F479417
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 757 | 403 | 713 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300048913|Ga0496110_0147094|Ga0496110_0147094_1153_1998 |
| Length | 281 |
| Sequence | VRVCPSDRPLPIAPAAKAIGGCASAAIALNPAEGEAMMLPARKRADVLLVERGLFESRARAQAAIEAGLVTANGKAVAKPSETIATDAVLQAQAAHPFVSRGGVKLAGAQEQYPIDIEGHVCLDVGASTGGFTEVLLANGASLVFAIDVGREQMHPSLRGHPKVVSMEETDIRDFEGKRLPMRPDVVVIDVSFVSLKAVLPVALSLAAAPMHLLALIKPQFEAARKHSKRGIIRNAMVHQQICDDIAEFAASLGCSDIKVFPSSITGGDGNIEFFIGARRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 4 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 8 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 9 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 10 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 11 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 12 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 13 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 14 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 15 | 2791355199 | |||
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 18 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 19 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 20 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 21 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 22 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 23 | 2904699407 | |||
| 24 | 2906610324 | |||
| 25 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 26 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 27 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 28 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 29 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 30 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 31 | 2922425934 | |||
| 32 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 33 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 34 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 35 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 36 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 37 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 38 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 45 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 107 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 108 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 109 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 206 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 218 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 236 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 248 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 249 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 327 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 330 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 331 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 332 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 333 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 334 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 335 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 372 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 377 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 381 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 383 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 384 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 385 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 391 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 396 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 397 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 398 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 399 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 400 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 401 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 402 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 403 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.56 |
| Metatranscriptomes | 0.13 |
| Isolates | 5.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.87 |
| Nodule | 4.89 |
| Rhizoplane | 6.08 |
| Rhizosphere | 73.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10004213 | 3300003215 | Bacteria | 7795 |
| 2 | JGI25404J52841_10013554 | 3300003659 | Bacteria | 1768 |
| 3 | Ga0070658_10023061 | 3300005327 | Bacteria | 4997 |
| 4 | Ga0070683_100002376 | 3300005329 | Bacteria | 14933 |
| 5 | Ga0070683_100039720 | 3300005329 | Bacteria | 4322 |
| 6 | Ga0068869_100053873 | 3300005334 | Bacteria | 2926 |
| 7 | Ga0068869_100109397 | 3300005334 | Bacteria | 2100 |
| 8 | Ga0070680_100101164 | 3300005336 | Bacteria | 2392 |
| 9 | Ga0070680_100184226 | 3300005336 | Bacteria | 1759 |
| 10 | Ga0070680_100294063 | 3300005336 | Bacteria | 1377 |
| 11 | Ga0070680_100401665 | 3300005336 | Bacteria | 1168 |
| 12 | Ga0070682_100051594 | 3300005337 | Bacteria | 2571 |
| 13 | Ga0068868_100041269 | 3300005338 | Bacteria | 3595 |
| 14 | Ga0070660_100011623 | 3300005339 | Bacteria | 6266 |
| 15 | Ga0070660_100146256 | 3300005339 | Bacteria | 1898 |
| 16 | Ga0070660_100438281 | 3300005339 | Bacteria | 1083 |
| 17 | Ga0070691_10015392 | 3300005341 | Bacteria | 3515 |
| 18 | Ga0070687_100068743 | 3300005343 | Bacteria | 1895 |
| 19 | Ga0070661_100121680 | 3300005344 | Bacteria | 1955 |
| 20 | Ga0070692_10351844 | 3300005345 | Bacteria | 916 |
| 21 | Ga0070668_100392405 | 3300005347 | Bacteria | 1183 |
| 22 | Ga0070668_100418139 | 3300005347 | Bacteria | 1147 |
| 23 | Ga0070669_100099354 | 3300005353 | Bacteria | 2193 |
| 24 | Ga0070671_100036389 | 3300005355 | Bacteria | 4082 |
| 25 | Ga0070671_100300834 | 3300005355 | Bacteria | 1366 |
| 26 | Ga0070674_100133845 | 3300005356 | Bacteria | 1852 |
| 27 | Ga0070673_100433193 | 3300005364 | Bacteria | 1180 |
| 28 | Ga0070688_100141458 | 3300005365 | Bacteria | 1635 |
| 29 | Ga0070659_100024121 | 3300005366 | Bacteria | 4661 |
| 30 | Ga0070659_100076973 | 3300005366 | Bacteria | 2660 |
