257022 3300044673 Unclassified 1114
459 Ga0466966_0103805 3300044684 Bacteria 1756
460 Ga0466966_0139911 3300044684 Bacteria 1479
461 Ga0466961_0004980 3300044693 Bacteria 8354
462 Ga0466961_0046485 3300044693 Bacteria 2776
463 Ga0466961_0078167 3300044693 Bacteria 2096
464 Ga0466961_0095904 3300044693 Bacteria 1870
465 Ga0466961_0208829 3300044693 Bacteria 1206
466 Ga0466961_0249038 3300044693 Bacteria 1091
467 Ga0466963_0001284 3300044694 Bacteria 13335
468 Ga0466963_0004381 3300044694 Bacteria 8202
469 Ga0466963_0008647 3300044694 Bacteria 6111
470 Ga0466963_0012642 3300044694 Bacteria 5171
471 Ga0466963_0020595 3300044694 Bacteria 4147
472 Ga0466963_0042698 3300044694 Bacteria 2978
473 Ga0466963_0068186 3300044694 Bacteria 2388
474 Ga0466963_0106728 3300044694 Bacteria 1920
475 Ga0466963_0112408 3300044694 Bacteria 1870
476 Ga0466963_0153557 3300044694 Bacteria 1599
477 Ga0466963_0172072 3300044694 Bacteria 1510
478 Ga0466964_0001577 3300044706 Bacteria 7848
479 Ga0466964_0026261 3300044706 Bacteria 2279
480 Ga0466964_0096569 3300044706 Bacteria 1295
481 Ga0466971_0001292 3300044719 Bacteria 10455
482 Ga0466971_0007129 3300044719 Bacteria 4864
483 Ga0466971_0022221 3300044719 Bacteria 2825
484 Ga0466971_0030905 3300044719 Bacteria 2397
485 Ga0466971_0104360 3300044719 Bacteria 1304
486 Ga0466968_0051762 3300044735 Bacteria 1755
487 Ga0466968_0054463 3300044735 Bacteria 1715
488 Ga0466970_0039675 3300044765 Bacteria 2499
489 Ga0466970_0047961 3300044765 Bacteria 2277
490 Ga0466957_0002456 3300044842 Bacteria 9949
491 Ga0466957_0014108 3300044842 Bacteria 4648
492 Ga0466957_0034683 3300044842 Bacteria 3026
493 Ga0466957_0058157 3300044842 Unclassified 2368
494 Ga0466957_0115532 3300044842 Bacteria 1706
495 Ga0466960_0075432 3300044901 Bacteria 1687
496 Ga0466960_0086219 3300044901 Bacteria 1592
497 Ga0466960_0130230 3300044901 Bacteria 1327
498 Ga0466960_0162041 3300044901 Bacteria 1201
499 Ga0466960_0164385 3300044901 Bacteria 1194
500 Ga0466960_0201300 3300044901 Bacteria 1088
501 Ga0466959_0001782 3300045049 Bacteria 13445
502 Ga0466959_0005602 3300045049 Bacteria 8632
503 Ga0466959_0009035 3300045049 Bacteria 7070
504 Ga0466959_0016644 3300045049 Bacteria 5376
505 Ga0466959_0022496 3300045049 Bacteria 4661
506 Ga0466959_0048828 3300045049 Bacteria 3110
507 Ga0466959_0075158 3300045049 Bacteria 2442
508 Ga0466959_0197203 3300045049 Bacteria 1403
509 Ga0466959_0287134 3300045049 Bacteria 1128
510 Ga0466959_0290339 3300045049 Bacteria 1121
511 Ga0466958_0002166 3300045836 Bacteria 9784
512 Ga0466958_0011620 3300045836 Bacteria 4962
513 Ga0466958_0014090 3300045836 Bacteria 4561
514 Ga0466958_0017039 3300045836 Bacteria 4193
515 Ga0466958_0025442 3300045836 Bacteria 3491
516 Ga0466958_0070476 3300045836 Bacteria 2139
517 Ga0466958_0141751 3300045836 Unclassified 1513
518 Ga0466967_0000648 3300045976 Bacteria 17473
519 Ga0466967_0008322 3300045976 Bacteria 7586
520 Ga0466967_0019805 3300045976 Bacteria 5421
521 Ga0466967_0022282 3300045976 Bacteria 5165
522 Ga0466967_0031278 3300045976 Bacteria 4478
523 Ga0466967_0077059 3300045976 Bacteria 3000
524 Ga0466967_0130134 3300045976 Bacteria 2335
525 Ga0466967_0143920 3300045976 Bacteria 2222
526 Ga0466967_0197159 3300045976 Bacteria 1905
527 Ga0466967_0245851 3300045976 Bacteria 1707
528 Ga0466967_0284372 3300045976 Bacteria 1587
529 Ga0466967_0285097 3300045976 Bacteria 1585
530 Ga0466967_0288711 3300045976 Bacteria 1575
531 Ga0466967_0408358 3300045976 Bacteria 1322
532 Ga0466967_1641877 3300045976 Bacteria 640
533 Ga0495592_0138081 3300046454 Bacteria 1698
534 Ga0495603_0039235 3300046455 Bacteria 2838
535 Ga0495629_0029097 3300046459 Bacteria 3920
536 Ga0495629_0091699 3300046459 Bacteria 2120
537 Ga0495629_0157599 3300046459 Bacteria 1577
538 Ga0495641_0001891 3300046461 Bacteria 17145
539 Ga0495641_0096279 3300046461 Bacteria 1321
540 Ga0495651_0009031 3300046462 Bacteria 7654
541 Ga0495651_0423252 3300046462 Bacteria 865
542 Ga0495653_0301865 3300046463 Bacteria 1044
543 Ga0495580_0202582 3300046472 Bacteria 1367
544 Ga0495582_0013172 3300046473 Bacteria 4550
545 Ga0495582_0014279 3300046473 Bacteria 4369
546 Ga0495639_0000124 3300046475 Bacteria 39427
