F479438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 758 | 325 | 1516 | 200 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10143309|Ga0075365_101433092 |
| Length | 193 |
| Sequence | MAAHAEAAHHGPPVAHQSSRVSASVLGMLLFIASEIMLFGAFFTAYFFVRVVNGIEWPTPPFELPVFVAGVNTAILVTSSFTMHWALTSIKRGSRAGLLTFLMGLVFLLTQAREYSRVGFAPHDGAFGTIFYTLTGLHGAHVFVGLSILLFMTVRAFRGHFSPEHHHGVEIGGIYWHFVDVMWIVVYSTVYLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 173 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 174 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 175 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 179 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 205 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 210 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 213 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 214 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 215 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 1.72 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.4 |
| Nodule | 0 |
| Rhizoplane | 13.06 |
| Rhizosphere | 85.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10143309 | 3300006038 | Unclassified | 1659 |
| 2 | JGI24742J22300_10036924 | 3300002244 | Bacteria | 864 |
| 3 | Ga0058862_12696819 | 3300004803 | Bacteria | 698 |
| 4 | Ga0070658_10001923 | 3300005327 | Bacteria | 17483 |
| 5 | Ga0070658_10009312 | 3300005327 | Bacteria | 7897 |
| 6 | Ga0070658_10095904 | 3300005327 | Bacteria | 2449 |
| 7 | Ga0070683_100003875 | 3300005329 | Bacteria | 12235 |
| 8 | Ga0070683_100029564 | 3300005329 | Bacteria | 4963 |
| 9 | Ga0070683_100179276 | 3300005329 | Bacteria | 2011 |
| 10 | Ga0070683_100434320 | 3300005329 | Bacteria | 1253 |
| 11 | Ga0070666_10128140 | 3300005335 | Bacteria | 1762 |
| 12 | Ga0070680_100024898 | 3300005336 | Bacteria | 4783 |
| 13 | Ga0070680_100025696 | 3300005336 | Bacteria | 4707 |
| 14 | Ga0070680_100042832 | 3300005336 | Bacteria | 3675 |
| 15 | Ga0070680_100054278 | 3300005336 | Bacteria | 3272 |
| 16 | Ga0070680_100240828 | 3300005336 | Bacteria | 1529 |
| 17 | Ga0070682_100012139 | 3300005337 | Bacteria | 4931 |
| 18 | Ga0070682_100266621 | 3300005337 | Bacteria | 1242 |
| 19 | Ga0070682_100693106 | 3300005337 | Bacteria | 816 |
| 20 | Ga0070660_100014142 | 3300005339 | Bacteria | 5745 |
| 21 | Ga0070660_100018143 | 3300005339 | Bacteria | 5136 |
| 22 | Ga0070660_100018912 | 3300005339 | Bacteria | 5043 |
| 23 | Ga0070660_100188861 | 3300005339 | Bacteria | 1668 |
| 24 | Ga0070660_100533982 | 3300005339 | Bacteria | 978 |
| 25 | Ga0070689_100012172 | 3300005340 | Bacteria | 6188 |
| 26 | Ga0070691_10341651 | 3300005341 | Bacteria | 829 |
| 27 | Ga0070687_100321358 | 3300005343 | Bacteria | 989 |
| 28 | Ga0070661_100098331 | 3300005344 | Bacteria | 2174 |
| 29 | Ga0070661_100101685 | 3300005344 | Bacteria | 2138 |
| 30 | Ga0070661_100386906 | 3300005344 | Bacteria | 1104 |
| 31 | Ga0070692_10247447 | 3300005345 | Bacteria | 1065 |
| 32 | Ga0070668_100115670 | 3300005347 | Bacteria | 2138 |
| 33 | Ga0070669_100347629 | 3300005353 | Bacteria | 1203 |
| 34 | Ga0070675_100020633 | 3300005354 | Bacteria | 5258 |
| 35 | Ga0070671_100186416 | 3300005355 | Bacteria | 1758 |
| 36 | Ga0070671_100379438 | 3300005355 | Bacteria | 1208 |
| 37 | Ga0070674_100005639 | 3300005356 | Bacteria | 7253 |
| 38 | Ga0070673_100133517 | 3300005364 | Bacteria | 2086 |
| 39 | Ga0070688_100016002 | 3300005365 | Bacteria | 4279 |
| 40 | Ga0070659_100120632 | 3300005366 | Bacteria | 2123 |
| 41 | Ga0070659_100130918 | 3300005366 | Bacteria | 2037 |
| 42 | Ga0070703_10033052 | 3300005406 | Unclassified | 1573 |
| 43 | Ga0070709_10082455 | 3300005434 | Bacteria | 2101 |
| 44 | Ga0070709_10293298 | 3300005434 | Bacteria | 1186 |
| 45 | Ga0070714_100002694 | 3300005435 | Bacteria | 13092 |
| 46 | Ga0070714_100026064 | 3300005435 | Bacteria | 4829 |
| 47 | Ga0070714_100053814 | 3300005435 | Bacteria | 3437 |
| 48 | Ga0070714_100079429 | 3300005435 | Bacteria | 2853 |
| 49 | Ga0070714_100088596 | 3300005435 | Bacteria | 2708 |
| 50 | Ga0070714_100373742 | 3300005435 | Bacteria | 1342 |
| 51 | Ga0070714_100426407 | 3300005435 | Bacteria | 1257 |
| 52 | Ga0070714_100769014 | 3300005435 | Bacteria | 932 |
| 53 | Ga0070714_101370142 | 3300005435 | Unclassified | 691 |
| 54 | Ga0070713_100092077 | 3300005436 | Bacteria | 2609 |
| 55 | Ga0070713_100121751 | 3300005436 | Bacteria | 2289 |
| 56 | Ga0070713_100253079 | 3300005436 | Bacteria | 1607 |
| 57 | Ga0070713_100298897 | 3300005436 | Bacteria | 1482 |
| 58 | Ga0070710_10003097 | 3300005437 | Bacteria | 7894 |
| 59 | Ga0070710_10017692 | 3300005437 | Bacteria | 3653 |
| 60 | Ga0070701_10011918 | 3300005438 | Bacteria | 3904 |
| 61 | Ga0070711_100018012 | 3300005439 | Bacteria | 4503 |
| 62 | Ga0070711_100174381 | 3300005439 | Bacteria | 1641 |
| 63 | Ga0070705_100037737 | 3300005440 | Bacteria | 2728 |
| 64 | Ga0070705_100040298 | 3300005440 | Bacteria | 2655 |
| 65 | Ga0070694_100530083 | 3300005444 | Bacteria | 941 |
| 66 | Ga0070708_100082016 | 3300005445 | Unclassified | 2921 |
| 67 | Ga0070708_100213456 | 3300005445 | Bacteria | 1809 |
| 68 | Ga0070708_100421996 | 3300005445 | Bacteria | 1258 |
| 69 | Ga0070708_100642661 | 3300005445 | Bacteria | 1000 |
| 70 | Ga0070678_100026628 | 3300005456 | Bacteria | 3913 |
| 71 | Ga0070681_10112465 | 3300005458 | Bacteria | 2662 |
| 72 | Ga0070681_10216014 | 3300005458 | Bacteria | 1833 |
| 73 | Ga0068867_100006828 | 3300005459 | Bacteria | 8070 |
| 74 | Ga0068867_100707062 | 3300005459 | Bacteria | 890 |
| 75 | Ga0070706_100001401 | 3300005467 | Bacteria | 25477 |
| 76 | Ga0070706_100027202 | 3300005467 | Bacteria | 5263 |
| 77 | Ga0070706_100365752 | 3300005467 | Bacteria | 1344 |
| 78 | Ga0070707_100006137 | 3300005468 | Bacteria | 11197 |
| 79 | Ga0070707_100113886 | 3300005468 | Bacteria | 2624 |
| 80 | Ga0070707_100168307 | 3300005468 | Bacteria | 2135 |
| 81 | Ga0070707_100192445 | 3300005468 | Bacteria | 1989 |
| 82 | Ga0070707_100277119 | 3300005468 | Bacteria | 1630 |
| 83 | Ga0070707_100622783 | 3300005468 | Bacteria | 1042 |
| 84 | Ga0070707_100975493 | 3300005468 | Unclassified | 813 |
| 85 | Ga0070698_100017579 | 3300005471 | Bacteria | 7537 |
| 86 | Ga0070698_100052946 | 3300005471 | Bacteria | 4126 |
| 87 | Ga0070698_100095006 | 3300005471 | Bacteria | 2959 |
| 88 | Ga0070698_100104128 | 3300005471 | Bacteria | 2808 |
| 89 | Ga0070698_100182083 | 3300005471 | Bacteria | 2039 |
| 90 | Ga0070698_100229687 | 3300005471 | Bacteria | 1789 |
| 91 | Ga0070698_100451864 | 3300005471 | Bacteria | 1221 |
| 92 | Ga0070698_100532516 | 3300005471 | Unclassified | 1113 |
| 93 | Ga0070699_100104381 | 3300005518 | Bacteria | 2486 |
| 94 | Ga0070699_100169661 | 3300005518 | Bacteria | 1933 |
| 95 | Ga0070679_100150570 | 3300005530 | Bacteria | 2303 |
| 96 | Ga0070679_100215791 | 3300005530 | Bacteria | 1881 |
| 97 | Ga0070679_100242752 | 3300005530 | Unclassified | 1758 |
| 98 | Ga0070679_100810250 | 3300005530 | Bacteria | 879 |
| 99 | Ga0070684_100013215 | 3300005535 | Bacteria | 6648 |
| 100 | Ga0070684_100164585 | 3300005535 | Bacteria | 2013 |
| 101 | Ga0070684_100184024 | 3300005535 | Bacteria | 1900 |
| 102 | Ga0070684_100374003 | 3300005535 | Bacteria | 1312 |
| 103 | Ga0070697_100164103 | 3300005536 | Bacteria | 1878 |
| 104 | Ga0070697_100679517 | 3300005536 | Bacteria | 908 |
| 105 | Ga0068853_100015612 | 3300005539 | Bacteria | 6238 |
| 106 | Ga0070686_100004382 | 3300005544 | Bacteria | 7782 |
| 107 | Ga0070695_100000231 | 3300005545 | Bacteria | 27675 |
| 108 | Ga0070695_100134934 | 3300005545 | Bacteria | 1705 |
| 109 | Ga0070696_100027249 | 3300005546 | Bacteria | 3892 |
| 110 | Ga0070696_100456771 | 3300005546 | Bacteria | 1009 |
| 111 | Ga0070665_100041443 | 3300005548 | Bacteria | 4628 |
| 112 | Ga0070704_100106063 | 3300005549 | Bacteria | 2129 |
| 113 | Ga0070704_100396386 | 3300005549 | Bacteria | 1177 |
| 114 | Ga0068855_100146496 | 3300005563 | Bacteria | 2688 |
| 115 | Ga0068855_100208575 | 3300005563 | Bacteria | 2197 |
| 116 | Ga0068855_100870205 | 3300005563 | Bacteria | 954 |
| 117 | Ga0068857_100322506 | 3300005577 | Bacteria | 1427 |
| 118 | Ga0068854_100377789 | 3300005578 | Bacteria | 1167 |
| 119 | Ga0068856_100014707 | 3300005614 | Bacteria | 7553 |
| 120 | Ga0068856_100261502 | 3300005614 | Bacteria | 1746 |
| 121 | Ga0068856_100558113 | 3300005614 | Bacteria | 1166 |
| 122 | Ga0070702_100072626 | 3300005615 | Bacteria | 2036 |
| 123 | Ga0068852_100038086 | 3300005616 | Bacteria | 4038 |
| 124 | Ga0068852_100308027 | 3300005616 | Bacteria | 1535 |
| 125 | Ga0068852_100577094 | 3300005616 | Bacteria | 1127 |
| 126 | Ga0068866_10006032 | 3300005718 | Bacteria | 5042 |
| 127 | Ga0068866_10230547 | 3300005718 | Bacteria | 1123 |
| 128 | Ga0068861_100038498 | 3300005719 | Bacteria | 3562 |
| 129 | Ga0068861_100752330 | 3300005719 | Bacteria | 910 |
| 130 | Ga0068860_100896937 | 3300005843 | Bacteria | 902 |
| 131 | Ga0068862_100221613 | 3300005844 | Unclassified | 1713 |
| 132 | Ga0081539_10005968 | 3300005985 | Bacteria | 12002 |
| 133 | Ga0081539_10300689 | 3300005985 | Bacteria | 690 |
| 134 | Ga0070717_10018317 | 3300006028 | Bacteria | 5463 |