| 31 | Ga0070659_100237090 | 3300005366 | Bacteria | 1508 |
| 32 | Ga0070709_10005136 | 3300005434 | Bacteria | 7082 |
| 33 | Ga0070714_100030939 | 3300005435 | Bacteria | 4460 |
| 34 | Ga0070714_100054028 | 3300005435 | Bacteria | 3430 |
| 35 | Ga0070714_100062126 | 3300005435 | Bacteria | 3210 |
| 36 | Ga0070714_100203092 | 3300005435 | Bacteria | 1813 |
| 37 | Ga0070714_100426475 | 3300005435 | Bacteria | 1257 |
| 38 | Ga0070713_100006818 | 3300005436 | Bacteria | 7958 |
| 39 | Ga0070713_100116181 | 3300005436 | Bacteria | 2340 |
| 40 | Ga0070713_100121600 | 3300005436 | Bacteria | 2291 |
| 41 | Ga0070713_100215148 | 3300005436 | Bacteria | 1741 |
| 42 | Ga0070713_100286579 | 3300005436 | Bacteria | 1512 |
| 43 | Ga0070710_10006463 | 3300005437 | Bacteria | 5633 |
| 44 | Ga0070710_10021427 | 3300005437 | Bacteria | 3369 |
| 45 | Ga0070710_10098276 | 3300005437 | Bacteria | 1739 |
| 46 | Ga0070711_100001065 | 3300005439 | Bacteria | 14649 |
| 47 | Ga0070711_100010729 | 3300005439 | Bacteria | 5678 |
| 48 | Ga0070711_100321816 | 3300005439 | Bacteria | 1236 |
| 49 | Ga0070708_100363178 | 3300005445 | Bacteria | 1365 |
| 50 | Ga0070663_100023081 | 3300005455 | Bacteria | 4165 |
| 51 | Ga0070663_100329952 | 3300005455 | Bacteria | 1229 |
| 52 | Ga0070678_100031818 | 3300005456 | Bacteria | 3644 |
| 53 | Ga0070678_100042358 | 3300005456 | Bacteria | 3235 |
| 54 | Ga0070678_100318952 | 3300005456 | Bacteria | 1326 |
| 55 | Ga0070662_100163692 | 3300005457 | Bacteria | 1741 |
| 56 | Ga0070681_10130390 | 3300005458 | Bacteria | 2446 |
| 57 | Ga0070681_10135762 | 3300005458 | Bacteria | 2391 |
| 58 | Ga0070706_100143695 | 3300005467 | Bacteria | 2228 |
| 59 | Ga0070707_100037942 | 3300005468 | Bacteria | 4600 |
| 60 | Ga0070698_100283818 | 3300005471 | Bacteria | 1587 |
| 61 | Ga0070679_100160275 | 3300005530 | Bacteria | 2224 |
| 62 | Ga0070684_100009910 | 3300005535 | Bacteria | 7529 |
| 63 | Ga0070684_100032347 | 3300005535 | Bacteria | 4457 |
| 64 | Ga0070697_100061661 | 3300005536 | Bacteria | 3059 |
| 65 | Ga0070697_100100186 | 3300005536 | Bacteria | 2406 |
| 66 | Ga0068853_100178979 | 3300005539 | Bacteria | 1922 |
| 67 | Ga0068853_100188553 | 3300005539 | Bacteria | 1873 |
| 68 | Ga0068853_100275033 | 3300005539 | Bacteria | 1551 |
| 69 | Ga0068853_100782604 | 3300005539 | Bacteria | 913 |
| 70 | Ga0070693_100054174 | 3300005547 | Bacteria | 2305 |
| 71 | Ga0070665_100053304 | 3300005548 | Bacteria | 4056 |
| 72 | Ga0070665_100080605 | 3300005548 | Bacteria | 3261 |
| 73 | Ga0070665_100097774 | 3300005548 | Bacteria | 2940 |
| 74 | Ga0070665_100210330 | 3300005548 | Bacteria | 1946 |
| 75 | Ga0070665_100243303 | 3300005548 | Bacteria | 1799 |
| 76 | Ga0070665_100248399 | 3300005548 | Bacteria | 1780 |
| 77 | Ga0070665_100298908 | 3300005548 | Bacteria | 1612 |
| 78 | Ga0068855_100010142 | 3300005563 | Bacteria | 11353 |
| 79 | Ga0068855_100100282 | 3300005563 | Bacteria | 3334 |
| 80 | Ga0068855_100119566 | 3300005563 | Bacteria | 3016 |
| 81 | Ga0068855_100320690 | 3300005563 | Bacteria | 1713 |
| 82 | Ga0068855_100356840 | 3300005563 | Bacteria | 1609 |
| 83 | Ga0070664_100075491 | 3300005564 | Bacteria | 2895 |
| 84 | Ga0070664_100422469 | 3300005564 | Bacteria | 1221 |
| 85 | Ga0068857_100134758 | 3300005577 | Bacteria | 2230 |
| 86 | Ga0068857_100537861 | 3300005577 | Bacteria | 1100 |
| 87 | Ga0068856_100084211 | 3300005614 | Bacteria | 3158 |
| 88 | Ga0068856_100096878 | 3300005614 | Bacteria | 2939 |
| 89 | Ga0068856_100149968 | 3300005614 | Bacteria | 2340 |
| 90 | Ga0068856_100404812 | 3300005614 | Bacteria | 1384 |
| 91 | Ga0068852_100078071 | 3300005616 | Bacteria | 2929 |
| 92 | Ga0068852_100342278 | 3300005616 | Bacteria | 1458 |
| 93 | Ga0068864_100073721 | 3300005618 | Bacteria | 2976 |
| 94 | Ga0068861_100027741 | 3300005719 | Bacteria | 4128 |
| 95 | Ga0068851_10055833 | 3300005834 | Bacteria | 2013 |
| 96 | Ga0068851_10240303 | 3300005834 | Bacteria | 1024 |
| 97 | Ga0068870_10236031 | 3300005840 | Bacteria | 1127 |
| 98 | Ga0068863_100222523 | 3300005841 | Bacteria | 1819 |
| 99 | Ga0068863_100695341 | 3300005841 | Bacteria | 1010 |
| 100 | Ga0068860_100000101 | 3300005843 | Bacteria | 142856 |
| 101 | Ga0068862_100111617 | 3300005844 | Bacteria | 2400 |
| 102 | Ga0081455_10011564 | 3300005937 | Bacteria | 8858 |
| 103 | Ga0081538_10033376 | 3300005981 | Bacteria | 3428 |
| 104 | Ga0081540_1016848 | 3300005983 | Bacteria | 4551 |
| 105 | Ga0081540_1017020 | 3300005983 | Bacteria | 4518 |
| 106 | Ga0081539_10039335 | 3300005985 | Bacteria | 2792 |
| 107 | Ga0070717_10003637 | 3300006028 | Bacteria | 11057 |
| 108 | Ga0070717_10036762 | 3300006028 | Bacteria | 3973 |
| 109 | Ga0070717_10110378 | 3300006028 | Bacteria | 2345 |
| 110 | Ga0070717_10182680 | 3300006028 | Bacteria | 1829 |
| 111 | Ga0070715_10012718 | 3300006163 | Bacteria | 3072 |
| 112 | Ga0070716_100003831 | 3300006173 | Bacteria | 7138 |
| 113 | Ga0070716_100195616 | 3300006173 | Bacteria | 1340 |
| 114 | Ga0070712_100034259 | 3300006175 | Bacteria | 3440 |
| 115 | Ga0070712_100035835 | 3300006175 | Bacteria | 3371 |
| 116 | Ga0070712_100047302 | 3300006175 | Bacteria | 2977 |
| 117 | Ga0070712_100142349 | 3300006175 | Bacteria | 1832 |
| 118 | Ga0075362_10030838 | 3300006177 | Bacteria | 2316 |
| 119 | Ga0075367_10091566 | 3300006178 | Bacteria | 1850 |
| 120 | Ga0075367_10109936 | 3300006178 | Bacteria | 1691 |
| 121 | Ga0075369_10053052 | 3300006186 | Bacteria | 1758 |
| 122 | Ga0075366_10082877 | 3300006195 | Bacteria | 1916 |
| 123 | Ga0075370_10056629 | 3300006353 | Bacteria | 2228 |
| 124 | Ga0075370_10218362 | 3300006353 | Bacteria | 1126 |
| 125 | Ga0068871_100013006 | 3300006358 | Bacteria | 6165 |
| 126 | Ga0075430_100274245 | 3300006846 | Bacteria | 1396 |
| 127 | Ga0075434_100006666 | 3300006871 | Bacteria | 10600 |
| 128 | Ga0075434_100133722 | 3300006871 | Bacteria | 2500 |
| 129 | Ga0068865_100107794 | 3300006881 | Bacteria | 2049 |