547 Ga0495664_0001606 3300046477 Bacteria 12016
548 Ga0495664_0227172 3300046477 Bacteria 1130
549 Ga0495584_0091085 3300046491 Bacteria 1538
550 Ga0495585_0373380 3300046492 Bacteria 690
551 Ga0495596_0091876 3300046500 Bacteria 1178
552 Ga0495608_0011822 3300046511 Bacteria 6073
553 Ga0495608_0175417 3300046511 Bacteria 1358
554 Ga0495618_0031836 3300046514 Bacteria 3302
555 Ga0495618_0042321 3300046514 Bacteria 2871
556 Ga0495628_0022690 3300046516 Bacteria 5155
557 Ga0495628_0129284 3300046516 Bacteria 1933
558 Ga0495630_0017182 3300046517 Bacteria 5297
559 Ga0495630_0107439 3300046517 Bacteria 2114
560 Ga0495644_0037913 3300046523 Bacteria 1819
561 Ga0495663_0126358 3300046525 Bacteria 859
562 Ga0495666_0000313 3300046526 Bacteria 21047
563 Ga0495642_0005247 3300046528 Bacteria 4981
564 Ga0495652_0010488 3300046529 Bacteria 8395
565 Ga0495665_0004150 3300046531 Bacteria 7814
566 Ga0495640_0170764 3300046533 Bacteria 1389
567 Ga0495640_0362263 3300046533 Unclassified 894
568 Ga0495645_0084916 3300046543 Bacteria 2266
569 Ga0495645_0285956 3300046543 Bacteria 1083
570 Ga0495667_0007852 3300046559 Bacteria 7232
571 Ga0495667_0033246 3300046559 Bacteria 3452
572 Ga0495667_0052013 3300046559 Bacteria 2700
573 Ga0495656_0334205 3300046615 Bacteria 782
574 Ga0495634_0018558 3300046642 Bacteria 4950
575 Ga0495635_0021037 3300046663 Bacteria 4546
576 Ga0495635_0035669 3300046663 Bacteria 3448
577 Ga0495635_0085658 3300046663 Bacteria 2156
578 Ga0495659_0030003 3300046664 Bacteria 1890
579 Ga0495588_0021195 3300046674 Bacteria 3200
580 Ga0495588_0088231 3300046674 Bacteria 1623
581 Ga0495657_0104954 3300046675 Bacteria 1796
582 Ga0495657_0257596 3300046675 Bacteria 1049
583 Ga0495646_0016017 3300046680 Bacteria 4758
584 Ga0495647_0000284 3300046681 Bacteria 14074
585 Ga0495647_0016468 3300046681 Bacteria 2603
586 Ga0495647_0058033 3300046681 Bacteria 1520
587 Ga0495658_0014682 3300046683 Bacteria 4005
588 Ga0495658_0043600 3300046683 Bacteria 2510
589 Ga0495613_0008842 3300046689 Bacteria 7470
590 Ga0495624_0088892 3300046690 Bacteria 1907
591 Ga0495670_0275548 3300046691 Bacteria 899
592 Ga0495670_0288707 3300046691 Bacteria 878
593 Ga0495589_0055300 3300046794 Bacteria 1956
594 Ga0495581_0006215 3300047315 Bacteria 6927
595 Ga0495581_0032602 3300047315 Bacteria 3016
596 Ga0495604_0149207 3300047317 Bacteria 1663
597 Ga0495636_0134365 3300047318 Bacteria 1102
598 Ga0495674_0030088 3300047319 Bacteria 4940
599 Ga0495674_0104988 3300047319 Bacteria 2402
600 Ga0495676_0005328 3300047321 Bacteria 11781
601 Ga0495676_0030870 3300047321 Bacteria 4540
602 Ga0495680_0001115 3300047322 Bacteria 29670
603 Ga0495680_0019071 3300047322 Bacteria 5806
604 Ga0495680_0065106 3300047322 Bacteria 2793
605 Ga0495680_0123006 3300047322 Bacteria 1914
606 Ga0495675_0183325 3300047444 Bacteria 1281
607 Ga0495684_0016876 3300047471 Bacteria 5625
608 Ga0495684_0035641 3300047471 Bacteria 3814
609 Ga0495684_0274417 3300047471 Bacteria 1219
610 Ga0495684_0428599 3300047471 Bacteria 923
611 Ga0495593_0003235 3300047673 Bacteria 9764
612 Ga0495614_0000837 3300048089 Bacteria 13016
613 Ga0495614_0313816 3300048089 Bacteria 726
614 Ga0496100_0002332 3300048903 Bacteria 9601
615 Ga0496100_0042161 3300048903 Bacteria 2914
616 Ga0496100_0135610 3300048903 Bacteria 1738
617 Ga0496100_0208502 3300048903 Bacteria 1428
618 Ga0496101_0158745 3300048904 Bacteria 1733
619 Ga0496101_0185604 3300048904 Bacteria 1603
620 Ga0496101_0185768 3300048904 Bacteria 1602
621 Ga0496101_0192551 3300048904 Bacteria 1574
622 Ga0496101_0200591 3300048904 Bacteria 1542
623 Ga0496101_0214356 3300048904 Bacteria 1492
624 Ga0496101_0550194 3300048904 Bacteria 912
625 Ga0496102_0002937 3300048905 Bacteria 14456
626 Ga0496102_0205535 3300048905 Bacteria 1856
627 Ga0496102_0574057 3300048905 Bacteria 1050
628 Ga0496103_0012327 3300048906 Bacteria 5072
629 Ga0496103_0015535 3300048906 Bacteria 4533
630 Ga0496103_0018880 3300048906 Bacteria 4140
631 Ga0496103_0057767 3300048906 Bacteria 2409
632 Ga0496103_0072742 3300048906 Bacteria 2154
633 Ga0496104_0000188 3300048907 Bacteria 55678
634 Ga0496104_0003064 3300048907 Bacteria 14407
635 Ga0496104_0015209 3300048907 Bacteria 6967