| 135 | Ga0070717_10139346 | 3300006028 | Bacteria | 2091 |
| 136 | Ga0070717_10287812 | 3300006028 | Bacteria | 1458 |
| 137 | Ga0070717_11094532 | 3300006028 | Bacteria | 726 |
| 138 | Ga0070715_10010063 | 3300006163 | Bacteria | 3358 |
| 139 | Ga0070716_100015237 | 3300006173 | Bacteria | 3946 |
| 140 | Ga0070716_100073723 | 3300006173 | Bacteria | 2014 |
| 141 | Ga0070716_100109187 | 3300006173 | Bacteria | 1711 |
| 142 | Ga0070712_100004431 | 3300006175 | Bacteria | 8665 |
| 143 | Ga0070712_100032500 | 3300006175 | Bacteria | 3525 |
| 144 | Ga0070712_100072705 | 3300006175 | Bacteria | 2464 |
| 145 | Ga0070712_100289136 | 3300006175 | Bacteria | 1323 |
| 146 | Ga0070712_100329624 | 3300006175 | Bacteria | 1243 |
| 147 | Ga0097621_100005052 | 3300006237 | Bacteria | 9267 |
| 148 | Ga0068871_100245974 | 3300006358 | Bacteria | 1556 |
| 149 | Ga0075434_100036046 | 3300006871 | Bacteria | 4891 |
| 150 | Ga0075429_101004048 | 3300006880 | Bacteria | 729 |
| 151 | Ga0068865_100001717 | 3300006881 | Bacteria | 12852 |
| 152 | Ga0075436_100328533 | 3300006914 | Bacteria | 1099 |
| 153 | Ga0075436_100452488 | 3300006914 | Unclassified | 935 |
| 154 | Ga0075435_100084580 | 3300007076 | Bacteria | 2611 |
| 155 | Ga0099795_10274692 | 3300007788 | Bacteria | 734 |
| 156 | Ga0105240_10019802 | 3300009093 | Bacteria | 8987 |
| 157 | Ga0105240_10029533 | 3300009093 | Bacteria | 7141 |
| 158 | Ga0105240_10917342 | 3300009093 | Bacteria | 941 |
| 159 | Ga0105245_10061036 | 3300009098 | Bacteria | 3397 |
| 160 | Ga0114129_10018315 | 3300009147 | Bacteria | 9976 |
| 161 | Ga0114129_10740169 | 3300009147 | Bacteria | 1260 |
| 162 | Ga0105243_10237005 | 3300009148 | Bacteria | 1622 |
| 163 | Ga0105241_10324730 | 3300009174 | Bacteria | 1328 |
| 164 | Ga0105248_10052205 | 3300009177 | Bacteria | 4588 |
| 165 | Ga0105237_10064534 | 3300009545 | Bacteria | 3658 |
| 166 | Ga0105237_10166645 | 3300009545 | Bacteria | 2202 |
| 167 | Ga0105237_10283278 | 3300009545 | Bacteria | 1660 |
| 168 | Ga0105237_10784657 | 3300009545 | Bacteria | 959 |
| 169 | Ga0105238_10047776 | 3300009551 | Bacteria | 4314 |
| 170 | Ga0105238_10840990 | 3300009551 | Bacteria | 935 |
| 171 | Ga0105249_10003715 | 3300009553 | Bacteria | 13162 |
| 172 | Ga0105239_10034604 | 3300010375 | Bacteria | 5548 |
| 173 | Ga0105239_10907455 | 3300010375 | Bacteria | 1011 |
| 174 | Ga0157373_10125051 | 3300013100 | Bacteria | 1808 |
| 175 | Ga0157373_10228250 | 3300013100 | Bacteria | 1314 |
| 176 | Ga0157373_10694818 | 3300013100 | Bacteria | 745 |
| 177 | Ga0157371_10165728 | 3300013102 | Bacteria | 1578 |
| 178 | Ga0157370_10011840 | 3300013104 | Bacteria | 9099 |
| 179 | Ga0157370_10019665 | 3300013104 | Bacteria | 6763 |
| 180 | Ga0157370_10618200 | 3300013104 | Bacteria | 991 |
| 181 | Ga0157369_10024176 | 3300013105 | Bacteria | 6762 |
| 182 | Ga0157369_10024611 | 3300013105 | Bacteria | 6694 |
| 183 | Ga0157369_10047050 | 3300013105 | Bacteria | 4686 |
| 184 | Ga0157369_10174803 | 3300013105 | Bacteria | 2261 |
| 185 | Ga0157369_10231407 | 3300013105 | Bacteria | 1932 |
| 186 | Ga0157369_10246375 | 3300013105 | Bacteria | 1866 |
| 187 | Ga0157369_10912525 | 3300013105 | Bacteria | 901 |
| 188 | Ga0157369_11083658 | 3300013105 | Bacteria | 819 |
| 189 | Ga0163162_10194925 | 3300013306 | Bacteria | 2154 |
| 190 | Ga0157372_10115289 | 3300013307 | Bacteria | 3080 |
| 191 | Ga0157372_11234272 | 3300013307 | Bacteria | 863 |
| 192 | Ga0157375_10423229 | 3300013308 | Bacteria | 1498 |
| 193 | Ga0163163_10198505 | 3300014325 | Bacteria | 2054 |
| 194 | Ga0182008_10051097 | 3300014497 | Bacteria | 2051 |
| 195 | Ga0157376_10011995 | 3300014969 | Bacteria | 6412 |
| 196 | Ga0182006_1019266 | 3300015261 | Bacteria | 2873 |
| 197 | Ga0197907_11164713 | 3300020069 | Bacteria | 3466 |
| 198 | Ga0206356_10660088 | 3300020070 | Bacteria | 2942 |
| 199 | Ga0206349_1260290 | 3300020075 | Bacteria | 1619 |
| 200 | Ga0206352_10452862 | 3300020078 | Bacteria | 962 |
| 201 | Ga0206350_11368982 | 3300020080 | Bacteria | 1434 |
| 202 | Ga0206354_10459876 | 3300020081 | Bacteria | 1365 |
| 203 | Ga0224712_10015343 | 3300022467 | Bacteria | 2491 |
| 204 | Ga0224712_10047466 | 3300022467 | Bacteria | 1653 |
| 205 | Ga0207656_10443165 | 3300025321 | Bacteria | 656 |
| 206 | Ga0207692_10088678 | 3300025898 | Bacteria | 1672 |
| 207 | Ga0207692_10363578 | 3300025898 | Bacteria | 895 |
| 208 | Ga0207642_10018124 | 3300025899 | Bacteria | 2695 |
| 209 | Ga0207710_10154886 | 3300025900 | Bacteria | 1113 |
| 210 | Ga0207688_10021149 | 3300025901 | Bacteria | 3553 |
| 211 | Ga0207680_10021008 | 3300025903 | Bacteria | 3526 |
| 212 | Ga0207685_10004620 | 3300025905 | Bacteria | 3530 |
| 213 | Ga0207699_10019352 | 3300025906 | Bacteria | 3628 |
| 214 | Ga0207699_10239027 | 3300025906 | Bacteria | 1247 |
| 215 | Ga0207705_10017839 | 3300025909 | Bacteria | 5075 |
| 216 | Ga0207705_10020415 | 3300025909 | Bacteria | 4734 |
| 217 | Ga0207705_10133328 | 3300025909 | Bacteria | 1850 |
| 218 | Ga0207705_10149880 | 3300025909 | Bacteria | 1747 |
| 219 | Ga0207684_10055395 | 3300025910 | Bacteria | 3364 |
| 220 | Ga0207684_10158073 | 3300025910 | Bacteria | 1951 |
| 221 | Ga0207654_10389029 | 3300025911 | Bacteria | 967 |
| 222 | Ga0207707_10008036 | 3300025912 | Bacteria | 9163 |
| 223 | Ga0207707_10228226 | 3300025912 | Bacteria | 1620 |
| 224 | Ga0207707_10758944 | 3300025912 | Bacteria | 811 |
| 225 | Ga0207695_10231931 | 3300025913 | Bacteria | 1750 |
| 226 | Ga0207671_10705680 | 3300025914 | Bacteria | 802 |
| 227 | Ga0207693_10005025 | 3300025915 | Bacteria | 11103 |
| 228 | Ga0207693_10011729 | 3300025915 | Bacteria | 7087 |
| 229 | Ga0207693_10029818 | 3300025915 | Bacteria | 4306 |
| 230 | Ga0207693_10064467 | 3300025915 | Bacteria | 2870 |
| 231 | Ga0207693_10065011 | 3300025915 | Bacteria | 2857 |
| 232 | Ga0207693_10083222 | 3300025915 | Bacteria | 2506 |
| 233 | Ga0207663_10046061 | 3300025916 | Bacteria | 2685 |
| 234 | Ga0207660_10047622 | 3300025917 | Bacteria | 3032 |
| 235 | Ga0207660_10063661 | 3300025917 | Bacteria | 2660 |
| 236 | Ga0207660_10104481 | 3300025917 | Bacteria | 2121 |
| 237 | Ga0207660_10276212 | 3300025917 | Bacteria | 1332 |
| 238 | Ga0207660_10359939 | 3300025917 | Bacteria | 1167 |
| 239 | Ga0207662_10048967 | 3300025918 | Bacteria | 2506 |
| 240 | Ga0207657_10009553 | 3300025919 | Bacteria | 9734 |
| 241 | Ga0207657_10011660 | 3300025919 | Bacteria | 8713 |
| 242 | Ga0207657_10017180 | 3300025919 | Bacteria | 6950 |
| 243 | Ga0207657_10017602 | 3300025919 | Bacteria | 6846 |
| 244 | Ga0207657_10052448 | 3300025919 | Bacteria | 3539 |
| 245 | Ga0207657_10183201 | 3300025919 | Bacteria | 1692 |
| 246 | Ga0207649_10157319 | 3300025920 | Bacteria | 1571 |
| 247 | Ga0207652_10131820 | 3300025921 | Bacteria | 2229 |
| 248 | Ga0207652_10141314 | 3300025921 | Bacteria | 2153 |
| 249 | Ga0207652_10183923 | 3300025921 | Bacteria | 1879 |
| 250 | Ga0207652_10294272 | 3300025921 | Bacteria | 1465 |
| 251 | Ga0207646_10004153 | 3300025922 | Bacteria | 15887 |
| 252 | Ga0207646_10010342 | 3300025922 | Bacteria | 9126 |
| 253 | Ga0207646_10029650 | 3300025922 | Bacteria | 4969 |
| 254 | Ga0207646_10058728 | 3300025922 | Bacteria | 3436 |
| 255 | Ga0207646_10141736 | 3300025922 | Bacteria | 2165 |
| 256 | Ga0207646_10522294 | 3300025922 | Bacteria | 1069 |
| 257 | Ga0207646_10615033 | 3300025922 | Bacteria | 975 |
| 258 | Ga0207694_10090186 | 3300025924 | Bacteria | 2418 |
| 259 | Ga0207694_10427900 | 3300025924 | Bacteria | 1103 |
| 260 | Ga0207694_10781466 | 3300025924 | Bacteria | 806 |
| 261 | Ga0207687_10137205 | 3300025927 | Bacteria | 1851 |
| 262 | Ga0207700_10115533 | 3300025928 | Bacteria | 2167 |
| 263 | Ga0207700_10335360 | 3300025928 | Bacteria | 1313 |
| 264 | Ga0207664_10067406 | 3300025929 | Bacteria | 2872 |
| 265 | Ga0207664_10076139 | 3300025929 | Bacteria | 2715 |
| 266 | Ga0207664_10090443 | 3300025929 | Bacteria | 2508 |
| 267 | Ga0207664_10138080 | 3300025929 | Bacteria | 2059 |
| 268 | Ga0207664_10287249 | 3300025929 | Bacteria | 1445 |
| 269 | Ga0207664_10295451 | 3300025929 | Bacteria | 1424 |
| 270 | Ga0207664_10637324 | 3300025929 | Bacteria | 958 |
| 271 | Ga0207664_10789333 | 3300025929 | Bacteria | 854 |
| 272 | Ga0207644_10413328 | 3300025931 | Bacteria | 1104 |
| 273 | Ga0207644_10855923 | 3300025931 | Bacteria | 761 |
| 274 | Ga0207690_10286506 | 3300025932 | Bacteria | 1284 |
| 275 | Ga0207706_10082059 | 3300025933 | Unclassified | 2833 |
| 276 | Ga0207686_10980104 | 3300025934 | Bacteria | 685 |
| 277 | Ga0207709_10001561 | 3300025935 | Bacteria | 15707 |
| 278 | Ga0207709_10063893 | 3300025935 | Bacteria | 2309 |
| 279 | Ga0207670_10005360 | 3300025936 | Bacteria | 7034 |
| 280 | Ga0207704_10009209 | 3300025938 | Bacteria | 4753 |
| 281 | Ga0207665_10009523 | 3300025939 | Bacteria | 6379 |
| 282 | Ga0207665_10023818 | 3300025939 | Bacteria | 4032 |
| 283 | Ga0207665_10257846 | 3300025939 | Bacteria | 1291 |
| 284 | Ga0207691_10010135 | 3300025940 | Bacteria | 9046 |
| 285 | Ga0207691_10104108 | 3300025940 | Bacteria | 2530 |
| 286 | Ga0207711_10097885 | 3300025941 | Bacteria | 2591 |
| 287 | Ga0207689_10113478 | 3300025942 | Bacteria | 2227 |