| 130 | Ga0097620_100408070 | 3300006931 | Bacteria | 1454 |
| 131 | Ga0099824_1006668 | 3300006942 | Bacteria | 15714 |
| 132 | Ga0099822_1000663 | 3300006943 | Bacteria | 34548 |
| 133 | Ga0099794_10004750 | 3300007265 | Bacteria | 5382 |
| 134 | Ga0099794_10010664 | 3300007265 | Bacteria | 3908 |
| 135 | Ga0099794_10072307 | 3300007265 | Bacteria | 1690 |
| 136 | Ga0099794_10211785 | 3300007265 | Bacteria | 994 |
| 137 | Ga0099795_10040757 | 3300007788 | Bacteria | 1651 |
| 138 | Ga0105240_10032506 | 3300009093 | Bacteria | 6755 |
| 139 | Ga0105240_10257882 | 3300009093 | Bacteria | 2013 |
| 140 | Ga0105240_10297895 | 3300009093 | Bacteria | 1846 |
| 141 | Ga0111539_10177063 | 3300009094 | Bacteria | 2492 |
| 142 | Ga0105245_10011127 | 3300009098 | Bacteria | 7831 |
| 143 | Ga0105245_10016868 | 3300009098 | Bacteria | 6375 |
| 144 | Ga0105247_10019655 | 3300009101 | Bacteria | 4056 |
| 145 | Ga0105247_10117210 | 3300009101 | Bacteria | 1721 |
| 146 | Ga0105243_10048436 | 3300009148 | Bacteria | 3350 |
| 147 | Ga0105243_10403329 | 3300009148 | Bacteria | 1271 |
| 148 | Ga0105241_10029647 | 3300009174 | Bacteria | 4084 |
| 149 | Ga0105242_10316387 | 3300009176 | Bacteria | 1430 |
| 150 | Ga0105248_10178264 | 3300009177 | Bacteria | 2395 |
| 151 | Ga0105237_10054501 | 3300009545 | Bacteria | 4007 |
| 152 | Ga0105237_10153004 | 3300009545 | Bacteria | 2303 |
| 153 | Ga0105237_10303183 | 3300009545 | Bacteria | 1601 |
| 154 | Ga0105237_10333240 | 3300009545 | Bacteria | 1522 |
| 155 | Ga0105238_10003279 | 3300009551 | Bacteria | 16156 |
| 156 | Ga0105238_10027788 | 3300009551 | Bacteria | 5765 |
| 157 | Ga0105238_10094819 | 3300009551 | Bacteria | 2972 |
| 158 | Ga0105238_10413754 | 3300009551 | Bacteria | 1342 |
| 159 | Ga0105249_10215687 | 3300009553 | Bacteria | 1886 |
| 160 | Ga0105239_10080497 | 3300010375 | Bacteria | 3584 |
| 161 | Ga0105239_10182631 | 3300010375 | Bacteria | 2347 |
| 162 | Ga0105239_11122421 | 3300010375 | Bacteria | 905 |
| 163 | Ga0105246_10066670 | 3300011119 | Bacteria | 2521 |
| 164 | Ga0105246_10200344 | 3300011119 | Bacteria | 1551 |
| 165 | Ga0157373_10039405 | 3300013100 | Bacteria | 3383 |
| 166 | Ga0157370_10013258 | 3300013104 | Bacteria | 8495 |
| 167 | Ga0157370_10261721 | 3300013104 | Bacteria | 1599 |
| 168 | Ga0157369_10014404 | 3300013105 | Bacteria | 8930 |
| 169 | Ga0157369_10402758 | 3300013105 | Bacteria | 1419 |
| 170 | Ga0157369_10611312 | 3300013105 | Bacteria | 1125 |
| 171 | Ga0157374_10041407 | 3300013296 | Bacteria | 4245 |
| 172 | Ga0157374_10441365 | 3300013296 | Bacteria | 1302 |
| 173 | Ga0157378_10194808 | 3300013297 | Bacteria | 1914 |
| 174 | Ga0163162_10031760 | 3300013306 | Bacteria | 5239 |
| 175 | Ga0163162_10122697 | 3300013306 | Bacteria | 2703 |
| 176 | Ga0163162_10369150 | 3300013306 | Bacteria | 1568 |
| 177 | Ga0157372_10083592 | 3300013307 | Bacteria | 3616 |
| 178 | Ga0157375_10008782 | 3300013308 | Bacteria | 8855 |
| 179 | Ga0157375_11032035 | 3300013308 | Bacteria | 961 |
| 180 | Ga0163163_10097774 | 3300014325 | Bacteria | 2956 |
| 181 | Ga0182008_10217802 | 3300014497 | Bacteria | 976 |
| 182 | Ga0157379_10082727 | 3300014968 | Bacteria | 2876 |
| 183 | Ga0157376_10034599 | 3300014969 | Bacteria | 4081 |
| 184 | Ga0213872_10029655 | 3300021361 | Bacteria | 2509 |
| 185 | Ga0213872_10090683 | 3300021361 | Bacteria | 1368 |
| 186 | Ga0213874_10016941 | 3300021377 | Bacteria | 1948 |
| 187 | Ga0213876_10220419 | 3300021384 | Bacteria | 1008 |
| 188 | Ga0213871_10001561 | 3300021441 | Bacteria | 3887 |
| 189 | Ga0209233_1005435 | 3300025261 | Bacteria | 4227 |
| 190 | Ga0209758_1003178 | 3300025297 | Bacteria | 15387 |
| 191 | Ga0209758_1014636 | 3300025297 | Bacteria | 4152 |
| 192 | Ga0207656_10075860 | 3300025321 | Bacteria | 1503 |
| 193 | Ga0207682_10197215 | 3300025893 | Bacteria | 925 |
| 194 | Ga0207692_10063188 | 3300025898 | Bacteria | 1924 |
| 195 | Ga0207642_10031730 | 3300025899 | Bacteria | 2216 |
| 196 | Ga0207642_10041436 | 3300025899 | Bacteria | 2016 |
| 197 | Ga0207710_10121530 | 3300025900 | Bacteria | 1248 |
| 198 | Ga0207710_10266381 | 3300025900 | Bacteria | 860 |
| 199 | Ga0207685_10028399 | 3300025905 | Bacteria | 1970 |
| 200 | Ga0207699_10027370 | 3300025906 | Bacteria | 3156 |
| 201 | Ga0207699_10056996 | 3300025906 | Bacteria | 2332 |
| 202 | Ga0207699_10070555 | 3300025906 | Bacteria | 2133 |
| 203 | Ga0207699_10337654 | 3300025906 | Bacteria | 1061 |
| 204 | Ga0207705_10017157 | 3300025909 | Bacteria | 5186 |
| 205 | Ga0207684_10261364 | 3300025910 | Bacteria | 1494 |
| 206 | Ga0207654_10098056 | 3300025911 | Bacteria | 1800 |
| 207 | Ga0207707_10028363 | 3300025912 | Bacteria | 4893 |
| 208 | Ga0207707_10032980 | 3300025912 | Bacteria | 4533 |
| 209 | Ga0207707_10118799 | 3300025912 | Bacteria | 2310 |
| 210 | Ga0207707_10128284 | 3300025912 | Bacteria | 2218 |
| 211 | Ga0207695_10015132 | 3300025913 | Bacteria | 9101 |
| 212 | Ga0207695_10099178 | 3300025913 | Bacteria | 2911 |
| 213 | Ga0207671_10046204 | 3300025914 | Bacteria | 3221 |
| 214 | Ga0207671_10095419 | 3300025914 | Bacteria | 2246 |
| 215 | Ga0207671_10661420 | 3300025914 | Bacteria | 832 |
| 216 | Ga0207693_10003158 | 3300025915 | Bacteria | 14168 |
| 217 | Ga0207693_10029632 | 3300025915 | Bacteria | 4321 |
| 218 | Ga0207693_10057236 | 3300025915 | Bacteria | 3056 |
| 219 | Ga0207693_10067345 | 3300025915 | Bacteria | 2804 |
| 220 | Ga0207693_10114691 | 3300025915 | Bacteria | 2114 |
| 221 | Ga0207663_10000261 | 3300025916 | Bacteria | 22957 |
| 222 | Ga0207663_10016206 | 3300025916 | Bacteria | 4126 |
| 223 | Ga0207663_10100024 | 3300025916 | Bacteria | 1945 |
| 224 | Ga0207660_10006085 | 3300025917 | Bacteria | 7831 |
| 225 | Ga0207660_10086833 | 3300025917 | Bacteria | 2310 |
| 226 | Ga0207660_10097559 | 3300025917 | Bacteria | 2190 |
| 227 | Ga0207660_10112333 | 3300025917 | Bacteria | 2052 |
| 228 | Ga0207662_10152089 | 3300025918 | Bacteria | 1472 |