636 Ga0496104_0368181 3300048907 Bacteria 1350
637 Ga0496105_0027980 3300048908 Bacteria 4609
638 Ga0496105_0050307 3300048908 Bacteria 3442
639 Ga0496105_0152010 3300048908 Bacteria 1902
640 Ga0496105_0174957 3300048908 Bacteria 1758
641 Ga0496105_0451590 3300048908 Bacteria 1014
642 Ga0496105_0883262 3300048908 Bacteria 675
643 Ga0496106_0003891 3300048909 Bacteria 11143
644 Ga0496106_0245931 3300048909 Bacteria 1429
645 Ga0496106_0257026 3300048909 Bacteria 1397
646 Ga0496106_0328995 3300048909 Bacteria 1227
647 Ga0496106_0718634 3300048909 Unclassified 795
648 Ga0496107_0001297 3300048910 Bacteria 15306
649 Ga0496107_0040799 3300048910 Bacteria 3332
650 Ga0496107_0047451 3300048910 Bacteria 3093
651 Ga0496107_0101910 3300048910 Bacteria 2105
652 Ga0496107_0290603 3300048910 Bacteria 1217
653 Ga0496108_0000668 3300048911 Bacteria 26451
654 Ga0496108_0050288 3300048911 Bacteria 3488
655 Ga0496108_0050566 3300048911 Bacteria 3479
656 Ga0496108_0070328 3300048911 Bacteria 2953
657 Ga0496108_0089411 3300048911 Bacteria 2617
658 Ga0496108_0146110 3300048911 Bacteria 2039
659 Ga0496109_0002742 3300048912 Bacteria 14774
660 Ga0496109_0003319 3300048912 Bacteria 13452
661 Ga0496109_0024106 3300048912 Bacteria 5406
662 Ga0496109_0203693 3300048912 Bacteria 1860
663 Ga0496109_0263985 3300048912 Bacteria 1622
664 Ga0496109_0455693 3300048912 Bacteria 1208
665 Ga0496110_0003760 3300048913 Bacteria 11694
666 Ga0496110_0039359 3300048913 Bacteria 4116
667 Ga0496110_0095245 3300048913 Unclassified 2666
668 Ga0496110_0185943 3300048913 Bacteria 1886
669 Ga0496111_0000433 3300048914 Bacteria 21184
670 Ga0496111_0001044 3300048914 Bacteria 15252
671 Ga0496111_0007288 3300048914 Bacteria 7239
672 Ga0496111_0007396 3300048914 Bacteria 7194
673 Ga0496111_0066973 3300048914 Bacteria 2608
674 Ga0496111_0108461 3300048914 Bacteria 2044
675 Ga0496111_0290106 3300048914 Bacteria 1213
676 Ga0496112_0001632 3300048915 Bacteria 17371
677 Ga0496112_0006143 3300048915 Bacteria 10500
678 Ga0496112_0015478 3300048915 Bacteria 7120
679 Ga0496112_0037845 3300048915 Bacteria 4711
680 Ga0496112_0064607 3300048915 Bacteria 3611
681 Ga0496112_0065951 3300048915 Bacteria 3572
682 Ga0496112_0115365 3300048915 Bacteria 2656
683 Ga0496112_0144076 3300048915 Bacteria 2351
684 Ga0496112_0170666 3300048915 Bacteria 2140
685 Ga0496112_0399804 3300048915 Bacteria 1314
686 Ga0496112_0505389 3300048915 Bacteria 1144
687 Ga0496112_0644814 3300048915 Bacteria 989
688 Ga0496113_0010963 3300048916 Bacteria 6020
689 Ga0496113_0018593 3300048916 Bacteria 4843
690 Ga0496113_0041554 3300048916 Bacteria 3393
691 Ga0496113_0051534 3300048916 Bacteria 3072
692 Ga0496113_0074867 3300048916 Bacteria 2582
693 Ga0496113_0082978 3300048916 Bacteria 2459
694 Ga0496113_0437971 3300048916 Bacteria 1050
695 Ga0496114_0003843 3300048917 Bacteria 11583
696 Ga0496114_0020582 3300048917 Bacteria 5355
697 Ga0496114_0053762 3300048917 Bacteria 3357
698 Ga0496114_0206122 3300048917 Bacteria 1723
699 Ga0496114_0208732 3300048917 Bacteria 1712
700 Ga0496114_0858499 3300048917 Bacteria 788
701 Ga0496115_0025999 3300048918 Bacteria 4563
702 Ga0496115_0045540 3300048918 Bacteria 3502
703 Ga0496115_0051449 3300048918 Bacteria 3303
704 Ga0496115_0064848 3300048918 Bacteria 2950
705 Ga0496115_0096971 3300048918 Bacteria 2415
706 Ga0496115_0138643 3300048918 Bacteria 2006
707 Ga0496115_0301572 3300048918 Bacteria 1313
708 Ga0501043_0344105 3300049579 Bacteria 1134
709 Ga0501047_0393640 3300049581 Bacteria 1219
710 Ga0501067_0007704 3300049583 Bacteria 5989
711 Ga0501067_0074612 3300049583 Bacteria 1880
712 Ga0501067_0078971 3300049583 Bacteria 1823
713 Ga0501067_0324404 3300049583 Bacteria 857
714 Ga0501069_0055918 3300049585 Bacteria 2198
715 Ga0501069_0119834 3300049585 Bacteria 1502
716 Ga0501070_0165542 3300049586 Bacteria 1822
717 Ga0501072_0017987 3300049588 Bacteria 5434
718 Ga0501073_0040303 3300049589 Bacteria 3306
719 Ga0501074_0025001 3300049590 Bacteria 4339
720 Ga0501074_0084297 3300049590 Bacteria 2278
721 Ga0501079_0062921 3300049741 Bacteria 2862
722 Ga0501080_0001559 3300049742 Bacteria 19371
723 Ga0501080_0071927 3300049742 Bacteria 3217
724 Ga0501083_0009330 3300049744 Bacteria 6926