| 288 | Ga0207689_10318000 | 3300025942 | Unclassified | 1291 |
| 289 | Ga0207661_10044940 | 3300025944 | Bacteria | 3493 |
| 290 | Ga0207661_10087757 | 3300025944 | Bacteria | 2584 |
| 291 | Ga0207661_10187130 | 3300025944 | Bacteria | 1813 |
| 292 | Ga0207661_10248030 | 3300025944 | Bacteria | 1582 |
| 293 | Ga0207667_10017450 | 3300025949 | Bacteria | 8076 |
| 294 | Ga0207667_10447586 | 3300025949 | Bacteria | 1313 |
| 295 | Ga0207651_10131115 | 3300025960 | Bacteria | 1919 |
| 296 | Ga0207668_10020001 | 3300025972 | Bacteria | 4246 |
| 297 | Ga0207703_10454760 | 3300026035 | Bacteria | 1196 |
| 298 | Ga0207639_10015422 | 3300026041 | Bacteria | 5392 |
| 299 | Ga0207702_10628261 | 3300026078 | Bacteria | 1055 |
| 300 | Ga0207648_10003432 | 3300026089 | Bacteria | 16631 |
| 301 | Ga0207675_100012469 | 3300026118 | Bacteria | 7940 |
| 302 | Ga0207675_100061283 | 3300026118 | Bacteria | 3512 |
| 303 | Ga0207683_10000262 | 3300026121 | Bacteria | 47039 |
| 304 | Ga0207698_10493449 | 3300026142 | Bacteria | 1190 |
| 305 | Ga0268265_10548852 | 3300028380 | Bacteria | 1097 |
| 306 | Ga0268264_10219178 | 3300028381 | Bacteria | 1751 |
| 307 | Ga0265319_1001400 | 3300028563 | Bacteria | 14462 |
| 308 | Ga0265319_1001726 | 3300028563 | Bacteria | 12581 |
| 309 | Ga0265319_1015462 | 3300028563 | Bacteria | 2959 |
| 310 | Ga0265334_10000531 | 3300028573 | Bacteria | 19440 |
| 311 | Ga0265334_10047221 | 3300028573 | Bacteria | 1662 |
| 312 | Ga0265318_10000197 | 3300028577 | Bacteria | 52920 |
| 313 | Ga0265318_10001153 | 3300028577 | Bacteria | 16417 |
| 314 | Ga0265318_10026984 | 3300028577 | Bacteria | 2260 |
| 315 | Ga0265322_10011001 | 3300028654 | Bacteria | 2624 |
| 316 | Ga0265322_10081164 | 3300028654 | Bacteria | 920 |
| 317 | Ga0265336_10010191 | 3300028666 | Bacteria | 3221 |
| 318 | Ga0265336_10015563 | 3300028666 | Bacteria | 2498 |
| 319 | Ga0265336_10039696 | 3300028666 | Bacteria | 1442 |
| 320 | Ga0265336_10075535 | 3300028666 | Bacteria | 1007 |
| 321 | Ga0265336_10129762 | 3300028666 | Bacteria | 750 |
| 322 | Ga0265338_10001136 | 3300028800 | Bacteria | 44077 |
| 323 | Ga0265338_10005668 | 3300028800 | Bacteria | 16194 |
| 324 | Ga0265338_10013542 | 3300028800 | Bacteria | 9194 |
| 325 | Ga0265338_10098155 | 3300028800 | Bacteria | 2397 |
| 326 | Ga0265338_10236190 | 3300028800 | Bacteria | 1356 |
| 327 | Ga0265338_10293118 | 3300028800 | Bacteria | 1185 |
| 328 | Ga0265324_10091769 | 3300029957 | Bacteria | 1033 |
| 329 | Ga0265330_10000626 | 3300031235 | Bacteria | 22841 |
| 330 | Ga0265330_10014950 | 3300031235 | Bacteria | 3595 |
| 331 | Ga0265332_10017312 | 3300031238 | Bacteria | 3181 |
| 332 | Ga0265328_10007120 | 3300031239 | Bacteria | 4686 |
| 333 | Ga0265325_10002011 | 3300031241 | Bacteria | 13964 |
| 334 | Ga0265325_10053981 | 3300031241 | Bacteria | 2059 |
| 335 | Ga0265329_10001354 | 3300031242 | Bacteria | 11887 |
| 336 | Ga0265340_10007159 | 3300031247 | Bacteria | 6076 |
| 337 | Ga0265340_10037920 | 3300031247 | Bacteria | 2386 |
| 338 | Ga0265339_10003320 | 3300031249 | Bacteria | 11270 |
| 339 | Ga0265339_10007751 | 3300031249 | Bacteria | 6902 |
| 340 | Ga0265331_10000942 | 3300031250 | Bacteria | 23214 |
| 341 | Ga0265331_10025154 | 3300031250 | Bacteria | 3007 |
| 342 | Ga0265331_10086654 | 3300031250 | Bacteria | 1451 |
| 343 | Ga0265327_10002175 | 3300031251 | Bacteria | 21560 |
| 344 | Ga0265327_10020769 | 3300031251 | Bacteria | 3988 |
| 345 | Ga0265327_10028630 | 3300031251 | Bacteria | 3182 |
| 346 | Ga0265327_10039170 | 3300031251 | Bacteria | 2577 |
| 347 | Ga0265316_10006881 | 3300031344 | Bacteria | 10789 |
| 348 | Ga0265316_10308802 | 3300031344 | Bacteria | 1151 |
| 349 | Ga0307408_100229703 | 3300031548 | Bacteria | 1519 |
| 350 | Ga0265313_10020753 | 3300031595 | Bacteria | 3615 |
| 351 | Ga0265313_10069995 | 3300031595 | Bacteria | 1618 |
| 352 | Ga0265313_10125470 | 3300031595 | Bacteria | 1116 |
| 353 | Ga0265314_10012157 | 3300031711 | Bacteria | 7049 |
| 354 | Ga0265314_10017534 | 3300031711 | Bacteria | 5617 |
| 355 | Ga0265342_10004117 | 3300031712 | Bacteria | 11588 |
| 356 | Ga0265342_10007045 | 3300031712 | Bacteria | 8289 |
| 357 | Ga0265342_10042406 | 3300031712 | Bacteria | 2749 |
| 358 | Ga0307416_100146948 | 3300032002 | Bacteria | 2154 |
| 359 | Ga0307415_100024667 | 3300032126 | Bacteria | 3760 |
| 360 | Ga0373948_0004226 | 3300034817 | Bacteria | 2257 |
| 361 | Ga0373958_0011107 | 3300034819 | Bacteria | 1515 |
| 362 | Ga0373959_0021327 | 3300034820 | Bacteria | 1243 |
| 363 | Ga0373926_0019053 | 3300035083 | Bacteria | 2365 |
| 364 | Ga0373928_0014516 | 3300035084 | Bacteria | 1594 |
| 365 | Ga0373929_0003618 | 3300035085 | Bacteria | 2776 |
| 366 | Ga0373949_0012980 | 3300035090 | Bacteria | 1846 |
| 367 | Ga0373951_0005542 | 3300035091 | Bacteria | 2928 |
| 368 | Ga0373952_0007264 | 3300035092 | Bacteria | 2071 |
| 369 | Ga0373932_0005667 | 3300035112 | Bacteria | 2937 |
| 370 | Ga0373939_0002231 | 3300035114 | Bacteria | 4590 |
| 371 | Ga0373945_0289164 | 3300035116 | Bacteria | 700 |
| 372 | Ga0373954_0249559 | 3300035118 | Bacteria | 874 |
| 373 | Ga0373956_0199299 | 3300035119 | Bacteria | 949 |
| 374 | Ga0373960_0005256 | 3300035121 | Bacteria | 2991 |
| 375 | Ga0373961_0037687 | 3300035241 | Bacteria | 1382 |
| 376 | Ga0373962_0012258 | 3300035242 | Bacteria | 2157 |
| 377 | Ga0373924_0131466 | 3300035410 | Bacteria | 1089 |
| 378 | Ga0373931_0007745 | 3300035691 | Bacteria | 5071 |
| 379 | Ga0373931_0496876 | 3300035691 | Bacteria | 786 |
| 380 | Ga0373927_0031585 | 3300035695 | Bacteria | 3451 |
| 381 | Ga0373933_0072794 | 3300035724 | Bacteria | 2093 |
| 382 | Ga0373947_0004274 | 3300035725 | Bacteria | 8385 |
| 383 | Ga0373947_0082048 | 3300035725 | Bacteria | 1998 |
| 384 | Ga0373937_0084688 | 3300036401 | Bacteria | 2933 |
| 385 | Ga0373925_0005302 | 3300037068 | Bacteria | 9625 |
| 386 | Ga0373925_0354680 | 3300037068 | Bacteria | 1191 |
| 387 | Ga0395899_0005387 | 3300037312 | Bacteria | 9940 |
| 388 | Ga0395899_0016691 | 3300037312 | Bacteria | 5598 |
| 389 | Ga0395899_0024326 | 3300037312 | Bacteria | 4579 |
| 390 | Ga0395899_0107372 | 3300037312 | Bacteria | 2009 |
| 391 | Ga0395899_0140139 | 3300037312 | Bacteria | 1721 |
| 392 | Ga0395899_0251332 | 3300037312 | Bacteria | 1213 |
| 393 | Ga0395900_0005706 | 3300037418 | Bacteria | 13012 |
| 394 | Ga0395900_0012562 | 3300037418 | Bacteria | 8665 |
| 395 | Ga0395900_0023819 | 3300037418 | Bacteria | 6264 |
| 396 | Ga0395900_0047537 | 3300037418 | Bacteria | 4418 |
| 397 | Ga0395900_0054326 | 3300037418 | Bacteria | 4124 |
| 398 | Ga0395900_0073002 | 3300037418 | Bacteria | 3527 |
| 399 | Ga0395900_0131871 | 3300037418 | Bacteria | 2560 |
| 400 | Ga0395900_0213670 | 3300037418 | Bacteria | 1947 |
| 401 | Ga0395900_0240632 | 3300037418 | Bacteria | 1816 |
| 402 | Ga0395900_0302161 | 3300037418 | Bacteria | 1586 |
| 403 | Ga0395900_0513986 | 3300037418 | Bacteria | 1146 |
| 404 | Ga0395898_0002053 | 3300037466 | Bacteria | 25121 |
| 405 | Ga0395898_0002193 | 3300037466 | Bacteria | 23839 |
| 406 | Ga0395898_0013859 | 3300037466 | Bacteria | 8285 |
| 407 | Ga0395898_0015806 | 3300037466 | Bacteria | 7735 |
| 408 | Ga0395898_0045267 | 3300037466 | Bacteria | 4326 |
| 409 | Ga0395898_0073780 | 3300037466 | Bacteria | 3296 |
| 410 | Ga0395898_0083930 | 3300037466 | Bacteria | 3070 |
| 411 | Ga0395898_0231248 | 3300037466 | Bacteria | 1763 |
| 412 | Ga0395898_0302807 | 3300037466 | Bacteria | 1525 |
| 413 | Ga0395898_0506861 | 3300037466 | Bacteria | 1148 |
| 414 | Ga0395898_0683473 | 3300037466 | Bacteria | 968 |
| 415 | Ga0395898_1003219 | 3300037466 | Bacteria | 771 |
| 416 | Ga0395905_0010295 | 3300037471 | Bacteria | 9104 |
| 417 | Ga0395905_0019755 | 3300037471 | Bacteria | 6387 |
| 418 | Ga0395905_0055519 | 3300037471 | Bacteria | 3706 |
| 419 | Ga0395905_0067615 | 3300037471 | Bacteria | 3347 |
| 420 | Ga0395905_0079329 | 3300037471 | Bacteria | 3077 |
| 421 | Ga0395905_0112488 | 3300037471 | Bacteria | 2557 |
| 422 | Ga0395905_0137223 | 3300037471 | Bacteria | 2301 |
| 423 | Ga0395905_0377801 | 3300037471 | Unclassified | 1310 |
| 424 | Ga0395905_0394254 | 3300037471 | Bacteria | 1279 |
| 425 | Ga0395905_0576827 | 3300037471 | Unclassified | 1026 |
| 426 | Ga0395905_0841048 | 3300037471 | Bacteria | 821 |
| 427 | Ga0395905_1110672 | 3300037471 | Bacteria | 694 |
| 428 | Ga0395901_0002380 | 3300038443 | Bacteria | 19130 |
| 429 | Ga0395901_0007531 | 3300038443 | Bacteria | 10995 |
| 430 | Ga0395901_0014202 | 3300038443 | Bacteria | 8107 |
| 431 | Ga0395901_0024354 | 3300038443 | Bacteria | 6211 |
| 432 | Ga0395901_0034604 | 3300038443 | Bacteria | 5217 |
| 433 | Ga0395901_0121799 | 3300038443 | Bacteria | 2741 |
| 434 | Ga0395901_0172582 | 3300038443 | Bacteria | 2268 |
| 435 | Ga0395901_0182190 | 3300038443 | Unclassified | 2203 |
| 436 | Ga0395901_0210537 | 3300038443 | Bacteria | 2035 |
| 437 | Ga0395901_0244598 | 3300038443 | Bacteria | 1870 |
| 438 | Ga0395901_0592013 | 3300038443 | Bacteria | 1119 |
| 439 | Ga0395901_0784483 | 3300038443 | Bacteria | 943 |
| 440 | Ga0242420_026687 | 3300038996 | Bacteria | 1055 |
| 441 | Ga0436360_0640321 | 3300039438 | Bacteria | 23023 |
| 442 | Ga0436360_1349107 | 3300039438 | Unclassified | 3217 |