| 229 | Ga0207657_10002700 | 3300025919 | Bacteria | 19128 |
| 230 | Ga0207657_10092065 | 3300025919 | Bacteria | 2527 |
| 231 | Ga0207652_10064850 | 3300025921 | Bacteria | 3161 |
| 232 | Ga0207652_10210735 | 3300025921 | Bacteria | 1750 |
| 233 | Ga0207652_10227425 | 3300025921 | Bacteria | 1681 |
| 234 | Ga0207652_10469074 | 3300025921 | Bacteria | 1134 |
| 235 | Ga0207652_10755826 | 3300025921 | Bacteria | 865 |
| 236 | Ga0207646_10222946 | 3300025922 | Bacteria | 1703 |
| 237 | Ga0207681_10115055 | 3300025923 | Bacteria | 1963 |
| 238 | Ga0207694_10030821 | 3300025924 | Bacteria | 4094 |
| 239 | Ga0207694_10084301 | 3300025924 | Bacteria | 2500 |
| 240 | Ga0207694_10116430 | 3300025924 | Bacteria | 2130 |
| 241 | Ga0207694_10162284 | 3300025924 | Bacteria | 1806 |
| 242 | Ga0207687_10082362 | 3300025927 | Bacteria | 2328 |
| 243 | Ga0207700_10005839 | 3300025928 | Bacteria | 7395 |
| 244 | Ga0207700_10040740 | 3300025928 | Bacteria | 3392 |
| 245 | Ga0207700_10056073 | 3300025928 | Bacteria | 2965 |
| 246 | Ga0207700_10102973 | 3300025928 | Bacteria | 2281 |
| 247 | Ga0207700_10164232 | 3300025928 | Bacteria | 1846 |
| 248 | Ga0207700_10178218 | 3300025928 | Bacteria | 1778 |
| 249 | Ga0207664_10063952 | 3300025929 | Bacteria | 2941 |
| 250 | Ga0207664_10246784 | 3300025929 | Bacteria | 1556 |
| 251 | Ga0207664_10317121 | 3300025929 | Bacteria | 1375 |
| 252 | Ga0207664_10351326 | 3300025929 | Bacteria | 1305 |
| 253 | Ga0207644_10074360 | 3300025931 | Bacteria | 2494 |
| 254 | Ga0207706_10172639 | 3300025933 | Bacteria | 1900 |
| 255 | Ga0207686_10083003 | 3300025934 | Bacteria | 2096 |
| 256 | Ga0207669_10209159 | 3300025937 | Bacteria | 1422 |
| 257 | Ga0207704_10360061 | 3300025938 | Bacteria | 1135 |
| 258 | Ga0207665_10000280 | 3300025939 | Bacteria | 35528 |
| 259 | Ga0207665_10025582 | 3300025939 | Bacteria | 3895 |
| 260 | Ga0207665_10122152 | 3300025939 | Bacteria | 1841 |
| 261 | Ga0207691_10075400 | 3300025940 | Bacteria | 3041 |
| 262 | Ga0207691_10198491 | 3300025940 | Bacteria | 1747 |
| 263 | Ga0207689_10074481 | 3300025942 | Bacteria | 2790 |
| 264 | Ga0207661_10000532 | 3300025944 | Bacteria | 24432 |
| 265 | Ga0207661_10002592 | 3300025944 | Bacteria | 12429 |
| 266 | Ga0207661_10256249 | 3300025944 | Bacteria | 1557 |
| 267 | Ga0207679_10076779 | 3300025945 | Bacteria | 2539 |
| 268 | Ga0207679_10151350 | 3300025945 | Bacteria | 1889 |
| 269 | Ga0207679_10554811 | 3300025945 | Bacteria | 1031 |
| 270 | Ga0207667_10010882 | 3300025949 | Bacteria | 10609 |
| 271 | Ga0207667_10027486 | 3300025949 | Bacteria | 6191 |
| 272 | Ga0207712_10095142 | 3300025961 | Bacteria | 2202 |
| 273 | Ga0207668_10045470 | 3300025972 | Bacteria | 2994 |
| 274 | Ga0207677_10080989 | 3300026023 | Bacteria | 2328 |
| 275 | Ga0207677_10862502 | 3300026023 | Bacteria | 814 |
| 276 | Ga0207703_10053309 | 3300026035 | Bacteria | 3287 |
| 277 | Ga0207639_10106811 | 3300026041 | Bacteria | 2273 |
| 278 | Ga0207639_10134900 | 3300026041 | Bacteria | 2048 |
| 279 | Ga0207639_10226902 | 3300026041 | Bacteria | 1616 |
| 280 | Ga0207678_10041308 | 3300026067 | Bacteria | 3999 |
| 281 | Ga0207678_10089150 | 3300026067 | Bacteria | 2636 |
| 282 | Ga0207678_10545651 | 3300026067 | Bacteria | 1014 |
| 283 | Ga0207678_10617478 | 3300026067 | Bacteria | 951 |
| 284 | Ga0207708_10072759 | 3300026075 | Bacteria | 2634 |
| 285 | Ga0207708_10159047 | 3300026075 | Bacteria | 1783 |
| 286 | Ga0207702_10047033 | 3300026078 | Bacteria | 3634 |
| 287 | Ga0207702_10203546 | 3300026078 | Bacteria | 1836 |
| 288 | Ga0207676_10070281 | 3300026095 | Bacteria | 2807 |
| 289 | Ga0207676_10123771 | 3300026095 | Bacteria | 2185 |
| 290 | Ga0207674_10032600 | 3300026116 | Bacteria | 5463 |
| 291 | Ga0207674_10565833 | 3300026116 | Bacteria | 1098 |
| 292 | Ga0207675_100024689 | 3300026118 | Bacteria | 5590 |
| 293 | Ga0207675_100062798 | 3300026118 | Bacteria | 3470 |
| 294 | Ga0207675_100160430 | 3300026118 | Bacteria | 2144 |
| 295 | Ga0207675_100244314 | 3300026118 | Bacteria | 1735 |
| 296 | Ga0207683_10019717 | 3300026121 | Bacteria | 5762 |
| 297 | Ga0207683_10160370 | 3300026121 | Bacteria | 2033 |
| 298 | Ga0207698_10017361 | 3300026142 | Bacteria | 4879 |
| 299 | Ga0207698_10150001 | 3300026142 | Bacteria | 2022 |
| 300 | Ga0207698_10464639 | 3300026142 | Bacteria | 1224 |
| 301 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 302 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 303 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 304 | Ga0209588_1000499 | 3300027671 | Bacteria | 10047 |
| 305 | Ga0268266_10016781 | 3300028379 | Bacteria | 6259 |
| 306 | Ga0268266_10241277 | 3300028379 | Bacteria | 1668 |
| 307 | Ga0268266_10344904 | 3300028379 | Bacteria | 1398 |
| 308 | Ga0268265_10052898 | 3300028380 | Bacteria | 3073 |
| 309 | Ga0268265_10084226 | 3300028380 | Bacteria | 2520 |
| 310 | Ga0268265_10182911 | 3300028380 | Bacteria | 1802 |
| 311 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 312 | Ga0268264_10159718 | 3300028381 | Bacteria | 2029 |
| 313 | Ga0307517_10000744 | 3300028786 | Bacteria | 56253 |
| 314 | Ga0307515_10088090 | 3300028794 | Bacteria | 3929 |
| 315 | Ga0265330_10006427 | 3300031235 | Bacteria | 5809 |
| 316 | Ga0265330_10009777 | 3300031235 | Bacteria | 4544 |
| 317 | Ga0265328_10080780 | 3300031239 | Bacteria | 1198 |
| 318 | Ga0265340_10023276 | 3300031247 | Bacteria | 3160 |
| 319 | Ga0265340_10026436 | 3300031247 | Bacteria | 2934 |
| 320 | Ga0265339_10009136 | 3300031249 | Bacteria | 6257 |
| 321 | Ga0265339_10011293 | 3300031249 | Bacteria | 5508 |
| 322 | Ga0265331_10074521 | 3300031250 | Bacteria | 1584 |
| 323 | Ga0307513_10296943 | 3300031456 | Bacteria | 1384 |
| 324 | Ga0307509_10079363 | 3300031507 | Bacteria | 3397 |
| 325 | Ga0307508_10000051 | 3300031616 | Bacteria | 134500 |
| 326 | Ga0307508_10232304 | 3300031616 | Bacteria | 1442 |
| 327 | Ga0265314_10078319 | 3300031711 | Bacteria | 2189 |
| 328 | Ga0265342_10017850 | 3300031712 | Bacteria | 4606 |