725 nmdc:mga03n38_32490_c1 3300050490 Bacteria 2211
726 nmdc:mga05p37_211601_c1 3300050507 Bacteria 2343
727 nmdc:mga05p37_5008_c1 3300050507 Bacteria 15530
728 nmdc:mga05p37_67750_c1 3300050507 Bacteria 4391
729 nmdc:mga06r32_585744_c1 3300050510 Unclassified 1087
730 nmdc:mga06r32_85397_c1 3300050510 Bacteria 3077
731 nmdc:mga0n895_424331_c1 3300050512 Bacteria 1344
732 nmdc:mga0n895_49725_c1 3300050512 Bacteria 4109
733 nmdc:mga0rr50_37176_c1 3300050513 Bacteria 3512
734 nmdc:mga08x19_100733_c1 3300050514 Bacteria 1916
735 nmdc:mga08x19_212790_c1 3300050514 Bacteria 1327
736 nmdc:mga08x19_220620_c1 3300050514 Unclassified 1303
737 Ga0495601_0066496 3300053077 Bacteria 2294
738 Ga0495601_0108812 3300053077 Bacteria 1794
739 Ga0495612_0019686 3300053078 Bacteria 2703
740 Ga0495655_0025617 3300053083 Bacteria 1382
741 Ga0495595_0035258 3300053084 Bacteria 2267
742 Ga0495595_0056991 3300053084 Bacteria 1822
743 Ga0495619_0002423 3300053085 Bacteria 12245
744 Ga0495619_0041217 3300053085 Bacteria 3020
745 Ga0495619_0048439 3300053085 Bacteria 2800
746 Ga0495619_0228455 3300053085 Bacteria 1289
747 Ga0500566_0084772 3300053094 Bacteria 1758
748 Ga0501084_0303070 3300054114 Bacteria 1350
749 Ga0587077_077916 3300059493 Bacteria 754
750 Ga0587080_042803 3300059503 Bacteria 831
751 Ga0587122_017656 3300059628 Bacteria 749
752 Ga0587128_034371 3300059630 Bacteria 857
753 Ga0466962_0000333 3300061719 Bacteria 20176
754 Ga0466962_0005158 3300061719 Bacteria 6283
755 Ga0466962_0007319 3300061719 Bacteria 5296
756 Ga0466962_0014870 3300061719 Bacteria 3750
757 Ga0466962_0061091 3300061719 Bacteria 1799
758 Ga0530510_0087899 3300061734 Bacteria 2265
759 Ga0075365_10143309
760 JGI24742J22300_10036924
761 Ga0058862_12696819
762 Ga0070658_10001923
763 Ga0070658_10009312
764 Ga0070658_10095904
765 Ga0070683_100003875
766 Ga0070683_100029564
767 Ga0070683_100179276
768 Ga0070683_100434320
769 Ga0070666_10128140
770 Ga0070680_100024898
771 Ga0070680_100025696
772 Ga0070680_100042832
773 Ga0070680_100054278
774 Ga0070680_100240828
775 Ga0070682_100012139
776 Ga0070682_100266621
777 Ga0070682_100693106
778 Ga0070660_100014142
779 Ga0070660_100018143
780 Ga0070660_100018912
781 Ga0070660_100188861
782 Ga0070660_100533982
783 Ga0070689_100012172
784 Ga0070691_10341651
785 Ga0070687_100321358
786 Ga0070661_100098331
787 Ga0070661_100101685
788 Ga0070661_100386906
789 Ga0070692_10247447
790 Ga0070668_100115670
791 Ga0070669_100347629
792 Ga0070675_100020633
793 Ga0070671_100186416
794 Ga0070671_100379438
795 Ga0070674_100005639
796 Ga0070673_100133517
797 Ga0070688_100016002
798 Ga0070659_100120632
799 Ga0070659_100130918
800 Ga0070703_10033052
801 Ga0070709_10082455
802 Ga0070709_10293298
803 Ga0070714_100002694
804 Ga0070714_100026064
805 Ga0070714_100053814
806 Ga0070714_100079429
807 Ga0070714_100088596
808 Ga0070714_100373742
809 Ga0070714_100426407
810 Ga0070714_100769014
811 Ga0070714_101370142
812 Ga0070713_100092077
813 Ga0070713_100121751
814 Ga0070713_100253079
815 Ga0070713_100298897
816 Ga0070710_10003097
817 Ga0070710_10017692
818 Ga0070701_10011918
819 Ga0070711_100018012
820 Ga0070711_100174381
821 Ga0070705_100037737
822 Ga0070705_100040298
823 Ga0070694_100530083
824 Ga0070708_100082016
825 Ga0070708_100213456
826 Ga0070708_100421996
827 Ga0070708_100642661
828 Ga0070678_100026628
829 Ga0070681_10112465
830 Ga0070681_10216014
831 Ga0068867_100006828
832 Ga0068867_100707062
833 Ga0070706_100001401
834 Ga0070706_100027202
835 Ga0070706_100365752
836 Ga0070707_100006137
837 Ga0070707_100113886
838 Ga0070707_100168307
839 Ga0070707_100192445
840 Ga0070707_100277119
841 Ga0070707_100622783
842 Ga0070707_100975493
843 Ga0070698_100017579
844 Ga0070698_100052946
845 Ga0070698_100095006
846 Ga0070698_100104128
847 Ga0070698_100182083
848 Ga0070698_100229687
849 Ga0070698_100451864
850 Ga0070698_100532516
851 Ga0070699_100104381
852 Ga0070699_100169661
853 Ga0070679_100150570
854 Ga0070679_100215791
855 Ga0070679_100242752
856 Ga0070679_100810250
857 Ga0070684_100013215
858 Ga0070684_100164585
859 Ga0070684_100184024
860 Ga0070684_100374003
861 Ga0070697_100164103
862 Ga0070697_100679517
863 Ga0068853_100015612