| 443 | Ga0436363_0236899 | 3300039450 | Bacteria | 991 |
| 444 | Ga0451787_845750 | 3300041441 | Unclassified | 1043 |
| 445 | Ga0451793_1037934 | 3300041452 | Bacteria | 3714 |
| 446 | Ga0451798_0070554 | 3300041458 | Unclassified | 937 |
| 447 | Ga0451802_1348883 | 3300041460 | Bacteria | 689 |
| 448 | Ga0451802_1818341 | 3300041460 | Unclassified | 1287 |
| 449 | Ga0451835_0953254 | 3300041492 | Unclassified | 1740 |
| 450 | Ga0451839_0669733 | 3300041496 | Bacteria | 1591 |
| 451 | Ga0451841_0048648 | 3300041498 | Unclassified | 987 |
| 452 | Ga0451845_0185107 | 3300041501 | Bacteria | 2333 |
| 453 | Ga0451847_0728326 | 3300041503 | Unclassified | 1117 |
| 454 | Ga0451849_0784089 | 3300041505 | Unclassified | 1101 |
| 455 | Ga0451851_0387679 | 3300041507 | Bacteria | 2245 |
| 456 | Ga0439458_0093195 | 3300042157 | Bacteria | 777 |
| 457 | Ga0466969_0162874 | 3300044656 | Bacteria | 1025 |
| 458 | Ga0453683_0257022 | 3300044673 | Unclassified | 1114 |
| 459 | Ga0466966_0103805 | 3300044684 | Bacteria | 1756 |
| 460 | Ga0466966_0139911 | 3300044684 | Bacteria | 1479 |
| 461 | Ga0466961_0004980 | 3300044693 | Bacteria | 8354 |
| 462 | Ga0466961_0046485 | 3300044693 | Bacteria | 2776 |
| 463 | Ga0466961_0078167 | 3300044693 | Bacteria | 2096 |
| 464 | Ga0466961_0095904 | 3300044693 | Bacteria | 1870 |
| 465 | Ga0466961_0208829 | 3300044693 | Bacteria | 1206 |
| 466 | Ga0466961_0249038 | 3300044693 | Bacteria | 1091 |
| 467 | Ga0466963_0001284 | 3300044694 | Bacteria | 13335 |
| 468 | Ga0466963_0004381 | 3300044694 | Bacteria | 8202 |
| 469 | Ga0466963_0008647 | 3300044694 | Bacteria | 6111 |
| 470 | Ga0466963_0012642 | 3300044694 | Bacteria | 5171 |
| 471 | Ga0466963_0020595 | 3300044694 | Bacteria | 4147 |
| 472 | Ga0466963_0042698 | 3300044694 | Bacteria | 2978 |
| 473 | Ga0466963_0068186 | 3300044694 | Bacteria | 2388 |
| 474 | Ga0466963_0106728 | 3300044694 | Bacteria | 1920 |
| 475 | Ga0466963_0112408 | 3300044694 | Bacteria | 1870 |
| 476 | Ga0466963_0153557 | 3300044694 | Bacteria | 1599 |
| 477 | Ga0466963_0172072 | 3300044694 | Bacteria | 1510 |
| 478 | Ga0466964_0001577 | 3300044706 | Bacteria | 7848 |
| 479 | Ga0466964_0026261 | 3300044706 | Bacteria | 2279 |
| 480 | Ga0466964_0096569 | 3300044706 | Bacteria | 1295 |
| 481 | Ga0466971_0001292 | 3300044719 | Bacteria | 10455 |
| 482 | Ga0466971_0007129 | 3300044719 | Bacteria | 4864 |
| 483 | Ga0466971_0022221 | 3300044719 | Bacteria | 2825 |
| 484 | Ga0466971_0030905 | 3300044719 | Bacteria | 2397 |
| 485 | Ga0466971_0104360 | 3300044719 | Bacteria | 1304 |
| 486 | Ga0466968_0051762 | 3300044735 | Bacteria | 1755 |
| 487 | Ga0466968_0054463 | 3300044735 | Bacteria | 1715 |
| 488 | Ga0466970_0039675 | 3300044765 | Bacteria | 2499 |
| 489 | Ga0466970_0047961 | 3300044765 | Bacteria | 2277 |
| 490 | Ga0466957_0002456 | 3300044842 | Bacteria | 9949 |
| 491 | Ga0466957_0014108 | 3300044842 | Bacteria | 4648 |
| 492 | Ga0466957_0034683 | 3300044842 | Bacteria | 3026 |
| 493 | Ga0466957_0058157 | 3300044842 | Unclassified | 2368 |
| 494 | Ga0466957_0115532 | 3300044842 | Bacteria | 1706 |
| 495 | Ga0466960_0075432 | 3300044901 | Bacteria | 1687 |
| 496 | Ga0466960_0086219 | 3300044901 | Bacteria | 1592 |
| 497 | Ga0466960_0130230 | 3300044901 | Bacteria | 1327 |
| 498 | Ga0466960_0162041 | 3300044901 | Bacteria | 1201 |
| 499 | Ga0466960_0164385 | 3300044901 | Bacteria | 1194 |
| 500 | Ga0466960_0201300 | 3300044901 | Bacteria | 1088 |
| 501 | Ga0466959_0001782 | 3300045049 | Bacteria | 13445 |
| 502 | Ga0466959_0005602 | 3300045049 | Bacteria | 8632 |
| 503 | Ga0466959_0009035 | 3300045049 | Bacteria | 7070 |
| 504 | Ga0466959_0016644 | 3300045049 | Bacteria | 5376 |
| 505 | Ga0466959_0022496 | 3300045049 | Bacteria | 4661 |
| 506 | Ga0466959_0048828 | 3300045049 | Bacteria | 3110 |
| 507 | Ga0466959_0075158 | 3300045049 | Bacteria | 2442 |
| 508 | Ga0466959_0197203 | 3300045049 | Bacteria | 1403 |
| 509 | Ga0466959_0287134 | 3300045049 | Bacteria | 1128 |
| 510 | Ga0466959_0290339 | 3300045049 | Bacteria | 1121 |
| 511 | Ga0466958_0002166 | 3300045836 | Bacteria | 9784 |
| 512 | Ga0466958_0011620 | 3300045836 | Bacteria | 4962 |
| 513 | Ga0466958_0014090 | 3300045836 | Bacteria | 4561 |
| 514 | Ga0466958_0017039 | 3300045836 | Bacteria | 4193 |
| 515 | Ga0466958_0025442 | 3300045836 | Bacteria | 3491 |
| 516 | Ga0466958_0070476 | 3300045836 | Bacteria | 2139 |
| 517 | Ga0466958_0141751 | 3300045836 | Unclassified | 1513 |
| 518 | Ga0466967_0000648 | 3300045976 | Bacteria | 17473 |
| 519 | Ga0466967_0008322 | 3300045976 | Bacteria | 7586 |
| 520 | Ga0466967_0019805 | 3300045976 | Bacteria | 5421 |
| 521 | Ga0466967_0022282 | 3300045976 | Bacteria | 5165 |
| 522 | Ga0466967_0031278 | 3300045976 | Bacteria | 4478 |
| 523 | Ga0466967_0077059 | 3300045976 | Bacteria | 3000 |
| 524 | Ga0466967_0130134 | 3300045976 | Bacteria | 2335 |
| 525 | Ga0466967_0143920 | 3300045976 | Bacteria | 2222 |
| 526 | Ga0466967_0197159 | 3300045976 | Bacteria | 1905 |
| 527 | Ga0466967_0245851 | 3300045976 | Bacteria | 1707 |
| 528 | Ga0466967_0284372 | 3300045976 | Bacteria | 1587 |
| 529 | Ga0466967_0285097 | 3300045976 | Bacteria | 1585 |
| 530 | Ga0466967_0288711 | 3300045976 | Bacteria | 1575 |
| 531 | Ga0466967_0408358 | 3300045976 | Bacteria | 1322 |
| 532 | Ga0466967_1641877 | 3300045976 | Bacteria | 640 |
| 533 | Ga0495592_0138081 | 3300046454 | Bacteria | 1698 |
| 534 | Ga0495603_0039235 | 3300046455 | Bacteria | 2838 |
| 535 | Ga0495629_0029097 | 3300046459 | Bacteria | 3920 |
| 536 | Ga0495629_0091699 | 3300046459 | Bacteria | 2120 |
| 537 | Ga0495629_0157599 | 3300046459 | Bacteria | 1577 |
| 538 | Ga0495641_0001891 | 3300046461 | Bacteria | 17145 |
| 539 | Ga0495641_0096279 | 3300046461 | Bacteria | 1321 |
| 540 | Ga0495651_0009031 | 3300046462 | Bacteria | 7654 |
| 541 | Ga0495651_0423252 | 3300046462 | Bacteria | 865 |
| 542 | Ga0495653_0301865 | 3300046463 | Bacteria | 1044 |
| 543 | Ga0495580_0202582 | 3300046472 | Bacteria | 1367 |
| 544 | Ga0495582_0013172 | 3300046473 | Bacteria | 4550 |
| 545 | Ga0495582_0014279 | 3300046473 | Bacteria | 4369 |
| 546 | Ga0495639_0000124 | 3300046475 | Bacteria | 39427 |
| 547 | Ga0495664_0001606 | 3300046477 | Bacteria | 12016 |
| 548 | Ga0495664_0227172 | 3300046477 | Bacteria | 1130 |
| 549 | Ga0495584_0091085 | 3300046491 | Bacteria | 1538 |
| 550 | Ga0495585_0373380 | 3300046492 | Bacteria | 690 |
| 551 | Ga0495596_0091876 | 3300046500 | Bacteria | 1178 |
| 552 | Ga0495608_0011822 | 3300046511 | Bacteria | 6073 |
| 553 | Ga0495608_0175417 | 3300046511 | Bacteria | 1358 |
| 554 | Ga0495618_0031836 | 3300046514 | Bacteria | 3302 |
| 555 | Ga0495618_0042321 | 3300046514 | Bacteria | 2871 |
| 556 | Ga0495628_0022690 | 3300046516 | Bacteria | 5155 |
| 557 | Ga0495628_0129284 | 3300046516 | Bacteria | 1933 |
| 558 | Ga0495630_0017182 | 3300046517 | Bacteria | 5297 |
| 559 | Ga0495630_0107439 | 3300046517 | Bacteria | 2114 |
| 560 | Ga0495644_0037913 | 3300046523 | Bacteria | 1819 |
| 561 | Ga0495663_0126358 | 3300046525 | Bacteria | 859 |
| 562 | Ga0495666_0000313 | 3300046526 | Bacteria | 21047 |
| 563 | Ga0495642_0005247 | 3300046528 | Bacteria | 4981 |
| 564 | Ga0495652_0010488 | 3300046529 | Bacteria | 8395 |
| 565 | Ga0495665_0004150 | 3300046531 | Bacteria | 7814 |
| 566 | Ga0495640_0170764 | 3300046533 | Bacteria | 1389 |
| 567 | Ga0495640_0362263 | 3300046533 | Unclassified | 894 |
| 568 | Ga0495645_0084916 | 3300046543 | Bacteria | 2266 |
| 569 | Ga0495645_0285956 | 3300046543 | Bacteria | 1083 |
| 570 | Ga0495667_0007852 | 3300046559 | Bacteria | 7232 |
| 571 | Ga0495667_0033246 | 3300046559 | Bacteria | 3452 |
| 572 | Ga0495667_0052013 | 3300046559 | Bacteria | 2700 |
| 573 | Ga0495656_0334205 | 3300046615 | Bacteria | 782 |
| 574 | Ga0495634_0018558 | 3300046642 | Bacteria | 4950 |
| 575 | Ga0495635_0021037 | 3300046663 | Bacteria | 4546 |
| 576 | Ga0495635_0035669 | 3300046663 | Bacteria | 3448 |
| 577 | Ga0495635_0085658 | 3300046663 | Bacteria | 2156 |
| 578 | Ga0495659_0030003 | 3300046664 | Bacteria | 1890 |
| 579 | Ga0495588_0021195 | 3300046674 | Bacteria | 3200 |
| 580 | Ga0495588_0088231 | 3300046674 | Bacteria | 1623 |
| 581 | Ga0495657_0104954 | 3300046675 | Bacteria | 1796 |
| 582 | Ga0495657_0257596 | 3300046675 | Bacteria | 1049 |
| 583 | Ga0495646_0016017 | 3300046680 | Bacteria | 4758 |
| 584 | Ga0495647_0000284 | 3300046681 | Bacteria | 14074 |
| 585 | Ga0495647_0016468 | 3300046681 | Bacteria | 2603 |
| 586 | Ga0495647_0058033 | 3300046681 | Bacteria | 1520 |
| 587 | Ga0495658_0014682 | 3300046683 | Bacteria | 4005 |
| 588 | Ga0495658_0043600 | 3300046683 | Bacteria | 2510 |
| 589 | Ga0495613_0008842 | 3300046689 | Bacteria | 7470 |
| 590 | Ga0495624_0088892 | 3300046690 | Bacteria | 1907 |
| 591 | Ga0495670_0275548 | 3300046691 | Bacteria | 899 |
| 592 | Ga0495670_0288707 | 3300046691 | Bacteria | 878 |
| 593 | Ga0495589_0055300 | 3300046794 | Bacteria | 1956 |
| 594 | Ga0495581_0006215 | 3300047315 | Bacteria | 6927 |
| 595 | Ga0495581_0032602 | 3300047315 | Bacteria | 3016 |
| 596 | Ga0495604_0149207 | 3300047317 | Bacteria | 1663 |
| 597 | Ga0495636_0134365 | 3300047318 | Bacteria | 1102 |