| 329 | Ga0265342_10092712 | 3300031712 | Bacteria | 1730 |
| 330 | Ga0307516_10029187 | 3300031730 | Bacteria | 5577 |
| 331 | Ga0307410_10173039 | 3300031852 | Bacteria | 1629 |
| 332 | Ga0307406_10195330 | 3300031901 | Bacteria | 1485 |
| 333 | Ga0307412_10204522 | 3300031911 | Bacteria | 1502 |
| 334 | Ga0307411_10091699 | 3300032005 | Bacteria | 2123 |
| 335 | Ga0307415_100028863 | 3300032126 | Bacteria | 3537 |
| 336 | Ga0307507_10007677 | 3300033179 | Bacteria | 15449 |
| 337 | Ga0307510_10024689 | 3300033180 | Bacteria | 6943 |
| 338 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 339 | Ga0316215_1000756 | 3300033544 | Bacteria | 3282 |
| 340 | Ga0373926_0007807 | 3300035083 | Bacteria | 3564 |
| 341 | Ga0373934_0000907 | 3300035086 | Bacteria | 10705 |
| 342 | Ga0373944_0026229 | 3300035089 | Bacteria | 1720 |
| 343 | Ga0373923_0002765 | 3300035111 | Bacteria | 5481 |
| 344 | Ga0373936_0011613 | 3300035113 | Bacteria | 3340 |
| 345 | Ga0373936_0022195 | 3300035113 | Bacteria | 2472 |
| 346 | Ga0373945_0051470 | 3300035116 | Bacteria | 1515 |
| 347 | Ga0373953_0016673 | 3300035117 | Bacteria | 2686 |
| 348 | Ga0373953_0073895 | 3300035117 | Bacteria | 1410 |
| 349 | Ga0373954_0007936 | 3300035118 | Bacteria | 4650 |
| 350 | Ga0373954_0040759 | 3300035118 | Bacteria | 2164 |
| 351 | Ga0373954_0050887 | 3300035118 | Bacteria | 1944 |
| 352 | Ga0373954_0103775 | 3300035118 | Bacteria | 1372 |
| 353 | Ga0373956_0081619 | 3300035119 | Bacteria | 1484 |
| 354 | Ga0373957_0067375 | 3300035120 | Bacteria | 1395 |
| 355 | Ga0373943_0016035 | 3300035170 | Bacteria | 3412 |
| 356 | Ga0373943_0051712 | 3300035170 | Bacteria | 2024 |
| 357 | Ga0373943_0083857 | 3300035170 | Bacteria | 1639 |
| 358 | Ga0373943_0140326 | 3300035170 | Bacteria | 1301 |
| 359 | Ga0373946_0154492 | 3300035171 | Bacteria | 1073 |
| 360 | Ga0373955_0040004 | 3300035172 | Bacteria | 2505 |
| 361 | Ga0373955_0058865 | 3300035172 | Bacteria | 2114 |
| 362 | Ga0373955_0142564 | 3300035172 | Bacteria | 1406 |
| 363 | Ga0373924_0003083 | 3300035410 | Bacteria | 5689 |
| 364 | Ga0373924_0022158 | 3300035410 | Bacteria | 2482 |
| 365 | Ga0373924_0091753 | 3300035410 | Bacteria | 1300 |
| 366 | Ga0373931_0349001 | 3300035691 | Bacteria | 926 |
| 367 | Ga0373935_0035466 | 3300035692 | Bacteria | 3114 |
| 368 | Ga0373935_0131415 | 3300035692 | Bacteria | 1682 |
| 369 | Ga0373927_0013792 | 3300035695 | Bacteria | 5364 |
| 370 | Ga0373927_0014122 | 3300035695 | Bacteria | 5296 |
| 371 | Ga0373927_0021149 | 3300035695 | Bacteria | 4262 |
| 372 | Ga0373927_0086692 | 3300035695 | Bacteria | 2032 |
| 373 | Ga0373927_0087324 | 3300035695 | Bacteria | 2024 |
| 374 | Ga0373927_0143422 | 3300035695 | Bacteria | 1563 |
| 375 | Ga0373927_0154369 | 3300035695 | Bacteria | 1503 |
| 376 | Ga0373927_0170553 | 3300035695 | Bacteria | 1426 |
| 377 | Ga0373933_0007801 | 3300035724 | Bacteria | 5847 |
| 378 | Ga0373947_0010871 | 3300035725 | Bacteria | 5224 |
| 379 | Ga0373947_0014913 | 3300035725 | Bacteria | 4460 |
| 380 | Ga0373947_0015785 | 3300035725 | Bacteria | 4337 |
| 381 | Ga0373947_0047088 | 3300035725 | Bacteria | 2583 |
| 382 | Ga0373947_0569474 | 3300035725 | Bacteria | 771 |
| 383 | Ga0373937_0014045 | 3300036401 | Bacteria | 7062 |
| 384 | Ga0373937_0024360 | 3300036401 | Bacteria | 5457 |
| 385 | Ga0373937_0668975 | 3300036401 | Bacteria | 984 |
| 386 | Ga0372808_002808 | 3300036459 | Bacteria | 2060 |
| 387 | Ga0373925_0029763 | 3300037068 | Bacteria | 4006 |
| 388 | Ga0373925_0048085 | 3300037068 | Bacteria | 3177 |
| 389 | Ga0373925_0054307 | 3300037068 | Bacteria | 2996 |
| 390 | Ga0395899_0283966 | 3300037312 | Bacteria | 1125 |
| 391 | Ga0395900_0007637 | 3300037418 | Bacteria | 11163 |
| 392 | Ga0395900_0114406 | 3300037418 | Bacteria | 2769 |
| 393 | Ga0395900_0400035 | 3300037418 | Bacteria | 1338 |
| 394 | Ga0395898_0025630 | 3300037466 | Bacteria | 5940 |
| 395 | Ga0395898_0032258 | 3300037466 | Bacteria | 5228 |
| 396 | Ga0395905_0082234 | 3300037471 | Bacteria | 3018 |
| 397 | Ga0436364_1423996 | 3300037853 | Bacteria | 5123 |
| 398 | Ga0395901_0136742 | 3300038443 | Bacteria | 2575 |
| 399 | Ga0395901_0228139 | 3300038443 | Bacteria | 1945 |
| 400 | Ga0395901_0242841 | 3300038443 | Bacteria | 1878 |
| 401 | Ga0395901_0578620 | 3300038443 | Bacteria | 1135 |
| 402 | Ga0436365_0615168 | 3300039437 | Bacteria | 1018 |
| 403 | Ga0436365_1781661 | 3300039437 | Bacteria | 1790 |
| 404 | Ga0436365_1883906 | 3300039437 | Bacteria | 1355 |
| 405 | Ga0436360_0770248 | 3300039438 | Bacteria | 2660 |
| 406 | Ga0436360_1259955 | 3300039438 | Bacteria | 1083 |
| 407 | Ga0436361_0128647 | 3300039447 | Bacteria | 2492 |
| 408 | Ga0436363_1067356 | 3300039450 | Bacteria | 5627 |
| 409 | Ga0439465_0021320 | 3300041413 | Bacteria | 2031 |
| 410 | Ga0439465_0038196 | 3300041413 | Bacteria | 1546 |
| 411 | Ga0451853_0502755 | 3300041512 | Bacteria | 1857 |
| 412 | Ga0466961_0179080 | 3300044693 | Bacteria | 1316 |
| 413 | Ga0466970_0081668 | 3300044765 | Bacteria | 1748 |
| 414 | Ga0466957_0026170 | 3300044842 | Bacteria | 3460 |
| 415 | Ga0466967_0098515 | 3300045976 | Bacteria | 2669 |
| 416 | Ga0466967_0181087 | 3300045976 | Bacteria | 1988 |
| 417 | Ga0466967_0229819 | 3300045976 | Bacteria | 1766 |
| 418 | Ga0495592_0012012 | 3300046454 | Bacteria | 6562 |
| 419 | Ga0495592_0013641 | 3300046454 | Bacteria | 6180 |
| 420 | Ga0495603_0003046 | 3300046455 | Bacteria | 9937 |
| 421 | Ga0495603_0011007 | 3300046455 | Bacteria | 5487 |
| 422 | Ga0495603_0013820 | 3300046455 | Bacteria | 4886 |
| 423 | Ga0495603_0068579 | 3300046455 | Bacteria | 2087 |
| 424 | Ga0495629_0000439 | 3300046459 | Bacteria | 34692 |
| 425 | Ga0495629_0000957 | 3300046459 | Bacteria | 23286 |
| 426 | Ga0495629_0030921 | 3300046459 | Bacteria | 3793 |
| 427 | Ga0495651_0019087 | 3300046462 | Bacteria | 5313 |
| 428 | Ga0495653_0080143 | 3300046463 | Bacteria | 2416 |