864 Ga0070686_100004382
865 Ga0070695_100000231
866 Ga0070695_100134934
867 Ga0070696_100027249
868 Ga0070696_100456771
869 Ga0070665_100041443
870 Ga0070704_100106063
871 Ga0070704_100396386
872 Ga0068855_100146496
873 Ga0068855_100208575
874 Ga0068855_100870205
875 Ga0068857_100322506
876 Ga0068854_100377789
877 Ga0068856_100014707
878 Ga0068856_100261502
879 Ga0068856_100558113
880 Ga0070702_100072626
881 Ga0068852_100038086
882 Ga0068852_100308027
883 Ga0068852_100577094
884 Ga0068866_10006032
885 Ga0068866_10230547
886 Ga0068861_100038498
887 Ga0068861_100752330
888 Ga0068860_100896937
889 Ga0068862_100221613
890 Ga0081539_10005968
891 Ga0081539_10300689
892 Ga0070717_10018317
893 Ga0070717_10139346
894 Ga0070717_10287812
895 Ga0070717_11094532
896 Ga0070715_10010063
897 Ga0070716_100015237
898 Ga0070716_100073723
899 Ga0070716_100109187
900 Ga0070712_100004431
901 Ga0070712_100032500
902 Ga0070712_100072705
903 Ga0070712_100289136
904 Ga0070712_100329624
905 Ga0097621_100005052
906 Ga0068871_100245974
907 Ga0075434_100036046
908 Ga0075429_101004048
909 Ga0068865_100001717
910 Ga0075436_100328533
911 Ga0075436_100452488
912 Ga0075435_100084580
913 Ga0099795_10274692
914 Ga0105240_10019802
915 Ga0105240_10029533
916 Ga0105240_10917342
917 Ga0105245_10061036
918 Ga0114129_10018315
919 Ga0114129_10740169
920 Ga0105243_10237005
921 Ga0105241_10324730
922 Ga0105248_10052205
923 Ga0105237_10064534
924 Ga0105237_10166645
925 Ga0105237_10283278
926 Ga0105237_10784657
927 Ga0105238_10047776
928 Ga0105238_10840990
929 Ga0105249_10003715
930 Ga0105239_10034604
931 Ga0105239_10907455
932 Ga0157373_10125051
933 Ga0157373_10228250
934 Ga0157373_10694818
935 Ga0157371_10165728
936 Ga0157370_10011840
937 Ga0157370_10019665
938 Ga0157370_10618200
939 Ga0157369_10024176
940 Ga0157369_10024611
941 Ga0157369_10047050
942 Ga0157369_10174803
943 Ga0157369_10231407
944 Ga0157369_10246375
945 Ga0157369_10912525
946 Ga0157369_11083658
947 Ga0163162_10194925
948 Ga0157372_10115289
949 Ga0157372_11234272
950 Ga0157375_10423229
951 Ga0163163_10198505
952 Ga0182008_10051097
953 Ga0157376_10011995
954 Ga0182006_1019266
955 Ga0197907_11164713
956 Ga0206356_10660088
957 Ga0206349_1260290
958 Ga0206352_10452862
959 Ga0206350_11368982
960 Ga0206354_10459876
961 Ga0224712_10015343
962 Ga0224712_10047466
963 Ga0207656_10443165
964 Ga0207692_10088678
965 Ga0207692_10363578
966 Ga0207642_10018124
967 Ga0207710_10154886
968 Ga0207688_10021149
969 Ga0207680_10021008
970 Ga0207685_10004620
971 Ga0207699_10019352
972 Ga0207699_10239027
973 Ga0207705_10017839
974 Ga0207705_10020415
975 Ga0207705_10133328
976 Ga0207705_10149880
977 Ga0207684_10055395
978 Ga0207684_10158073
979 Ga0207654_10389029
980 Ga0207707_10008036
981 Ga0207707_10228226
982 Ga0207707_10758944
983 Ga0207695_10231931
984 Ga0207671_10705680
985 Ga0207693_10005025
986 Ga0207693_10011729
987 Ga0207693_10029818
988 Ga0207693_10064467
989 Ga0207693_10065011
990 Ga0207693_10083222
991 Ga0207663_10046061
992 Ga0207660_10047622
993 Ga0207660_10063661
994 Ga0207660_10104481
995 Ga0207660_10276212
996 Ga0207660_10359939
997 Ga0207662_10048967
998 Ga0207657_10009553
999 Ga0207657_10011660
1000 Ga0207657_10017180
1001 Ga0207657_10017602
1002 Ga0207657_10052448
1003 Ga0207657_10183201
1004 Ga0207649_10157319
1005 Ga0207652_10131820
1006 Ga0207652_10141314
1007 Ga0207652_10183923
1008 Ga0207652_10294272
1009 Ga0207646_10004153
1010 Ga0207646_10010342
1011 Ga0207646_10029650
1012 Ga0207646_10058728
1013 Ga0207646_10141736
1014 Ga0207646_10522294
1015 Ga0207646_10615033
1016 Ga0207694_10090186
1017 Ga0207694_10427900
1018 Ga0207694_10781466
1019 Ga0207687_10137205
1020 Ga0207700_10115533
1021 Ga0207700_10335360
1022 Ga0207664_10067406
1023 Ga0207664_10076139
1024 Ga0207664_10090443
1025 Ga0207664_10138080
1026 Ga0207664_10287249
1027 Ga0207664_10295451
1028 Ga0207664_10637324
1029 Ga0207664_10789333
1030 Ga0207644_10413328
1031 Ga0207644_10855923
1032 Ga0207690_10286506
1033 Ga0207706_10082059
1034 Ga0207686_10980104
1035 Ga0207709_10001561
1036 Ga0207709_10063893
1037 Ga0207670_10005360
1038 Ga0207704_10009209
1039 Ga0207665_10009523
1040 Ga0207665_10023818
1041 Ga0207665_10257846
1042 Ga0207691_10010135