| 598 | Ga0495674_0030088 | 3300047319 | Bacteria | 4940 |
| 599 | Ga0495674_0104988 | 3300047319 | Bacteria | 2402 |
| 600 | Ga0495676_0005328 | 3300047321 | Bacteria | 11781 |
| 601 | Ga0495676_0030870 | 3300047321 | Bacteria | 4540 |
| 602 | Ga0495680_0001115 | 3300047322 | Bacteria | 29670 |
| 603 | Ga0495680_0019071 | 3300047322 | Bacteria | 5806 |
| 604 | Ga0495680_0065106 | 3300047322 | Bacteria | 2793 |
| 605 | Ga0495680_0123006 | 3300047322 | Bacteria | 1914 |
| 606 | Ga0495675_0183325 | 3300047444 | Bacteria | 1281 |
| 607 | Ga0495684_0016876 | 3300047471 | Bacteria | 5625 |
| 608 | Ga0495684_0035641 | 3300047471 | Bacteria | 3814 |
| 609 | Ga0495684_0274417 | 3300047471 | Bacteria | 1219 |
| 610 | Ga0495684_0428599 | 3300047471 | Bacteria | 923 |
| 611 | Ga0495593_0003235 | 3300047673 | Bacteria | 9764 |
| 612 | Ga0495614_0000837 | 3300048089 | Bacteria | 13016 |
| 613 | Ga0495614_0313816 | 3300048089 | Bacteria | 726 |
| 614 | Ga0496100_0002332 | 3300048903 | Bacteria | 9601 |
| 615 | Ga0496100_0042161 | 3300048903 | Bacteria | 2914 |
| 616 | Ga0496100_0135610 | 3300048903 | Bacteria | 1738 |
| 617 | Ga0496100_0208502 | 3300048903 | Bacteria | 1428 |
| 618 | Ga0496101_0158745 | 3300048904 | Bacteria | 1733 |
| 619 | Ga0496101_0185604 | 3300048904 | Bacteria | 1603 |
| 620 | Ga0496101_0185768 | 3300048904 | Bacteria | 1602 |
| 621 | Ga0496101_0192551 | 3300048904 | Bacteria | 1574 |
| 622 | Ga0496101_0200591 | 3300048904 | Bacteria | 1542 |
| 623 | Ga0496101_0214356 | 3300048904 | Bacteria | 1492 |
| 624 | Ga0496101_0550194 | 3300048904 | Bacteria | 912 |
| 625 | Ga0496102_0002937 | 3300048905 | Bacteria | 14456 |
| 626 | Ga0496102_0205535 | 3300048905 | Bacteria | 1856 |
| 627 | Ga0496102_0574057 | 3300048905 | Bacteria | 1050 |
| 628 | Ga0496103_0012327 | 3300048906 | Bacteria | 5072 |
| 629 | Ga0496103_0015535 | 3300048906 | Bacteria | 4533 |
| 630 | Ga0496103_0018880 | 3300048906 | Bacteria | 4140 |
| 631 | Ga0496103_0057767 | 3300048906 | Bacteria | 2409 |
| 632 | Ga0496103_0072742 | 3300048906 | Bacteria | 2154 |
| 633 | Ga0496104_0000188 | 3300048907 | Bacteria | 55678 |
| 634 | Ga0496104_0003064 | 3300048907 | Bacteria | 14407 |
| 635 | Ga0496104_0015209 | 3300048907 | Bacteria | 6967 |
| 636 | Ga0496104_0368181 | 3300048907 | Bacteria | 1350 |
| 637 | Ga0496105_0027980 | 3300048908 | Bacteria | 4609 |
| 638 | Ga0496105_0050307 | 3300048908 | Bacteria | 3442 |
| 639 | Ga0496105_0152010 | 3300048908 | Bacteria | 1902 |
| 640 | Ga0496105_0174957 | 3300048908 | Bacteria | 1758 |
| 641 | Ga0496105_0451590 | 3300048908 | Bacteria | 1014 |
| 642 | Ga0496105_0883262 | 3300048908 | Bacteria | 675 |
| 643 | Ga0496106_0003891 | 3300048909 | Bacteria | 11143 |
| 644 | Ga0496106_0245931 | 3300048909 | Bacteria | 1429 |
| 645 | Ga0496106_0257026 | 3300048909 | Bacteria | 1397 |
| 646 | Ga0496106_0328995 | 3300048909 | Bacteria | 1227 |
| 647 | Ga0496106_0718634 | 3300048909 | Unclassified | 795 |
| 648 | Ga0496107_0001297 | 3300048910 | Bacteria | 15306 |
| 649 | Ga0496107_0040799 | 3300048910 | Bacteria | 3332 |
| 650 | Ga0496107_0047451 | 3300048910 | Bacteria | 3093 |
| 651 | Ga0496107_0101910 | 3300048910 | Bacteria | 2105 |
| 652 | Ga0496107_0290603 | 3300048910 | Bacteria | 1217 |
| 653 | Ga0496108_0000668 | 3300048911 | Bacteria | 26451 |
| 654 | Ga0496108_0050288 | 3300048911 | Bacteria | 3488 |
| 655 | Ga0496108_0050566 | 3300048911 | Bacteria | 3479 |
| 656 | Ga0496108_0070328 | 3300048911 | Bacteria | 2953 |
| 657 | Ga0496108_0089411 | 3300048911 | Bacteria | 2617 |
| 658 | Ga0496108_0146110 | 3300048911 | Bacteria | 2039 |
| 659 | Ga0496109_0002742 | 3300048912 | Bacteria | 14774 |
| 660 | Ga0496109_0003319 | 3300048912 | Bacteria | 13452 |
| 661 | Ga0496109_0024106 | 3300048912 | Bacteria | 5406 |
| 662 | Ga0496109_0203693 | 3300048912 | Bacteria | 1860 |
| 663 | Ga0496109_0263985 | 3300048912 | Bacteria | 1622 |
| 664 | Ga0496109_0455693 | 3300048912 | Bacteria | 1208 |
| 665 | Ga0496110_0003760 | 3300048913 | Bacteria | 11694 |
| 666 | Ga0496110_0039359 | 3300048913 | Bacteria | 4116 |
| 667 | Ga0496110_0095245 | 3300048913 | Unclassified | 2666 |
| 668 | Ga0496110_0185943 | 3300048913 | Bacteria | 1886 |
| 669 | Ga0496111_0000433 | 3300048914 | Bacteria | 21184 |
| 670 | Ga0496111_0001044 | 3300048914 | Bacteria | 15252 |
| 671 | Ga0496111_0007288 | 3300048914 | Bacteria | 7239 |
| 672 | Ga0496111_0007396 | 3300048914 | Bacteria | 7194 |
| 673 | Ga0496111_0066973 | 3300048914 | Bacteria | 2608 |
| 674 | Ga0496111_0108461 | 3300048914 | Bacteria | 2044 |
| 675 | Ga0496111_0290106 | 3300048914 | Bacteria | 1213 |
| 676 | Ga0496112_0001632 | 3300048915 | Bacteria | 17371 |
| 677 | Ga0496112_0006143 | 3300048915 | Bacteria | 10500 |
| 678 | Ga0496112_0015478 | 3300048915 | Bacteria | 7120 |
| 679 | Ga0496112_0037845 | 3300048915 | Bacteria | 4711 |
| 680 | Ga0496112_0064607 | 3300048915 | Bacteria | 3611 |
| 681 | Ga0496112_0065951 | 3300048915 | Bacteria | 3572 |
| 682 | Ga0496112_0115365 | 3300048915 | Bacteria | 2656 |
| 683 | Ga0496112_0144076 | 3300048915 | Bacteria | 2351 |
| 684 | Ga0496112_0170666 | 3300048915 | Bacteria | 2140 |
| 685 | Ga0496112_0399804 | 3300048915 | Bacteria | 1314 |
| 686 | Ga0496112_0505389 | 3300048915 | Bacteria | 1144 |
| 687 | Ga0496112_0644814 | 3300048915 | Bacteria | 989 |
| 688 | Ga0496113_0010963 | 3300048916 | Bacteria | 6020 |
| 689 | Ga0496113_0018593 | 3300048916 | Bacteria | 4843 |
| 690 | Ga0496113_0041554 | 3300048916 | Bacteria | 3393 |
| 691 | Ga0496113_0051534 | 3300048916 | Bacteria | 3072 |
| 692 | Ga0496113_0074867 | 3300048916 | Bacteria | 2582 |
| 693 | Ga0496113_0082978 | 3300048916 | Bacteria | 2459 |
| 694 | Ga0496113_0437971 | 3300048916 | Bacteria | 1050 |
| 695 | Ga0496114_0003843 | 3300048917 | Bacteria | 11583 |
| 696 | Ga0496114_0020582 | 3300048917 | Bacteria | 5355 |
| 697 | Ga0496114_0053762 | 3300048917 | Bacteria | 3357 |
| 698 | Ga0496114_0206122 | 3300048917 | Bacteria | 1723 |
| 699 | Ga0496114_0208732 | 3300048917 | Bacteria | 1712 |
| 700 | Ga0496114_0858499 | 3300048917 | Bacteria | 788 |
| 701 | Ga0496115_0025999 | 3300048918 | Bacteria | 4563 |
| 702 | Ga0496115_0045540 | 3300048918 | Bacteria | 3502 |
| 703 | Ga0496115_0051449 | 3300048918 | Bacteria | 3303 |
| 704 | Ga0496115_0064848 | 3300048918 | Bacteria | 2950 |
| 705 | Ga0496115_0096971 | 3300048918 | Bacteria | 2415 |
| 706 | Ga0496115_0138643 | 3300048918 | Bacteria | 2006 |
| 707 | Ga0496115_0301572 | 3300048918 | Bacteria | 1313 |
| 708 | Ga0501043_0344105 | 3300049579 | Bacteria | 1134 |
| 709 | Ga0501047_0393640 | 3300049581 | Bacteria | 1219 |
| 710 | Ga0501067_0007704 | 3300049583 | Bacteria | 5989 |
| 711 | Ga0501067_0074612 | 3300049583 | Bacteria | 1880 |
| 712 | Ga0501067_0078971 | 3300049583 | Bacteria | 1823 |
| 713 | Ga0501067_0324404 | 3300049583 | Bacteria | 857 |
| 714 | Ga0501069_0055918 | 3300049585 | Bacteria | 2198 |
| 715 | Ga0501069_0119834 | 3300049585 | Bacteria | 1502 |
| 716 | Ga0501070_0165542 | 3300049586 | Bacteria | 1822 |
| 717 | Ga0501072_0017987 | 3300049588 | Bacteria | 5434 |
| 718 | Ga0501073_0040303 | 3300049589 | Bacteria | 3306 |
| 719 | Ga0501074_0025001 | 3300049590 | Bacteria | 4339 |
| 720 | Ga0501074_0084297 | 3300049590 | Bacteria | 2278 |
| 721 | Ga0501079_0062921 | 3300049741 | Bacteria | 2862 |
| 722 | Ga0501080_0001559 | 3300049742 | Bacteria | 19371 |
| 723 | Ga0501080_0071927 | 3300049742 | Bacteria | 3217 |
| 724 | Ga0501083_0009330 | 3300049744 | Bacteria | 6926 |
| 725 | nmdc:mga03n38_32490_c1 | 3300050490 | Bacteria | 2211 |
| 726 | nmdc:mga05p37_211601_c1 | 3300050507 | Bacteria | 2343 |
| 727 | nmdc:mga05p37_5008_c1 | 3300050507 | Bacteria | 15530 |
| 728 | nmdc:mga05p37_67750_c1 | 3300050507 | Bacteria | 4391 |
| 729 | nmdc:mga06r32_585744_c1 | 3300050510 | Unclassified | 1087 |
| 730 | nmdc:mga06r32_85397_c1 | 3300050510 | Bacteria | 3077 |
| 731 | nmdc:mga0n895_424331_c1 | 3300050512 | Bacteria | 1344 |
| 732 | nmdc:mga0n895_49725_c1 | 3300050512 | Bacteria | 4109 |
| 733 | nmdc:mga0rr50_37176_c1 | 3300050513 | Bacteria | 3512 |
| 734 | nmdc:mga08x19_100733_c1 | 3300050514 | Bacteria | 1916 |
| 735 | nmdc:mga08x19_212790_c1 | 3300050514 | Bacteria | 1327 |
| 736 | nmdc:mga08x19_220620_c1 | 3300050514 | Unclassified | 1303 |
| 737 | Ga0495601_0066496 | 3300053077 | Bacteria | 2294 |
| 738 | Ga0495601_0108812 | 3300053077 | Bacteria | 1794 |
| 739 | Ga0495612_0019686 | 3300053078 | Bacteria | 2703 |
| 740 | Ga0495655_0025617 | 3300053083 | Bacteria | 1382 |
| 741 | Ga0495595_0035258 | 3300053084 | Bacteria | 2267 |
| 742 | Ga0495595_0056991 | 3300053084 | Bacteria | 1822 |
| 743 | Ga0495619_0002423 | 3300053085 | Bacteria | 12245 |
| 744 | Ga0495619_0041217 | 3300053085 | Bacteria | 3020 |
| 745 | Ga0495619_0048439 | 3300053085 | Bacteria | 2800 |
| 746 | Ga0495619_0228455 | 3300053085 | Bacteria | 1289 |
| 747 | Ga0500566_0084772 | 3300053094 | Bacteria | 1758 |
| 748 | Ga0501084_0303070 | 3300054114 | Bacteria | 1350 |
| 749 | Ga0587077_077916 | 3300059493 | Bacteria | 754 |
| 750 | Ga0587080_042803 | 3300059503 | Bacteria | 831 |
| 751 | Ga0587122_017656 | 3300059628 | Bacteria | 749 |