| 429 | Ga0495580_0022668 | 3300046472 | Bacteria | 4617 |
| 430 | Ga0495580_0090574 | 3300046472 | Bacteria | 2129 |
| 431 | Ga0495580_0549782 | 3300046472 | Bacteria | 767 |
| 432 | Ga0495582_0003251 | 3300046473 | Bacteria | 9124 |
| 433 | Ga0495582_0020537 | 3300046473 | Bacteria | 3616 |
| 434 | Ga0495582_0212507 | 3300046473 | Bacteria | 1106 |
| 435 | Ga0495639_0006764 | 3300046475 | Bacteria | 4931 |
| 436 | Ga0495639_0051304 | 3300046475 | Bacteria | 1875 |
| 437 | Ga0495662_0011192 | 3300046476 | Bacteria | 4385 |
| 438 | Ga0495662_0022869 | 3300046476 | Bacteria | 3017 |
| 439 | Ga0495664_0014457 | 3300046477 | Bacteria | 4475 |
| 440 | Ga0495664_0018231 | 3300046477 | Bacteria | 4018 |
| 441 | Ga0495664_0025032 | 3300046477 | Bacteria | 3473 |
| 442 | Ga0495664_0057675 | 3300046477 | Bacteria | 2310 |
| 443 | Ga0495664_0117847 | 3300046477 | Bacteria | 1605 |
| 444 | Ga0495585_0116922 | 3300046492 | Bacteria | 1414 |
| 445 | Ga0495608_0009342 | 3300046511 | Bacteria | 6855 |
| 446 | Ga0495608_0068668 | 3300046511 | Bacteria | 2317 |
| 447 | Ga0495616_0158056 | 3300046513 | Bacteria | 1021 |
| 448 | Ga0495618_0004727 | 3300046514 | Bacteria | 8329 |
| 449 | Ga0495618_0055842 | 3300046514 | Bacteria | 2500 |
| 450 | Ga0495628_0009529 | 3300046516 | Bacteria | 8290 |
| 451 | Ga0495628_0052614 | 3300046516 | Bacteria | 3216 |
| 452 | Ga0495630_0072137 | 3300046517 | Bacteria | 2599 |
| 453 | Ga0495630_0204690 | 3300046517 | Bacteria | 1506 |
| 454 | Ga0495630_0442117 | 3300046517 | Bacteria | 996 |
| 455 | Ga0495631_0106413 | 3300046518 | Bacteria | 1206 |
| 456 | Ga0495644_0035488 | 3300046523 | Bacteria | 1883 |
| 457 | Ga0495644_0071767 | 3300046523 | Bacteria | 1301 |
| 458 | Ga0495666_0017968 | 3300046526 | Bacteria | 3522 |
| 459 | Ga0495666_0044605 | 3300046526 | Bacteria | 2140 |
| 460 | Ga0495652_0034465 | 3300046529 | Bacteria | 4411 |
| 461 | Ga0495652_0042026 | 3300046529 | Bacteria | 3942 |
| 462 | Ga0495652_0042477 | 3300046529 | Bacteria | 3920 |
| 463 | Ga0495652_0143257 | 3300046529 | Bacteria | 1877 |
| 464 | Ga0495665_0005732 | 3300046531 | Bacteria | 6703 |
| 465 | Ga0495665_0009314 | 3300046531 | Bacteria | 5318 |
| 466 | Ga0495665_0141139 | 3300046531 | Bacteria | 1259 |
| 467 | Ga0495640_0001232 | 3300046533 | Bacteria | 20045 |
| 468 | Ga0495640_0015529 | 3300046533 | Bacteria | 5727 |
| 469 | Ga0495640_0032451 | 3300046533 | Bacteria | 3720 |
| 470 | Ga0495640_0160191 | 3300046533 | Bacteria | 1442 |
| 471 | Ga0495586_0040423 | 3300046535 | Bacteria | 2509 |
| 472 | Ga0495587_0013476 | 3300046536 | Bacteria | 5137 |
| 473 | Ga0495587_0092079 | 3300046536 | Bacteria | 1750 |
| 474 | Ga0495609_0071925 | 3300046538 | Bacteria | 1519 |
| 475 | Ga0495621_0025425 | 3300046539 | Bacteria | 1989 |
| 476 | Ga0495645_0007838 | 3300046543 | Bacteria | 7432 |
| 477 | Ga0495645_0031972 | 3300046543 | Bacteria | 3837 |
| 478 | Ga0495622_0025591 | 3300046557 | Bacteria | 2756 |
| 479 | Ga0495667_0003416 | 3300046559 | Bacteria | 10642 |
| 480 | Ga0495667_0021483 | 3300046559 | Bacteria | 4356 |
| 481 | Ga0495667_0027235 | 3300046559 | Bacteria | 3853 |
| 482 | Ga0495667_0105989 | 3300046559 | Bacteria | 1817 |
| 483 | Ga0495667_0204346 | 3300046559 | Bacteria | 1263 |
| 484 | Ga0495668_0029805 | 3300046616 | Bacteria | 3083 |
| 485 | Ga0495634_0019547 | 3300046642 | Bacteria | 4812 |
| 486 | Ga0495611_0047528 | 3300046648 | Bacteria | 1926 |
| 487 | Ga0495611_0086703 | 3300046648 | Bacteria | 1444 |
| 488 | Ga0495625_0094620 | 3300046660 | Bacteria | 2061 |
| 489 | Ga0495635_0009930 | 3300046663 | Bacteria | 6653 |
| 490 | Ga0495635_0027261 | 3300046663 | Bacteria | 3974 |
| 491 | Ga0495635_0087696 | 3300046663 | Bacteria | 2129 |
| 492 | Ga0495635_0111512 | 3300046663 | Bacteria | 1868 |
| 493 | Ga0495635_0121454 | 3300046663 | Bacteria | 1782 |
| 494 | Ga0495659_0026482 | 3300046664 | Bacteria | 1993 |
| 495 | Ga0495588_0129327 | 3300046674 | Bacteria | 1332 |
| 496 | Ga0495657_0018194 | 3300046675 | Bacteria | 5090 |
| 497 | Ga0495599_0001369 | 3300046678 | Bacteria | 13928 |
| 498 | Ga0495599_0005440 | 3300046678 | Bacteria | 7612 |
| 499 | Ga0495599_0213937 | 3300046678 | Bacteria | 1181 |
| 500 | Ga0495646_0025605 | 3300046680 | Bacteria | 3711 |
| 501 | Ga0495646_0028973 | 3300046680 | Bacteria | 3464 |
| 502 | Ga0495647_0019993 | 3300046681 | Bacteria | 2400 |
| 503 | Ga0495669_0004668 | 3300046684 | Bacteria | 5679 |
| 504 | Ga0495613_0022008 | 3300046689 | Bacteria | 4753 |
| 505 | Ga0495613_0081708 | 3300046689 | Bacteria | 2347 |
| 506 | Ga0495624_0171663 | 3300046690 | Bacteria | 1323 |
| 507 | Ga0495624_0285742 | 3300046690 | Bacteria | 996 |
| 508 | Ga0495600_0001020 | 3300046809 | Bacteria | 15122 |
| 509 | Ga0495600_0035995 | 3300046809 | Bacteria | 3217 |
| 510 | Ga0495600_0098171 | 3300046809 | Bacteria | 1909 |
| 511 | Ga0495581_0000019 | 3300047315 | Bacteria | 57810 |
| 512 | Ga0495604_0244650 | 3300047317 | Bacteria | 1225 |
| 513 | Ga0495674_0000458 | 3300047319 | Bacteria | 36828 |
| 514 | Ga0495674_0009039 | 3300047319 | Bacteria | 9465 |
| 515 | Ga0495674_0064351 | 3300047319 | Bacteria | 3188 |
| 516 | Ga0495674_0110158 | 3300047319 | Bacteria | 2335 |
| 517 | Ga0495674_0122742 | 3300047319 | Bacteria | 2194 |
| 518 | Ga0495672_0073410 | 3300047320 | Bacteria | 1929 |
| 519 | Ga0495680_0013039 | 3300047322 | Bacteria | 7270 |
| 520 | Ga0495680_0015630 | 3300047322 | Bacteria | 6542 |
| 521 | Ga0495675_0080493 | 3300047444 | Bacteria | 2051 |
| 522 | Ga0495675_0088933 | 3300047444 | Bacteria | 1939 |
| 523 | Ga0495673_0082853 | 3300047469 | Bacteria | 1325 |
| 524 | Ga0495684_0007607 | 3300047471 | Bacteria | 8383 |
| 525 | Ga0495684_0011461 | 3300047471 | Bacteria | 6847 |
| 526 | Ga0495593_0000687 | 3300047673 | Bacteria | 19500 |
| 527 | Ga0495593_0079891 | 3300047673 | Bacteria | 1693 |
| 528 | Ga0495593_0124640 | 3300047673 | Bacteria | 1310 |
| 529 | Ga0495602_0118820 | 3300048088 | Bacteria | 2131 |