1043 Ga0207691_10104108
1044 Ga0207711_10097885
1045 Ga0207689_10113478
1046 Ga0207689_10318000
1047 Ga0207661_10044940
1048 Ga0207661_10087757
1049 Ga0207661_10187130
1050 Ga0207661_10248030
1051 Ga0207667_10017450
1052 Ga0207667_10447586
1053 Ga0207651_10131115
1054 Ga0207668_10020001
1055 Ga0207703_10454760
1056 Ga0207639_10015422
1057 Ga0207702_10628261
1058 Ga0207648_10003432
1059 Ga0207675_100012469
1060 Ga0207675_100061283
1061 Ga0207683_10000262
1062 Ga0207698_10493449
1063 Ga0268265_10548852
1064 Ga0268264_10219178
1065 Ga0265319_1001400
1066 Ga0265319_1001726
1067 Ga0265319_1015462
1068 Ga0265334_10000531
1069 Ga0265334_10047221
1070 Ga0265318_10000197
1071 Ga0265318_10001153
1072 Ga0265318_10026984
1073 Ga0265322_10011001
1074 Ga0265322_10081164
1075 Ga0265336_10010191
1076 Ga0265336_10015563
1077 Ga0265336_10039696
1078 Ga0265336_10075535
1079 Ga0265336_10129762
1080 Ga0265338_10001136
1081 Ga0265338_10005668
1082 Ga0265338_10013542
1083 Ga0265338_10098155
1084 Ga0265338_10236190
1085 Ga0265338_10293118
1086 Ga0265324_10091769
1087 Ga0265330_10000626
1088 Ga0265330_10014950
1089 Ga0265332_10017312
1090 Ga0265328_10007120
1091 Ga0265325_10002011
1092 Ga0265325_10053981
1093 Ga0265329_10001354
1094 Ga0265340_10007159
1095 Ga0265340_10037920
1096 Ga0265339_10003320
1097 Ga0265339_10007751
1098 Ga0265331_10000942
1099 Ga0265331_10025154
1100 Ga0265331_10086654
1101 Ga0265327_10002175
1102 Ga0265327_10020769
1103 Ga0265327_10028630
1104 Ga0265327_10039170
1105 Ga0265316_10006881
1106 Ga0265316_10308802
1107 Ga0307408_100229703
1108 Ga0265313_10020753
1109 Ga0265313_10069995
1110 Ga0265313_10125470
1111 Ga0265314_10012157
1112 Ga0265314_10017534
1113 Ga0265342_10004117
1114 Ga0265342_10007045
1115 Ga0265342_10042406
1116 Ga0307416_100146948
1117 Ga0307415_100024667
1118 Ga0373948_0004226
1119 Ga0373958_0011107
1120 Ga0373959_0021327
1121 Ga0373926_0019053
1122 Ga0373928_0014516
1123 Ga0373929_0003618
1124 Ga0373949_0012980
1125 Ga0373951_0005542
1126 Ga0373952_0007264
1127 Ga0373932_0005667
1128 Ga0373939_0002231
1129 Ga0373945_0289164
1130 Ga0373954_0249559
1131 Ga0373956_0199299
1132 Ga0373960_0005256
1133 Ga0373961_0037687
1134 Ga0373962_0012258
1135 Ga0373924_0131466
1136 Ga0373931_0007745
1137 Ga0373931_0496876
1138 Ga0373927_0031585
1139 Ga0373933_0072794
1140 Ga0373947_0004274
1141 Ga0373947_0082048
1142 Ga0373937_0084688
1143 Ga0373925_0005302
1144 Ga0373925_0354680
1145 Ga0395899_0005387
1146 Ga0395899_0016691
1147 Ga0395899_0024326
1148 Ga0395899_0107372
1149 Ga0395899_0140139
1150 Ga0395899_0251332
1151 Ga0395900_0005706
1152 Ga0395900_0012562
1153 Ga0395900_0023819
1154 Ga0395900_0047537
1155 Ga0395900_0054326
1156 Ga0395900_0073002
1157 Ga0395900_0131871
1158 Ga0395900_0213670
1159 Ga0395900_0240632
1160 Ga0395900_0302161
1161 Ga0395900_0513986
1162 Ga0395898_0002053
1163 Ga0395898_0002193
1164 Ga0395898_0013859
1165 Ga0395898_0015806
1166 Ga0395898_0045267
1167 Ga0395898_0073780
1168 Ga0395898_0083930
1169 Ga0395898_0231248
1170 Ga0395898_0302807
1171 Ga0395898_0506861
1172 Ga0395898_0683473
1173 Ga0395898_1003219
1174 Ga0395905_0010295
1175 Ga0395905_0019755
1176 Ga0395905_0055519
1177 Ga0395905_0067615
1178 Ga0395905_0079329
1179 Ga0395905_0112488
1180 Ga0395905_0137223
1181 Ga0395905_0377801
1182 Ga0395905_0394254
1183 Ga0395905_0576827
1184 Ga0395905_0841048
1185 Ga0395905_1110672
1186 Ga0395901_0002380
1187 Ga0395901_0007531
1188 Ga0395901_0014202
1189 Ga0395901_0024354
1190 Ga0395901_0034604
1191 Ga0395901_0121799
1192 Ga0395901_0172582
1193 Ga0395901_0182190
1194 Ga0395901_0210537
1195 Ga0395901_0244598
1196 Ga0395901_0592013
1197 Ga0395901_0784483
1198 Ga0242420_026687
1199 Ga0436360_0640321
1200 Ga0436360_1349107
1201 Ga0436363_0236899
1202 Ga0451787_845750
1203 Ga0451793_1037934
1204 Ga0451798_0070554
1205 Ga0451802_1348883
1206 Ga0451802_1818341
1207 Ga0451835_0953254
1208 Ga0451839_0669733
1209 Ga0451841_0048648
1210 Ga0451845_0185107
1211 Ga0451847_0728326
1212 Ga0451849_0784089
1213 Ga0451851_0387679
1214 Ga0439458_0093195
1215 Ga0466969_0162874
1216 Ga0453683_0257022
1217 Ga0466966_0103805
1218 Ga0466966_0139911
1219 Ga0466961_0004980
1220 Ga0466961_0046485