| 752 | Ga0587128_034371 | 3300059630 | Bacteria | 857 |
| 753 | Ga0466962_0000333 | 3300061719 | Bacteria | 20176 |
| 754 | Ga0466962_0005158 | 3300061719 | Bacteria | 6283 |
| 755 | Ga0466962_0007319 | 3300061719 | Bacteria | 5296 |
| 756 | Ga0466962_0014870 | 3300061719 | Bacteria | 3750 |
| 757 | Ga0466962_0061091 | 3300061719 | Bacteria | 1799 |
| 758 | Ga0530510_0087899 | 3300061734 | Bacteria | 2265 |
| 759 | Ga0075365_10143309 | |||
| 760 | JGI24742J22300_10036924 | |||
| 761 | Ga0058862_12696819 | |||
| 762 | Ga0070658_10001923 | |||
| 763 | Ga0070658_10009312 | |||
| 764 | Ga0070658_10095904 | |||
| 765 | Ga0070683_100003875 | |||
| 766 | Ga0070683_100029564 | |||
| 767 | Ga0070683_100179276 | |||
| 768 | Ga0070683_100434320 | |||
| 769 | Ga0070666_10128140 | |||
| 770 | Ga0070680_100024898 | |||
| 771 | Ga0070680_100025696 | |||
| 772 | Ga0070680_100042832 | |||
| 773 | Ga0070680_100054278 | |||
| 774 | Ga0070680_100240828 | |||
| 775 | Ga0070682_100012139 | |||
| 776 | Ga0070682_100266621 | |||
| 777 | Ga0070682_100693106 | |||
| 778 | Ga0070660_100014142 | |||
| 779 | Ga0070660_100018143 | |||
| 780 | Ga0070660_100018912 | |||
| 781 | Ga0070660_100188861 | |||
| 782 | Ga0070660_100533982 | |||
| 783 | Ga0070689_100012172 | |||
| 784 | Ga0070691_10341651 | |||
| 785 | Ga0070687_100321358 | |||
| 786 | Ga0070661_100098331 | |||
| 787 | Ga0070661_100101685 | |||
| 788 | Ga0070661_100386906 | |||
| 789 | Ga0070692_10247447 | |||
| 790 | Ga0070668_100115670 | |||
| 791 | Ga0070669_100347629 | |||
| 792 | Ga0070675_100020633 | |||
| 793 | Ga0070671_100186416 | |||
| 794 | Ga0070671_100379438 | |||
| 795 | Ga0070674_100005639 | |||
| 796 | Ga0070673_100133517 | |||
| 797 | Ga0070688_100016002 | |||
| 798 | Ga0070659_100120632 | |||
| 799 | Ga0070659_100130918 | |||
| 800 | Ga0070703_10033052 | |||
| 801 | Ga0070709_10082455 | |||
| 802 | Ga0070709_10293298 | |||
| 803 | Ga0070714_100002694 | |||
| 804 | Ga0070714_100026064 | |||
| 805 | Ga0070714_100053814 | |||
| 806 | Ga0070714_100079429 | |||
| 807 | Ga0070714_100088596 | |||
| 808 | Ga0070714_100373742 | |||
| 809 | Ga0070714_100426407 | |||
| 810 | Ga0070714_100769014 | |||
| 811 | Ga0070714_101370142 | |||
| 812 | Ga0070713_100092077 | |||
| 813 | Ga0070713_100121751 | |||
| 814 | Ga0070713_100253079 | |||
| 815 | Ga0070713_100298897 | |||
| 816 | Ga0070710_10003097 | |||
| 817 | Ga0070710_10017692 | |||
| 818 | Ga0070701_10011918 | |||
| 819 | Ga0070711_100018012 | |||
| 820 | Ga0070711_100174381 | |||
| 821 | Ga0070705_100037737 | |||
| 822 | Ga0070705_100040298 | |||
| 823 | Ga0070694_100530083 | |||
| 824 | Ga0070708_100082016 | |||
| 825 | Ga0070708_100213456 | |||
| 826 | Ga0070708_100421996 | |||
| 827 | Ga0070708_100642661 | |||
| 828 | Ga0070678_100026628 | |||
| 829 | Ga0070681_10112465 | |||
| 830 | Ga0070681_10216014 | |||
| 831 | Ga0068867_100006828 | |||
| 832 | Ga0068867_100707062 | |||
| 833 | Ga0070706_100001401 | |||
| 834 | Ga0070706_100027202 | |||
| 835 | Ga0070706_100365752 | |||
| 836 | Ga0070707_100006137 | |||
| 837 | Ga0070707_100113886 | |||
| 838 | Ga0070707_100168307 | |||
| 839 | Ga0070707_100192445 | |||
| 840 | Ga0070707_100277119 | |||
| 841 | Ga0070707_100622783 | |||
| 842 | Ga0070707_100975493 | |||
| 843 | Ga0070698_100017579 | |||
| 844 | Ga0070698_100052946 | |||
| 845 | Ga0070698_100095006 | |||
| 846 | Ga0070698_100104128 | |||
| 847 | Ga0070698_100182083 | |||
| 848 | Ga0070698_100229687 | |||
| 849 | Ga0070698_100451864 | |||
| 850 | Ga0070698_100532516 | |||
| 851 | Ga0070699_100104381 | |||
| 852 | Ga0070699_100169661 | |||
| 853 | Ga0070679_100150570 | |||
| 854 | Ga0070679_100215791 | |||
| 855 | Ga0070679_100242752 | |||
| 856 | Ga0070679_100810250 | |||
| 857 | Ga0070684_100013215 | |||
| 858 | Ga0070684_100164585 | |||
| 859 | Ga0070684_100184024 | |||
| 860 | Ga0070684_100374003 | |||
| 861 | Ga0070697_100164103 | |||
| 862 | Ga0070697_100679517 | |||
| 863 | Ga0068853_100015612 | |||
| 864 | Ga0070686_100004382 | |||
| 865 | Ga0070695_100000231 | |||
| 866 | Ga0070695_100134934 | |||
| 867 | Ga0070696_100027249 | |||
| 868 | Ga0070696_100456771 | |||
| 869 | Ga0070665_100041443 | |||
| 870 | Ga0070704_100106063 | |||
| 871 | Ga0070704_100396386 | |||
| 872 | Ga0068855_100146496 | |||
| 873 | Ga0068855_100208575 | |||
| 874 | Ga0068855_100870205 | |||
| 875 | Ga0068857_100322506 | |||
| 876 | Ga0068854_100377789 | |||
| 877 | Ga0068856_100014707 | |||
| 878 | Ga0068856_100261502 | |||
| 879 | Ga0068856_100558113 | |||
| 880 | Ga0070702_100072626 | |||
| 881 | Ga0068852_100038086 | |||
| 882 | Ga0068852_100308027 | |||
| 883 | Ga0068852_100577094 | |||
| 884 | Ga0068866_10006032 | |||
| 885 | Ga0068866_10230547 | |||
| 886 | Ga0068861_100038498 | |||
| 887 | Ga0068861_100752330 | |||
| 888 | Ga0068860_100896937 | |||
| 889 | Ga0068862_100221613 | |||
| 890 | Ga0081539_10005968 | |||
| 891 | Ga0081539_10300689 | |||
| 892 | Ga0070717_10018317 | |||
| 893 | Ga0070717_10139346 | |||
| 894 | Ga0070717_10287812 | |||
| 895 | Ga0070717_11094532 | |||
| 896 | Ga0070715_10010063 | |||
| 897 | Ga0070716_100015237 | |||
| 898 | Ga0070716_100073723 | |||
| 899 | Ga0070716_100109187 | |||
| 900 | Ga0070712_100004431 | |||
| 901 | Ga0070712_100032500 | |||
| 902 | Ga0070712_100072705 | |||
| 903 | Ga0070712_100289136 | |||
| 904 | Ga0070712_100329624 | |||
| 905 | Ga0097621_100005052 | |||
| 906 | Ga0068871_100245974 | |||
| 907 | Ga0075434_100036046 | |||
| 908 | Ga0075429_101004048 | |||
| 909 | Ga0068865_100001717 | |||
| 910 | Ga0075436_100328533 | |||
| 911 | Ga0075436_100452488 | |||
| 912 | Ga0075435_100084580 | |||
| 913 | Ga0099795_10274692 | |||
| 914 | Ga0105240_10019802 | |||
| 915 | Ga0105240_10029533 | |||
| 916 | Ga0105240_10917342 | |||
| 917 | Ga0105245_10061036 | |||
| 918 | Ga0114129_10018315 | |||
| 919 | Ga0114129_10740169 | |||
| 920 | Ga0105243_10237005 | |||
| 921 | Ga0105241_10324730 | |||
| 922 | Ga0105248_10052205 | |||
| 923 | Ga0105237_10064534 | |||
| 924 | Ga0105237_10166645 | |||
| 925 | Ga0105237_10283278 | |||
| 926 | Ga0105237_10784657 | |||
| 927 | Ga0105238_10047776 | |||
| 928 | Ga0105238_10840990 | |||
| 929 | Ga0105249_10003715 | |||
| 930 | Ga0105239_10034604 | |||
| 931 | Ga0105239_10907455 | |||
| 932 | Ga0157373_10125051 | |||
| 933 | Ga0157373_10228250 | |||
| 934 | Ga0157373_10694818 | |||
| 935 | Ga0157371_10165728 | |||
| 936 | Ga0157370_10011840 | |||
| 937 | Ga0157370_10019665 | |||
| 938 | Ga0157370_10618200 | |||
| 939 | Ga0157369_10024176 | |||
| 940 | Ga0157369_10024611 | |||
| 941 | Ga0157369_10047050 | |||
| 942 | Ga0157369_10174803 | |||
| 943 | Ga0157369_10231407 | |||
| 944 | Ga0157369_10246375 | |||
| 945 | Ga0157369_10912525 | |||
| 946 | Ga0157369_11083658 | |||
| 947 | Ga0163162_10194925 | |||
| 948 | Ga0157372_10115289 | |||
| 949 | Ga0157372_11234272 | |||
| 950 | Ga0157375_10423229 | |||
| 951 | Ga0163163_10198505 | |||
| 952 | Ga0182008_10051097 | |||
| 953 | Ga0157376_10011995 | |||
| 954 | Ga0182006_1019266 | |||
| 955 | Ga0197907_11164713 | |||
| 956 | Ga0206356_10660088 | |||
| 957 | Ga0206349_1260290 | |||
| 958 | Ga0206352_10452862 | |||
| 959 | Ga0206350_11368982 | |||
| 960 | Ga0206354_10459876 | |||
| 961 | Ga0224712_10015343 | |||
| 962 | Ga0224712_10047466 | |||
| 963 | Ga0207656_10443165 | |||
| 964 | Ga0207692_10088678 | |||
| 965 | Ga0207692_10363578 | |||
| 966 | Ga0207642_10018124 | |||
| 967 | Ga0207710_10154886 | |||
| 968 | Ga0207688_10021149 | |||
| 969 | Ga0207680_10021008 | |||
| 970 | Ga0207685_10004620 | |||
| 971 | Ga0207699_10019352 | |||
| 972 | Ga0207699_10239027 | |||
| 973 | Ga0207705_10017839 | |||
| 974 | Ga0207705_10020415 | |||
| 975 | Ga0207705_10133328 | |||
| 976 | Ga0207705_10149880 | |||
| 977 | Ga0207684_10055395 | |||
| 978 | Ga0207684_10158073 | |||
| 979 | Ga0207654_10389029 | |||
| 980 | Ga0207707_10008036 | |||
| 981 | Ga0207707_10228226 | |||
| 982 | Ga0207707_10758944 | |||
| 983 | Ga0207695_10231931 | |||
| 984 | Ga0207671_10705680 | |||
| 985 | Ga0207693_10005025 | |||
| 986 | Ga0207693_10011729 | |||
| 987 | Ga0207693_10029818 | |||
| 988 | Ga0207693_10064467 | |||
| 989 | Ga0207693_10065011 | |||
| 990 | Ga0207693_10083222 | |||
| 991 | Ga0207663_10046061 | |||
| 992 | Ga0207660_10047622 | |||
| 993 | Ga0207660_10063661 | |||
| 994 | Ga0207660_10104481 | |||
| 995 | Ga0207660_10276212 | |||
| 996 | Ga0207660_10359939 | |||
| 997 | Ga0207662_10048967 | |||
| 998 | Ga0207657_10009553 | |||
| 999 | Ga0207657_10011660 | |||
| 1000 | Ga0207657_10017180 | |||
| 1001 | Ga0207657_10017602 | |||
| 1002 | Ga0207657_10052448 | |||
| 1003 | Ga0207657_10183201 | |||
| 1004 | Ga0207649_10157319 | |||
| 1005 | Ga0207652_10131820 | |||
| 1006 | Ga0207652_10141314 | |||
| 1007 | Ga0207652_10183923 | |||
| 1008 | Ga0207652_10294272 | |||
| 1009 | Ga0207646_10004153 | |||
| 1010 | Ga0207646_10010342 | |||
| 1011 | Ga0207646_10029650 | |||
| 1012 | Ga0207646_10058728 | |||
| 1013 | Ga0207646_10141736 | |||
| 1014 | Ga0207646_10522294 | |||
| 1015 | Ga0207646_10615033 | |||
| 1016 | Ga0207694_10090186 | |||
| 1017 | Ga0207694_10427900 | |||
| 1018 | Ga0207694_10781466 | |||
| 1019 | Ga0207687_10137205 | |||
| 1020 | Ga0207700_10115533 | |||