| 530 | Ga0495602_0173768 | 3300048088 | Bacteria | 1669 |
| 531 | Ga0495602_0314863 | 3300048088 | Bacteria | 1141 |
| 532 | Ga0495602_0626143 | 3300048088 | Bacteria | 737 |
| 533 | Ga0496100_0015649 | 3300048903 | Bacteria | 4433 |
| 534 | Ga0496100_0092825 | 3300048903 | Bacteria | 2064 |
| 535 | Ga0496100_0205623 | 3300048903 | Bacteria | 1437 |
| 536 | Ga0496101_0004392 | 3300048904 | Bacteria | 8864 |
| 537 | Ga0496101_0043859 | 3300048904 | Bacteria | 3198 |
| 538 | Ga0496101_0194526 | 3300048904 | Bacteria | 1566 |
| 539 | Ga0496101_0584126 | 3300048904 | Bacteria | 883 |
| 540 | Ga0496102_0013777 | 3300048905 | Bacteria | 7013 |
| 541 | Ga0496102_0052436 | 3300048905 | Bacteria | 3717 |
| 542 | Ga0496102_0112622 | 3300048905 | Bacteria | 2538 |
| 543 | Ga0496102_0113133 | 3300048905 | Bacteria | 2532 |
| 544 | Ga0496103_0237018 | 3300048906 | Bacteria | 1174 |
| 545 | Ga0496103_0361053 | 3300048906 | Bacteria | 934 |
| 546 | Ga0496104_0041945 | 3300048907 | Bacteria | 4291 |
| 547 | Ga0496104_0246531 | 3300048907 | Bacteria | 1699 |
| 548 | Ga0496104_0405554 | 3300048907 | Bacteria | 1275 |
| 549 | Ga0496106_0000740 | 3300048909 | Bacteria | 23552 |
| 550 | Ga0496106_0018748 | 3300048909 | Bacteria | 5124 |
| 551 | Ga0496106_0019707 | 3300048909 | Bacteria | 5002 |
| 552 | Ga0496106_0296176 | 3300048909 | Bacteria | 1297 |
| 553 | Ga0496106_0494628 | 3300048909 | Bacteria | 982 |
| 554 | Ga0496107_0002930 | 3300048910 | Bacteria | 11282 |
| 555 | Ga0496107_0004783 | 3300048910 | Bacteria | 9200 |
| 556 | Ga0496107_0033894 | 3300048910 | Bacteria | 3655 |
| 557 | Ga0496107_0090860 | 3300048910 | Bacteria | 2231 |
| 558 | Ga0496108_0000938 | 3300048911 | Bacteria | 22748 |
| 559 | Ga0496108_0199011 | 3300048911 | Bacteria | 1738 |
| 560 | Ga0496109_0000977 | 3300048912 | Bacteria | 23646 |
| 561 | Ga0496109_0200987 | 3300048912 | Bacteria | 1873 |
| 562 | Ga0496109_0224879 | 3300048912 | Bacteria | 1765 |
| 563 | Ga0496110_0003174 | 3300048913 | Bacteria | 12507 |
| 564 | Ga0496110_0147094 | 3300048913 | Bacteria | 2132 |
| 565 | Ga0496110_0272332 | 3300048913 | Bacteria | 1541 |
| 566 | Ga0496111_0043521 | 3300048914 | Bacteria | 3227 |
| 567 | Ga0496111_0330929 | 3300048914 | Bacteria | 1128 |
| 568 | Ga0496112_0000590 | 3300048915 | Bacteria | 24921 |
| 569 | Ga0496112_0067674 | 3300048915 | Bacteria | 3525 |
| 570 | Ga0496112_0070093 | 3300048915 | Bacteria | 3464 |
| 571 | Ga0496112_0310661 | 3300048915 | Bacteria | 1521 |
| 572 | Ga0496113_0014433 | 3300048916 | Bacteria | 5389 |
| 573 | Ga0496113_0080348 | 3300048916 | Bacteria | 2497 |
| 574 | Ga0496113_0484088 | 3300048916 | Bacteria | 994 |
| 575 | Ga0496114_0236009 | 3300048917 | Bacteria | 1607 |
| 576 | Ga0496115_0003730 | 3300048918 | Bacteria | 10956 |
| 577 | Ga0496115_0034314 | 3300048918 | Bacteria | 4010 |
| 578 | Ga0496117_0005455 | 3300048920 | Bacteria | 13342 |
| 579 | Ga0496118_0001758 | 3300048921 | Bacteria | 31406 |
| 580 | Ga0496119_0040839 | 3300048922 | Bacteria | 2962 |
| 581 | Ga0496119_0047723 | 3300048922 | Bacteria | 2662 |
| 582 | Ga0496119_0192163 | 3300048922 | Bacteria | 1063 |
| 583 | Ga0496121_0000089 | 3300048924 | Bacteria | 219007 |
| 584 | Ga0496121_0000379 | 3300048924 | Bacteria | 91131 |
| 585 | Ga0496121_0004013 | 3300048924 | Bacteria | 20280 |
| 586 | Ga0496121_0027921 | 3300048924 | Bacteria | 5271 |
| 587 | Ga0496121_0064256 | 3300048924 | Bacteria | 2993 |
| 588 | Ga0496121_0143040 | 3300048924 | Bacteria | 1771 |
| 589 | Ga0496121_0145075 | 3300048924 | Bacteria | 1755 |
| 590 | Ga0496121_0150606 | 3300048924 | Bacteria | 1712 |
| 591 | Ga0496121_0150845 | 3300048924 | Bacteria | 1710 |
| 592 | Ga0496122_0063008 | 3300048925 | Bacteria | 2710 |
| 593 | Ga0496123_0125075 | 3300048926 | Bacteria | 1437 |
| 594 | Ga0496124_0001073 | 3300048927 | Bacteria | 43225 |
| 595 | Ga0496124_0174267 | 3300048927 | Bacteria | 1662 |
| 596 | Ga0496125_0000199 | 3300048928 | Bacteria | 126676 |
| 597 | Ga0496125_0000964 | 3300048928 | Bacteria | 45175 |
| 598 | Ga0496125_0088892 | 3300048928 | Bacteria | 2326 |
| 599 | Ga0496126_0036354 | 3300048929 | Bacteria | 4605 |
| 600 | Ga0496126_0038119 | 3300048929 | Bacteria | 4474 |
| 601 | Ga0496126_0046484 | 3300048929 | Bacteria | 3980 |
| 602 | Ga0496126_0046563 | 3300048929 | Bacteria | 3976 |
| 603 | Ga0496126_0097347 | 3300048929 | Bacteria | 2579 |
| 604 | Ga0496126_0126845 | 3300048929 | Bacteria | 2208 |
| 605 | Ga0496126_0138554 | 3300048929 | Bacteria | 2096 |
| 606 | Ga0496126_0159847 | 3300048929 | Bacteria | 1926 |
| 607 | Ga0496126_0169071 | 3300048929 | Bacteria | 1864 |
| 608 | Ga0496126_0183917 | 3300048929 | Bacteria | 1773 |
| 609 | Ga0496126_0190677 | 3300048929 | Bacteria | 1736 |
| 610 | Ga0495678_071311 | 3300049459 | Bacteria | 1273 |
| 611 | Ga0501032_0081894 | 3300049569 | Bacteria | 2147 |
| 612 | Ga0501034_0209385 | 3300049571 | Bacteria | 1905 |
| 613 | Ga0501036_0051917 | 3300049572 | Bacteria | 3472 |
| 614 | Ga0501036_0413587 | 3300049572 | Bacteria | 1125 |
| 615 | Ga0501037_0020258 | 3300049573 | Bacteria | 4911 |
| 616 | Ga0501037_0060414 | 3300049573 | Bacteria | 2764 |
| 617 | Ga0501037_0271825 | 3300049573 | Bacteria | 1182 |
| 618 | Ga0501038_0003168 | 3300049574 | Bacteria | 15342 |
| 619 | Ga0501038_0013686 | 3300049574 | Bacteria | 7393 |
| 620 | Ga0501038_0047759 | 3300049574 | Bacteria | 3707 |
| 621 | Ga0501038_0348908 | 3300049574 | Bacteria | 1153 |
| 622 | Ga0501039_0084531 | 3300049575 | Bacteria | 2471 |
| 623 | Ga0501039_0186473 | 3300049575 | Bacteria | 1631 |
| 624 | Ga0501041_0041190 | 3300049577 | Bacteria | 2805 |
| 625 | Ga0501042_0003280 | 3300049578 | Bacteria | 10124 |
| 626 | Ga0501042_0271419 | 3300049578 | Bacteria | 1225 |
| 627 | Ga0501043_0039322 | 3300049579 | Bacteria | 3717 |
| 628 | Ga0501043_0051727 | 3300049579 | Bacteria | 3228 |
| 629 | Ga0501043_0127714 | 3300049579 | Bacteria | 1993 |
| 630 | Ga0501046_0185115 | 3300049580 | Bacteria | 1555 |