1221 Ga0466961_0078167
1222 Ga0466961_0095904
1223 Ga0466961_0208829
1224 Ga0466961_0249038
1225 Ga0466963_0001284
1226 Ga0466963_0004381
1227 Ga0466963_0008647
1228 Ga0466963_0012642
1229 Ga0466963_0020595
1230 Ga0466963_0042698
1231 Ga0466963_0068186
1232 Ga0466963_0106728
1233 Ga0466963_0112408
1234 Ga0466963_0153557
1235 Ga0466963_0172072
1236 Ga0466964_0001577
1237 Ga0466964_0026261
1238 Ga0466964_0096569
1239 Ga0466971_0001292
1240 Ga0466971_0007129
1241 Ga0466971_0022221
1242 Ga0466971_0030905
1243 Ga0466971_0104360
1244 Ga0466968_0051762
1245 Ga0466968_0054463
1246 Ga0466970_0039675
1247 Ga0466970_0047961
1248 Ga0466957_0002456
1249 Ga0466957_0014108
1250 Ga0466957_0034683
1251 Ga0466957_0058157
1252 Ga0466957_0115532
1253 Ga0466960_0075432
1254 Ga0466960_0086219
1255 Ga0466960_0130230
1256 Ga0466960_0162041
1257 Ga0466960_0164385
1258 Ga0466960_0201300
1259 Ga0466959_0001782
1260 Ga0466959_0005602
1261 Ga0466959_0009035
1262 Ga0466959_0016644
1263 Ga0466959_0022496
1264 Ga0466959_0048828
1265 Ga0466959_0075158
1266 Ga0466959_0197203
1267 Ga0466959_0287134
1268 Ga0466959_0290339
1269 Ga0466958_0002166
1270 Ga0466958_0011620
1271 Ga0466958_0014090
1272 Ga0466958_0017039
1273 Ga0466958_0025442
1274 Ga0466958_0070476
1275 Ga0466958_0141751
1276 Ga0466967_0000648
1277 Ga0466967_0008322
1278 Ga0466967_0019805
1279 Ga0466967_0022282
1280 Ga0466967_0031278
1281 Ga0466967_0077059
1282 Ga0466967_0130134
1283 Ga0466967_0143920
1284 Ga0466967_0197159
1285 Ga0466967_0245851
1286 Ga0466967_0284372
1287 Ga0466967_0285097
1288 Ga0466967_0288711
1289 Ga0466967_0408358
1290 Ga0466967_1641877
1291 Ga0495592_0138081
1292 Ga0495603_0039235
1293 Ga0495629_0029097
1294 Ga0495629_0091699
1295 Ga0495629_0157599
1296 Ga0495641_0001891
1297 Ga0495641_0096279
1298 Ga0495651_0009031
1299 Ga0495651_0423252
1300 Ga0495653_0301865
1301 Ga0495580_0202582
1302 Ga0495582_0013172
1303 Ga0495582_0014279
1304 Ga0495639_0000124
1305 Ga0495664_0001606
1306 Ga0495664_0227172
1307 Ga0495584_0091085
1308 Ga0495585_0373380
1309 Ga0495596_0091876
1310 Ga0495608_0011822
1311 Ga0495608_0175417
1312 Ga0495618_0031836
1313 Ga0495618_0042321
1314 Ga0495628_0022690
1315 Ga0495628_0129284
1316 Ga0495630_0017182
1317 Ga0495630_0107439
1318 Ga0495644_0037913
1319 Ga0495663_0126358
1320 Ga0495666_0000313
1321 Ga0495642_0005247
1322 Ga0495652_0010488
1323 Ga0495665_0004150
1324 Ga0495640_0170764
1325 Ga0495640_0362263
1326 Ga0495645_0084916
1327 Ga0495645_0285956
1328 Ga0495667_0007852
1329 Ga0495667_0033246
1330 Ga0495667_0052013
1331 Ga0495656_0334205
1332 Ga0495634_0018558
1333 Ga0495635_0021037
1334 Ga0495635_0035669
1335 Ga0495635_0085658
1336 Ga0495659_0030003
1337 Ga0495588_0021195
1338 Ga0495588_0088231
1339 Ga0495657_0104954
1340 Ga0495657_0257596
1341 Ga0495646_0016017
1342 Ga0495647_0000284
1343 Ga0495647_0016468
1344 Ga0495647_0058033
1345 Ga0495658_0014682
1346 Ga0495658_0043600
1347 Ga0495613_0008842
1348 Ga0495624_0088892
1349 Ga0495670_0275548
1350 Ga0495670_0288707
1351 Ga0495589_0055300
1352 Ga0495581_0006215
1353 Ga0495581_0032602
1354 Ga0495604_0149207
1355 Ga0495636_0134365
1356 Ga0495674_0030088
1357 Ga0495674_0104988
1358 Ga0495676_0005328
1359 Ga0495676_0030870
1360 Ga0495680_0001115
1361 Ga0495680_0019071
1362 Ga0495680_0065106
1363 Ga0495680_0123006
1364 Ga0495675_0183325
1365 Ga0495684_0016876
1366 Ga0495684_0035641
1367 Ga0495684_0274417
1368 Ga0495684_0428599
1369 Ga0495593_0003235
1370 Ga0495614_0000837
1371 Ga0495614_0313816
1372 Ga0496100_0002332
1373 Ga0496100_0042161
1374 Ga0496100_0135610
1375 Ga0496100_0208502
1376 Ga0496101_0158745
1377 Ga0496101_0185604
1378 Ga0496101_0185768
1379 Ga0496101_0192551
1380 Ga0496101_0200591
1381 Ga0496101_0214356
1382 Ga0496101_0550194
1383 Ga0496102_0002937
1384 Ga0496102_0205535
1385 Ga0496102_0574057
1386 Ga0496103_0012327
1387 Ga0496103_0015535
1388 Ga0496103_0018880
1389 Ga0496103_0057767
1390 Ga0496103_0072742
1391 Ga0496104_0000188
1392 Ga0496104_0003064
1393 Ga0496104_0015209
1394 Ga0496104_0368181
1395 Ga0496105_0027980
1396 Ga0496105_0050307
1397 Ga0496105_0152010
1398 Ga0496105_0174957
1399 Ga0496105_0451590
1400 Ga0496105_0883262
1401 Ga0496106_0003891
1402 Ga0496106_0245931