| 1021 | Ga0207700_10335360 | |||
| 1022 | Ga0207664_10067406 | |||
| 1023 | Ga0207664_10076139 | |||
| 1024 | Ga0207664_10090443 | |||
| 1025 | Ga0207664_10138080 | |||
| 1026 | Ga0207664_10287249 | |||
| 1027 | Ga0207664_10295451 | |||
| 1028 | Ga0207664_10637324 | |||
| 1029 | Ga0207664_10789333 | |||
| 1030 | Ga0207644_10413328 | |||
| 1031 | Ga0207644_10855923 | |||
| 1032 | Ga0207690_10286506 | |||
| 1033 | Ga0207706_10082059 | |||
| 1034 | Ga0207686_10980104 | |||
| 1035 | Ga0207709_10001561 | |||
| 1036 | Ga0207709_10063893 | |||
| 1037 | Ga0207670_10005360 | |||
| 1038 | Ga0207704_10009209 | |||
| 1039 | Ga0207665_10009523 | |||
| 1040 | Ga0207665_10023818 | |||
| 1041 | Ga0207665_10257846 | |||
| 1042 | Ga0207691_10010135 | |||
| 1043 | Ga0207691_10104108 | |||
| 1044 | Ga0207711_10097885 | |||
| 1045 | Ga0207689_10113478 | |||
| 1046 | Ga0207689_10318000 | |||
| 1047 | Ga0207661_10044940 | |||
| 1048 | Ga0207661_10087757 | |||
| 1049 | Ga0207661_10187130 | |||
| 1050 | Ga0207661_10248030 | |||
| 1051 | Ga0207667_10017450 | |||
| 1052 | Ga0207667_10447586 | |||
| 1053 | Ga0207651_10131115 | |||
| 1054 | Ga0207668_10020001 | |||
| 1055 | Ga0207703_10454760 | |||
| 1056 | Ga0207639_10015422 | |||
| 1057 | Ga0207702_10628261 | |||
| 1058 | Ga0207648_10003432 | |||
| 1059 | Ga0207675_100012469 | |||
| 1060 | Ga0207675_100061283 | |||
| 1061 | Ga0207683_10000262 | |||
| 1062 | Ga0207698_10493449 | |||
| 1063 | Ga0268265_10548852 | |||
| 1064 | Ga0268264_10219178 | |||
| 1065 | Ga0265319_1001400 | |||
| 1066 | Ga0265319_1001726 | |||
| 1067 | Ga0265319_1015462 | |||
| 1068 | Ga0265334_10000531 | |||
| 1069 | Ga0265334_10047221 | |||
| 1070 | Ga0265318_10000197 | |||
| 1071 | Ga0265318_10001153 | |||
| 1072 | Ga0265318_10026984 | |||
| 1073 | Ga0265322_10011001 | |||
| 1074 | Ga0265322_10081164 | |||
| 1075 | Ga0265336_10010191 | |||
| 1076 | Ga0265336_10015563 | |||
| 1077 | Ga0265336_10039696 | |||
| 1078 | Ga0265336_10075535 | |||
| 1079 | Ga0265336_10129762 | |||
| 1080 | Ga0265338_10001136 | |||
| 1081 | Ga0265338_10005668 | |||
| 1082 | Ga0265338_10013542 | |||
| 1083 | Ga0265338_10098155 | |||
| 1084 | Ga0265338_10236190 | |||
| 1085 | Ga0265338_10293118 | |||
| 1086 | Ga0265324_10091769 | |||
| 1087 | Ga0265330_10000626 | |||
| 1088 | Ga0265330_10014950 | |||
| 1089 | Ga0265332_10017312 | |||
| 1090 | Ga0265328_10007120 | |||
| 1091 | Ga0265325_10002011 | |||
| 1092 | Ga0265325_10053981 | |||
| 1093 | Ga0265329_10001354 | |||
| 1094 | Ga0265340_10007159 | |||
| 1095 | Ga0265340_10037920 | |||
| 1096 | Ga0265339_10003320 | |||
| 1097 | Ga0265339_10007751 | |||
| 1098 | Ga0265331_10000942 | |||
| 1099 | Ga0265331_10025154 | |||
| 1100 | Ga0265331_10086654 | |||
| 1101 | Ga0265327_10002175 | |||
| 1102 | Ga0265327_10020769 | |||
| 1103 | Ga0265327_10028630 | |||
| 1104 | Ga0265327_10039170 | |||
| 1105 | Ga0265316_10006881 | |||
| 1106 | Ga0265316_10308802 | |||
| 1107 | Ga0307408_100229703 | |||
| 1108 | Ga0265313_10020753 | |||
| 1109 | Ga0265313_10069995 | |||
| 1110 | Ga0265313_10125470 | |||
| 1111 | Ga0265314_10012157 | |||
| 1112 | Ga0265314_10017534 | |||
| 1113 | Ga0265342_10004117 | |||
| 1114 | Ga0265342_10007045 | |||
| 1115 | Ga0265342_10042406 | |||
| 1116 | Ga0307416_100146948 | |||
| 1117 | Ga0307415_100024667 | |||
| 1118 | Ga0373948_0004226 | |||
| 1119 | Ga0373958_0011107 | |||
| 1120 | Ga0373959_0021327 | |||
| 1121 | Ga0373926_0019053 | |||
| 1122 | Ga0373928_0014516 | |||
| 1123 | Ga0373929_0003618 | |||
| 1124 | Ga0373949_0012980 | |||
| 1125 | Ga0373951_0005542 | |||
| 1126 | Ga0373952_0007264 | |||
| 1127 | Ga0373932_0005667 | |||
| 1128 | Ga0373939_0002231 | |||
| 1129 | Ga0373945_0289164 | |||
| 1130 | Ga0373954_0249559 | |||
| 1131 | Ga0373956_0199299 | |||
| 1132 | Ga0373960_0005256 | |||
| 1133 | Ga0373961_0037687 | |||
| 1134 | Ga0373962_0012258 | |||
| 1135 | Ga0373924_0131466 | |||
| 1136 | Ga0373931_0007745 | |||
| 1137 | Ga0373931_0496876 | |||
| 1138 | Ga0373927_0031585 | |||
| 1139 | Ga0373933_0072794 | |||
| 1140 | Ga0373947_0004274 | |||
| 1141 | Ga0373947_0082048 | |||
| 1142 | Ga0373937_0084688 | |||
| 1143 | Ga0373925_0005302 | |||
| 1144 | Ga0373925_0354680 | |||
| 1145 | Ga0395899_0005387 | |||
| 1146 | Ga0395899_0016691 | |||
| 1147 | Ga0395899_0024326 | |||
| 1148 | Ga0395899_0107372 | |||
| 1149 | Ga0395899_0140139 | |||
| 1150 | Ga0395899_0251332 | |||
| 1151 | Ga0395900_0005706 | |||
| 1152 | Ga0395900_0012562 | |||
| 1153 | Ga0395900_0023819 | |||
| 1154 | Ga0395900_0047537 | |||
| 1155 | Ga0395900_0054326 | |||
| 1156 | Ga0395900_0073002 | |||
| 1157 | Ga0395900_0131871 | |||
| 1158 | Ga0395900_0213670 | |||
| 1159 | Ga0395900_0240632 | |||
| 1160 | Ga0395900_0302161 | |||
| 1161 | Ga0395900_0513986 | |||
| 1162 | Ga0395898_0002053 | |||
| 1163 | Ga0395898_0002193 | |||
| 1164 | Ga0395898_0013859 | |||
| 1165 | Ga0395898_0015806 | |||
| 1166 | Ga0395898_0045267 | |||
| 1167 | Ga0395898_0073780 | |||
| 1168 | Ga0395898_0083930 | |||
| 1169 | Ga0395898_0231248 | |||
| 1170 | Ga0395898_0302807 | |||
| 1171 | Ga0395898_0506861 | |||
| 1172 | Ga0395898_0683473 | |||
| 1173 | Ga0395898_1003219 | |||
| 1174 | Ga0395905_0010295 | |||
| 1175 | Ga0395905_0019755 | |||
| 1176 | Ga0395905_0055519 | |||
| 1177 | Ga0395905_0067615 | |||
| 1178 | Ga0395905_0079329 | |||
| 1179 | Ga0395905_0112488 | |||
| 1180 | Ga0395905_0137223 | |||
| 1181 | Ga0395905_0377801 | |||
| 1182 | Ga0395905_0394254 | |||
| 1183 | Ga0395905_0576827 | |||
| 1184 | Ga0395905_0841048 | |||
| 1185 | Ga0395905_1110672 | |||
| 1186 | Ga0395901_0002380 | |||
| 1187 | Ga0395901_0007531 | |||
| 1188 | Ga0395901_0014202 | |||
| 1189 | Ga0395901_0024354 | |||
| 1190 | Ga0395901_0034604 | |||
| 1191 | Ga0395901_0121799 | |||
| 1192 | Ga0395901_0172582 | |||
| 1193 | Ga0395901_0182190 | |||
| 1194 | Ga0395901_0210537 | |||
| 1195 | Ga0395901_0244598 | |||
| 1196 | Ga0395901_0592013 | |||
| 1197 | Ga0395901_0784483 | |||
| 1198 | Ga0242420_026687 | |||
| 1199 | Ga0436360_0640321 | |||
| 1200 | Ga0436360_1349107 | |||
| 1201 | Ga0436363_0236899 | |||
| 1202 | Ga0451787_845750 | |||
| 1203 | Ga0451793_1037934 | |||
| 1204 | Ga0451798_0070554 | |||
| 1205 | Ga0451802_1348883 | |||
| 1206 | Ga0451802_1818341 | |||
| 1207 | Ga0451835_0953254 | |||
| 1208 | Ga0451839_0669733 | |||
| 1209 | Ga0451841_0048648 | |||
| 1210 | Ga0451845_0185107 | |||
| 1211 | Ga0451847_0728326 | |||
| 1212 | Ga0451849_0784089 | |||
| 1213 | Ga0451851_0387679 | |||
| 1214 | Ga0439458_0093195 | |||
| 1215 | Ga0466969_0162874 | |||
| 1216 | Ga0453683_0257022 | |||
| 1217 | Ga0466966_0103805 | |||
| 1218 | Ga0466966_0139911 | |||
| 1219 | Ga0466961_0004980 | |||
| 1220 | Ga0466961_0046485 | |||
| 1221 | Ga0466961_0078167 | |||
| 1222 | Ga0466961_0095904 | |||
| 1223 | Ga0466961_0208829 | |||
| 1224 | Ga0466961_0249038 | |||
| 1225 | Ga0466963_0001284 | |||
| 1226 | Ga0466963_0004381 | |||
| 1227 | Ga0466963_0008647 | |||
| 1228 | Ga0466963_0012642 | |||
| 1229 | Ga0466963_0020595 | |||
| 1230 | Ga0466963_0042698 | |||
| 1231 | Ga0466963_0068186 | |||
| 1232 | Ga0466963_0106728 | |||
| 1233 | Ga0466963_0112408 | |||
| 1234 | Ga0466963_0153557 | |||
| 1235 | Ga0466963_0172072 | |||
| 1236 | Ga0466964_0001577 | |||
| 1237 | Ga0466964_0026261 | |||
| 1238 | Ga0466964_0096569 | |||
| 1239 | Ga0466971_0001292 | |||
| 1240 | Ga0466971_0007129 | |||
| 1241 | Ga0466971_0022221 | |||
| 1242 | Ga0466971_0030905 | |||
| 1243 | Ga0466971_0104360 | |||
| 1244 | Ga0466968_0051762 | |||
| 1245 | Ga0466968_0054463 | |||
| 1246 | Ga0466970_0039675 | |||
| 1247 | Ga0466970_0047961 | |||
| 1248 | Ga0466957_0002456 | |||
| 1249 | Ga0466957_0014108 | |||
| 1250 | Ga0466957_0034683 | |||
| 1251 | Ga0466957_0058157 | |||
| 1252 | Ga0466957_0115532 | |||
| 1253 | Ga0466960_0075432 | |||
| 1254 | Ga0466960_0086219 | |||
| 1255 | Ga0466960_0130230 | |||
| 1256 | Ga0466960_0162041 | |||
| 1257 | Ga0466960_0164385 | |||
| 1258 | Ga0466960_0201300 | |||
| 1259 | Ga0466959_0001782 | |||
| 1260 | Ga0466959_0005602 | |||
| 1261 | Ga0466959_0009035 | |||
| 1262 | Ga0466959_0016644 | |||
| 1263 | Ga0466959_0022496 | |||
| 1264 | Ga0466959_0048828 | |||
| 1265 | Ga0466959_0075158 | |||
| 1266 | Ga0466959_0197203 | |||
| 1267 | Ga0466959_0287134 | |||
| 1268 | Ga0466959_0290339 | |||
| 1269 | Ga0466958_0002166 | |||
| 1270 | Ga0466958_0011620 | |||
| 1271 | Ga0466958_0014090 | |||
| 1272 | Ga0466958_0017039 | |||
| 1273 | Ga0466958_0025442 | |||
| 1274 | Ga0466958_0070476 | |||
| 1275 | Ga0466958_0141751 | |||
| 1276 | Ga0466967_0000648 | |||
| 1277 | Ga0466967_0008322 | |||
| 1278 | Ga0466967_0019805 | |||
| 1279 | Ga0466967_0022282 | |||
| 1280 | Ga0466967_0031278 | |||
| 1281 | Ga0466967_0077059 | |||
| 1282 | Ga0466967_0130134 | |||
| 1283 | Ga0466967_0143920 | |||
| 1284 | Ga0466967_0197159 | |||
| 1285 | Ga0466967_0245851 | |||
| 1286 | Ga0466967_0284372 | |||
| 1287 | Ga0466967_0285097 | |||
| 1288 | Ga0466967_0288711 | |||
| 1289 | Ga0466967_0408358 | |||
| 1290 | Ga0466967_1641877 | |||
| 1291 | Ga0495592_0138081 | |||
| 1292 | Ga0495603_0039235 | |||
| 1293 | Ga0495629_0029097 | |||
| 1294 | Ga0495629_0091699 | |||
| 1295 | Ga0495629_0157599 | |||
| 1296 | Ga0495641_0001891 | |||