1403 Ga0496106_0257026
1404 Ga0496106_0328995
1405 Ga0496106_0718634
1406 Ga0496107_0001297
1407 Ga0496107_0040799
1408 Ga0496107_0047451
1409 Ga0496107_0101910
1410 Ga0496107_0290603
1411 Ga0496108_0000668
1412 Ga0496108_0050288
1413 Ga0496108_0050566
1414 Ga0496108_0070328
1415 Ga0496108_0089411
1416 Ga0496108_0146110
1417 Ga0496109_0002742
1418 Ga0496109_0003319
1419 Ga0496109_0024106
1420 Ga0496109_0203693
1421 Ga0496109_0263985
1422 Ga0496109_0455693
1423 Ga0496110_0003760
1424 Ga0496110_0039359
1425 Ga0496110_0095245
1426 Ga0496110_0185943
1427 Ga0496111_0000433
1428 Ga0496111_0001044
1429 Ga0496111_0007288
1430 Ga0496111_0007396
1431 Ga0496111_0066973
1432 Ga0496111_0108461
1433 Ga0496111_0290106
1434 Ga0496112_0001632
1435 Ga0496112_0006143
1436 Ga0496112_0015478
1437 Ga0496112_0037845
1438 Ga0496112_0064607
1439 Ga0496112_0065951
1440 Ga0496112_0115365
1441 Ga0496112_0144076
1442 Ga0496112_0170666
1443 Ga0496112_0399804
1444 Ga0496112_0505389
1445 Ga0496112_0644814
1446 Ga0496113_0010963
1447 Ga0496113_0018593
1448 Ga0496113_0041554
1449 Ga0496113_0051534
1450 Ga0496113_0074867
1451 Ga0496113_0082978
1452 Ga0496113_0437971
1453 Ga0496114_0003843
1454 Ga0496114_0020582
1455 Ga0496114_0053762
1456 Ga0496114_0206122
1457 Ga0496114_0208732
1458 Ga0496114_0858499
1459 Ga0496115_0025999
1460 Ga0496115_0045540
1461 Ga0496115_0051449
1462 Ga0496115_0064848
1463 Ga0496115_0096971
1464 Ga0496115_0138643
1465 Ga0496115_0301572
1466 Ga0501043_0344105
1467 Ga0501047_0393640
1468 Ga0501067_0007704
1469 Ga0501067_0074612
1470 Ga0501067_0078971
1471 Ga0501067_0324404
1472 Ga0501069_0055918
1473 Ga0501069_0119834
1474 Ga0501070_0165542
1475 Ga0501072_0017987
1476 Ga0501073_0040303
1477 Ga0501074_0025001
1478 Ga0501074_0084297
1479 Ga0501079_0062921
1480 Ga0501080_0001559
1481 Ga0501080_0071927
1482 Ga0501083_0009330
1483 nmdc:mga03n38_32490_c1
1484 nmdc:mga05p37_211601_c1
1485 nmdc:mga05p37_5008_c1
1486 nmdc:mga05p37_67750_c1
1487 nmdc:mga06r32_585744_c1
1488 nmdc:mga06r32_85397_c1
1489 nmdc:mga0n895_424331_c1
1490 nmdc:mga0n895_49725_c1
1491 nmdc:mga0rr50_37176_c1
1492 nmdc:mga08x19_100733_c1
1493 nmdc:mga08x19_212790_c1
1494 nmdc:mga08x19_220620_c1
1495 Ga0495601_0066496
1496 Ga0495601_0108812
1497 Ga0495612_0019686
1498 Ga0495655_0025617
1499 Ga0495595_0035258
1500 Ga0495595_0056991
1501 Ga0495619_0002423
1502 Ga0495619_0041217
1503 Ga0495619_0048439
1504 Ga0495619_0228455
1505 Ga0500566_0084772
1506 Ga0501084_0303070
1507 Ga0587077_077916
1508 Ga0587080_042803
1509 Ga0587122_017656
1510 Ga0587128_034371
1511 Ga0466962_0000333
1512 Ga0466962_0005158
1513 Ga0466962_0007319
1514 Ga0466962_0014870
1515 Ga0466962_0061091
1516 Ga0530510_0087899

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

4

193

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.9036 23 195
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.9036 23 195
1occ-assembly1.cif.gz_C structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.9036 23 195
1occ-assembly1.cif.gz_P structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.9036 23 195
7dgq-assembly1.cif.gz_A9 activity optimized supercomplex state1 0.9036 23 195
ID Description Score Start End Superfamily
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8936 24 195 1.20.120.80
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8881 23 196 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8862 20 197 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8841 18 197 1.20.120.80
af_P24891_68_255_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8831 23 195 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A838IAJ7-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.9658 55 197 GO:0004129
GO:0005886
GO:0019646
AF-A0A838IAJ7-F1-model_v4 cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.9592 55 197 GO:0004129
GO:0005886
GO:0019646
AF-G3CJQ1-F1-model_v4 Cytochrome c oxidase subunit 3 0.9588 77 195 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A087FW95-F1-model_v4 Cytochrome c oxidase subunit 3 0.9574 74 195 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A068ACJ6-F1-model_v4 Cytochrome c oxidase subunit 3 0.954 70 187 GO:0004129
GO:0005739
GO:0006123
GO:0016020

Map