| 1297 | Ga0495641_0096279 | |||
| 1298 | Ga0495651_0009031 | |||
| 1299 | Ga0495651_0423252 | |||
| 1300 | Ga0495653_0301865 | |||
| 1301 | Ga0495580_0202582 | |||
| 1302 | Ga0495582_0013172 | |||
| 1303 | Ga0495582_0014279 | |||
| 1304 | Ga0495639_0000124 | |||
| 1305 | Ga0495664_0001606 | |||
| 1306 | Ga0495664_0227172 | |||
| 1307 | Ga0495584_0091085 | |||
| 1308 | Ga0495585_0373380 | |||
| 1309 | Ga0495596_0091876 | |||
| 1310 | Ga0495608_0011822 | |||
| 1311 | Ga0495608_0175417 | |||
| 1312 | Ga0495618_0031836 | |||
| 1313 | Ga0495618_0042321 | |||
| 1314 | Ga0495628_0022690 | |||
| 1315 | Ga0495628_0129284 | |||
| 1316 | Ga0495630_0017182 | |||
| 1317 | Ga0495630_0107439 | |||
| 1318 | Ga0495644_0037913 | |||
| 1319 | Ga0495663_0126358 | |||
| 1320 | Ga0495666_0000313 | |||
| 1321 | Ga0495642_0005247 | |||
| 1322 | Ga0495652_0010488 | |||
| 1323 | Ga0495665_0004150 | |||
| 1324 | Ga0495640_0170764 | |||
| 1325 | Ga0495640_0362263 | |||
| 1326 | Ga0495645_0084916 | |||
| 1327 | Ga0495645_0285956 | |||
| 1328 | Ga0495667_0007852 | |||
| 1329 | Ga0495667_0033246 | |||
| 1330 | Ga0495667_0052013 | |||
| 1331 | Ga0495656_0334205 | |||
| 1332 | Ga0495634_0018558 | |||
| 1333 | Ga0495635_0021037 | |||
| 1334 | Ga0495635_0035669 | |||
| 1335 | Ga0495635_0085658 | |||
| 1336 | Ga0495659_0030003 | |||
| 1337 | Ga0495588_0021195 | |||
| 1338 | Ga0495588_0088231 | |||
| 1339 | Ga0495657_0104954 | |||
| 1340 | Ga0495657_0257596 | |||
| 1341 | Ga0495646_0016017 | |||
| 1342 | Ga0495647_0000284 | |||
| 1343 | Ga0495647_0016468 | |||
| 1344 | Ga0495647_0058033 | |||
| 1345 | Ga0495658_0014682 | |||
| 1346 | Ga0495658_0043600 | |||
| 1347 | Ga0495613_0008842 | |||
| 1348 | Ga0495624_0088892 | |||
| 1349 | Ga0495670_0275548 | |||
| 1350 | Ga0495670_0288707 | |||
| 1351 | Ga0495589_0055300 | |||
| 1352 | Ga0495581_0006215 | |||
| 1353 | Ga0495581_0032602 | |||
| 1354 | Ga0495604_0149207 | |||
| 1355 | Ga0495636_0134365 | |||
| 1356 | Ga0495674_0030088 | |||
| 1357 | Ga0495674_0104988 | |||
| 1358 | Ga0495676_0005328 | |||
| 1359 | Ga0495676_0030870 | |||
| 1360 | Ga0495680_0001115 | |||
| 1361 | Ga0495680_0019071 | |||
| 1362 | Ga0495680_0065106 | |||
| 1363 | Ga0495680_0123006 | |||
| 1364 | Ga0495675_0183325 | |||
| 1365 | Ga0495684_0016876 | |||
| 1366 | Ga0495684_0035641 | |||
| 1367 | Ga0495684_0274417 | |||
| 1368 | Ga0495684_0428599 | |||
| 1369 | Ga0495593_0003235 | |||
| 1370 | Ga0495614_0000837 | |||
| 1371 | Ga0495614_0313816 | |||
| 1372 | Ga0496100_0002332 | |||
| 1373 | Ga0496100_0042161 | |||
| 1374 | Ga0496100_0135610 | |||
| 1375 | Ga0496100_0208502 | |||
| 1376 | Ga0496101_0158745 | |||
| 1377 | Ga0496101_0185604 | |||
| 1378 | Ga0496101_0185768 | |||
| 1379 | Ga0496101_0192551 | |||
| 1380 | Ga0496101_0200591 | |||
| 1381 | Ga0496101_0214356 | |||
| 1382 | Ga0496101_0550194 | |||
| 1383 | Ga0496102_0002937 | |||
| 1384 | Ga0496102_0205535 | |||
| 1385 | Ga0496102_0574057 | |||
| 1386 | Ga0496103_0012327 | |||
| 1387 | Ga0496103_0015535 | |||
| 1388 | Ga0496103_0018880 | |||
| 1389 | Ga0496103_0057767 | |||
| 1390 | Ga0496103_0072742 | |||
| 1391 | Ga0496104_0000188 | |||
| 1392 | Ga0496104_0003064 | |||
| 1393 | Ga0496104_0015209 | |||
| 1394 | Ga0496104_0368181 | |||
| 1395 | Ga0496105_0027980 | |||
| 1396 | Ga0496105_0050307 | |||
| 1397 | Ga0496105_0152010 | |||
| 1398 | Ga0496105_0174957 | |||
| 1399 | Ga0496105_0451590 | |||
| 1400 | Ga0496105_0883262 | |||
| 1401 | Ga0496106_0003891 | |||
| 1402 | Ga0496106_0245931 | |||
| 1403 | Ga0496106_0257026 | |||
| 1404 | Ga0496106_0328995 | |||
| 1405 | Ga0496106_0718634 | |||
| 1406 | Ga0496107_0001297 | |||
| 1407 | Ga0496107_0040799 | |||
| 1408 | Ga0496107_0047451 | |||
| 1409 | Ga0496107_0101910 | |||
| 1410 | Ga0496107_0290603 | |||
| 1411 | Ga0496108_0000668 | |||
| 1412 | Ga0496108_0050288 | |||
| 1413 | Ga0496108_0050566 | |||
| 1414 | Ga0496108_0070328 | |||
| 1415 | Ga0496108_0089411 | |||
| 1416 | Ga0496108_0146110 | |||
| 1417 | Ga0496109_0002742 | |||
| 1418 | Ga0496109_0003319 | |||
| 1419 | Ga0496109_0024106 | |||
| 1420 | Ga0496109_0203693 | |||
| 1421 | Ga0496109_0263985 | |||
| 1422 | Ga0496109_0455693 | |||
| 1423 | Ga0496110_0003760 | |||
| 1424 | Ga0496110_0039359 | |||
| 1425 | Ga0496110_0095245 | |||
| 1426 | Ga0496110_0185943 | |||
| 1427 | Ga0496111_0000433 | |||
| 1428 | Ga0496111_0001044 | |||
| 1429 | Ga0496111_0007288 | |||
| 1430 | Ga0496111_0007396 | |||
| 1431 | Ga0496111_0066973 | |||
| 1432 | Ga0496111_0108461 | |||
| 1433 | Ga0496111_0290106 | |||
| 1434 | Ga0496112_0001632 | |||
| 1435 | Ga0496112_0006143 | |||
| 1436 | Ga0496112_0015478 | |||
| 1437 | Ga0496112_0037845 | |||
| 1438 | Ga0496112_0064607 | |||
| 1439 | Ga0496112_0065951 | |||
| 1440 | Ga0496112_0115365 | |||
| 1441 | Ga0496112_0144076 | |||
| 1442 | Ga0496112_0170666 | |||
| 1443 | Ga0496112_0399804 | |||
| 1444 | Ga0496112_0505389 | |||
| 1445 | Ga0496112_0644814 | |||
| 1446 | Ga0496113_0010963 | |||
| 1447 | Ga0496113_0018593 | |||
| 1448 | Ga0496113_0041554 | |||
| 1449 | Ga0496113_0051534 | |||
| 1450 | Ga0496113_0074867 | |||
| 1451 | Ga0496113_0082978 | |||
| 1452 | Ga0496113_0437971 | |||
| 1453 | Ga0496114_0003843 | |||
| 1454 | Ga0496114_0020582 | |||
| 1455 | Ga0496114_0053762 | |||
| 1456 | Ga0496114_0206122 | |||
| 1457 | Ga0496114_0208732 | |||
| 1458 | Ga0496114_0858499 | |||
| 1459 | Ga0496115_0025999 | |||
| 1460 | Ga0496115_0045540 | |||
| 1461 | Ga0496115_0051449 | |||
| 1462 | Ga0496115_0064848 | |||
| 1463 | Ga0496115_0096971 | |||
| 1464 | Ga0496115_0138643 | |||
| 1465 | Ga0496115_0301572 | |||
| 1466 | Ga0501043_0344105 | |||
| 1467 | Ga0501047_0393640 | |||
| 1468 | Ga0501067_0007704 | |||
| 1469 | Ga0501067_0074612 | |||
| 1470 | Ga0501067_0078971 | |||
| 1471 | Ga0501067_0324404 | |||
| 1472 | Ga0501069_0055918 | |||
| 1473 | Ga0501069_0119834 | |||
| 1474 | Ga0501070_0165542 | |||
| 1475 | Ga0501072_0017987 | |||
| 1476 | Ga0501073_0040303 | |||
| 1477 | Ga0501074_0025001 | |||
| 1478 | Ga0501074_0084297 | |||
| 1479 | Ga0501079_0062921 | |||
| 1480 | Ga0501080_0001559 | |||
| 1481 | Ga0501080_0071927 | |||
| 1482 | Ga0501083_0009330 | |||
| 1483 | nmdc:mga03n38_32490_c1 | |||
| 1484 | nmdc:mga05p37_211601_c1 | |||
| 1485 | nmdc:mga05p37_5008_c1 | |||
| 1486 | nmdc:mga05p37_67750_c1 | |||
| 1487 | nmdc:mga06r32_585744_c1 | |||
| 1488 | nmdc:mga06r32_85397_c1 | |||
| 1489 | nmdc:mga0n895_424331_c1 | |||
| 1490 | nmdc:mga0n895_49725_c1 | |||
| 1491 | nmdc:mga0rr50_37176_c1 | |||
| 1492 | nmdc:mga08x19_100733_c1 | |||
| 1493 | nmdc:mga08x19_212790_c1 | |||
| 1494 | nmdc:mga08x19_220620_c1 | |||
| 1495 | Ga0495601_0066496 | |||
| 1496 | Ga0495601_0108812 | |||
| 1497 | Ga0495612_0019686 | |||
| 1498 | Ga0495655_0025617 | |||
| 1499 | Ga0495595_0035258 | |||
| 1500 | Ga0495595_0056991 | |||
| 1501 | Ga0495619_0002423 | |||
| 1502 | Ga0495619_0041217 | |||
| 1503 | Ga0495619_0048439 | |||
| 1504 | Ga0495619_0228455 | |||
| 1505 | Ga0500566_0084772 | |||
| 1506 | Ga0501084_0303070 | |||
| 1507 | Ga0587077_077916 | |||
| 1508 | Ga0587080_042803 | |||
| 1509 | Ga0587122_017656 | |||
| 1510 | Ga0587128_034371 | |||
| 1511 | Ga0466962_0000333 | |||
| 1512 | Ga0466962_0005158 | |||
| 1513 | Ga0466962_0007319 | |||
| 1514 | Ga0466962_0014870 | |||
| 1515 | Ga0466962_0061091 | |||
| 1516 | Ga0530510_0087899 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gpn-assembly1.cif.gz_0 | architecture of mammalian respirasome | 0.9036 | 23 | 195 |
| 5luf-assembly1.cif.gz_z | cryo-em of bovine respirasome | 0.9036 | 23 | 195 |
| 1occ-assembly1.cif.gz_C | structure of bovine heart cytochrome c oxidase at the fully oxidized state | 0.9036 | 23 | 195 |
| 1occ-assembly1.cif.gz_P | structure of bovine heart cytochrome c oxidase at the fully oxidized state | 0.9036 | 23 | 195 |
| 7dgq-assembly1.cif.gz_A9 | activity optimized supercomplex state1 | 0.9036 | 23 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0H600_74_264_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8936 | 24 | 195 | 1.20.120.80 |
| af_P14575_77_269_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8881 | 23 | 196 | 1.20.120.80 |
| 2yevD03 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8862 | 20 | 197 | 1.20.120.80 |
| af_P9WP67_20_203_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8841 | 18 | 197 | 1.20.120.80 |
| af_P24891_68_255_1.20.120.80 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle | 0.8831 | 23 | 195 | 1.20.120.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838IAJ7-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) | 0.9658 | 55 | 197 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-A0A838IAJ7-F1-model_v4 | cytochrome-c oxidase (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) | 0.9592 | 55 | 197 |
GO:0004129
GO:0005886 GO:0019646 |
| AF-G3CJQ1-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.9588 | 77 | 195 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |
| AF-A0A087FW95-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.9574 | 74 | 195 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |
| AF-A0A068ACJ6-F1-model_v4 | Cytochrome c oxidase subunit 3 | 0.954 | 70 | 187 |
GO:0004129
GO:0005739 GO:0006123 GO:0016020 |