| 631 | Ga0501047_0064889 | 3300049581 | Bacteria | 3521 |
| 632 | Ga0501047_0319027 | 3300049581 | Bacteria | 1394 |
| 633 | Ga0501067_0051336 | 3300049583 | Bacteria | 2286 |
| 634 | Ga0501068_0002163 | 3300049584 | Bacteria | 10474 |
| 635 | Ga0501071_0150775 | 3300049587 | Bacteria | 1734 |
| 636 | Ga0501071_0213616 | 3300049587 | Bacteria | 1451 |
| 637 | Ga0501073_0169581 | 3300049589 | Bacteria | 1511 |
| 638 | Ga0501074_0011129 | 3300049590 | Bacteria | 6534 |
| 639 | Ga0501074_0247647 | 3300049590 | Bacteria | 1267 |
| 640 | Ga0501076_0024085 | 3300049592 | Bacteria | 4702 |
| 641 | Ga0501077_0022001 | 3300049593 | Bacteria | 4038 |
| 642 | Ga0501080_0066728 | 3300049742 | Bacteria | 3346 |
| 643 | Ga0501080_0177440 | 3300049742 | Bacteria | 1962 |
| 644 | Ga0501080_0219875 | 3300049742 | Bacteria | 1738 |
| 645 | Ga0501080_0295717 | 3300049742 | Bacteria | 1469 |
| 646 | Ga0501035_0017052 | 3300049822 | Bacteria | 6692 |
| 647 | Ga0501035_0088576 | 3300049822 | Bacteria | 2727 |
| 648 | Ga0501044_0098065 | 3300049823 | Bacteria | 2951 |
| 649 | Ga0501044_0109545 | 3300049823 | Bacteria | 2770 |
| 650 | Ga0501044_0181161 | 3300049823 | Bacteria | 2073 |
| 651 | nmdc:mga00v17_89867_c1 | 3300050491 | Bacteria | 1928 |
| 652 | nmdc:mga0k408_45189_c1 | 3300050493 | Bacteria | 2541 |
| 653 | nmdc:mga0k408_77948_c1 | 3300050493 | Bacteria | 1938 |
| 654 | nmdc:mga06z11_282780_c1 | 3300050494 | Bacteria | 983 |
| 655 | nmdc:mga06z11_407666_c1 | 3300050494 | Bacteria | 819 |
| 656 | nmdc:mga06z11_86843_c1 | 3300050494 | Bacteria | 1690 |
| 657 | nmdc:mga07m45_46230_c1 | 3300050496 | Bacteria | 2445 |
| 658 | nmdc:mga08y16_136202_c1 | 3300050511 | Bacteria | 2552 |
| 659 | nmdc:mga0n895_18842_c1 | 3300050512 | Bacteria | 6398 |
| 660 | nmdc:mga0rr50_174308_c1 | 3300050513 | Bacteria | 1754 |
| 661 | nmdc:mga08x19_253571_c1 | 3300050514 | Bacteria | 1215 |
| 662 | nmdc:mga0a205_376832_c1 | 3300050515 | Bacteria | 1284 |
| 663 | Ga0495601_0031878 | 3300053077 | Bacteria | 3277 |
| 664 | Ga0495601_0057472 | 3300053077 | Bacteria | 2464 |
| 665 | Ga0495601_0129943 | 3300053077 | Bacteria | 1640 |
| 666 | Ga0495601_0207496 | 3300053077 | Bacteria | 1280 |
| 667 | Ga0495612_0013526 | 3300053078 | Bacteria | 3286 |
| 668 | Ga0495612_0118719 | 3300053078 | Bacteria | 1136 |
| 669 | Ga0495655_0002763 | 3300053083 | Bacteria | 2823 |
| 670 | Ga0495595_0004450 | 3300053084 | Bacteria | 5640 |
| 671 | Ga0495595_0016779 | 3300053084 | Bacteria | 3138 |
| 672 | Ga0495619_0001280 | 3300053085 | Bacteria | 16510 |
| 673 | Ga0495619_0222484 | 3300053085 | Bacteria | 1307 |
| 674 | Ga0495619_0289819 | 3300053085 | Bacteria | 1134 |
| 675 | Ga0495619_0524069 | 3300053085 | Bacteria | 814 |
| 676 | Ga0500646_0044954 | 3300053090 | Bacteria | 1255 |
| 677 | Ga0500647_0030111 | 3300053091 | Bacteria | 2577 |
| 678 | Ga0500583_0228905 | 3300053092 | Bacteria | 921 |
| 679 | Ga0500566_0000046 | 3300053094 | Bacteria | 59187 |
| 680 | Ga0500566_0096422 | 3300053094 | Bacteria | 1628 |
| 681 | Ga0500641_0001509 | 3300053096 | Bacteria | 8318 |
| 682 | Ga0500641_0058753 | 3300053096 | Bacteria | 1597 |
| 683 | Ga0500554_001571 | 3300053102 | Bacteria | 4401 |
| 684 | Ga0500556_0038644 | 3300053104 | Bacteria | 1667 |
| 685 | Ga0500595_001395 | 3300053119 | Bacteria | 12953 |
| 686 | Ga0500595_003376 | 3300053119 | Bacteria | 7480 |
| 687 | Ga0500595_004070 | 3300053119 | Bacteria | 6646 |
| 688 | Ga0500595_009512 | 3300053119 | Bacteria | 3919 |
| 689 | Ga0500595_014720 | 3300053119 | Bacteria | 2960 |
| 690 | Ga0500642_0159753 | 3300053130 | Bacteria | 1056 |
| 691 | Ga0500652_109798 | 3300053131 | Bacteria | 1153 |
| 692 | Ga0500559_0001633 | 3300053136 | Bacteria | 12428 |
| 693 | Ga0500559_0112820 | 3300053136 | Bacteria | 1260 |
| 694 | Ga0500568_0007172 | 3300053139 | Bacteria | 5498 |
| 695 | Ga0500568_0051503 | 3300053139 | Bacteria | 1619 |
| 696 | Ga0500577_0113997 | 3300053142 | Bacteria | 1118 |
| 697 | Ga0500588_0065533 | 3300053146 | Bacteria | 1176 |
| 698 | Ga0500603_000071 | 3300053150 | Bacteria | 23487 |
| 699 | Ga0500603_000328 | 3300053150 | Bacteria | 12422 |
| 700 | Ga0500603_021589 | 3300053150 | Bacteria | 1585 |
| 701 | Ga0500633_0048777 | 3300053160 | Bacteria | 1454 |
| 702 | Ga0500639_000009 | 3300053163 | Bacteria | 139043 |
| 703 | Ga0500636_0026626 | 3300053177 | Bacteria | 3415 |
| 704 | Ga0500637_0000262 | 3300053178 | Bacteria | 19711 |
| 705 | Ga0500637_0001994 | 3300053178 | Bacteria | 8887 |
| 706 | Ga0500637_0051276 | 3300053178 | Bacteria | 2352 |
| 707 | Ga0500637_0158607 | 3300053178 | Bacteria | 1305 |
| 708 | Ga0500609_006359 | 3300053731 | Bacteria | 1610 |
| 709 | Ga0501084_0498017 | 3300054114 | Bacteria | 1030 |
| 710 | Ga0500661_001756 | 3300055283 | Bacteria | 4085 |
| 711 | Ga0501082_0192295 | 3300060353 | Bacteria | 1775 |
| 712 | Ga0466962_0239302 | 3300061719 | Bacteria | 891 |
| 713 | Ga0530510_0323810 | 3300061734 | Bacteria | 1156 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005339 | Ga0070660_100438281 | Ga0070660_1004382811 | 218 |
| 2 | 3300005563 | Ga0068855_100010142 | Ga0068855_1000101423 | 218 |
| 3 | 3300009093 | Ga0105240_10032506 | Ga0105240_100325066 | 218 |
| 4 | 3300009545 | Ga0105237_10333240 | Ga0105237_103332402 | 218 |
| 5 | 3300013104 | Ga0157370_10013258 | Ga0157370_100132582 | 218 |
| 6 | 3300025949 | Ga0207667_10010882 | Ga0207667_100108822 | 218 |
| 7 | 3300048929 | Ga0496126_0159847 | Ga0496126_0159847_103_864 | 218 |
| 8 | 3300053119 | Ga0500595_001395 | Ga0500595_001395_1848_2603 | 220 |
| 9 | 3300053150 | Ga0500603_021589 | Ga0500603_021589_96_851 | 220 |
| 10 | 3300053178 | Ga0500637_0000262 | Ga0500637_0000262_3510_4265 | 220 |
| 11 | 3300055283 | Ga0500661_001756 | Ga0500661_001756_2197_2952 | 220 |
| 12 | 3300025906 | Ga0207699_10337654 | Ga0207699_103376541 | 222 |
| 13 | 3300025921 | Ga0207652_10210735 | Ga0207652_102107352 | 222 |
| 14 | 3300035170 | Ga0373943_0016035 | Ga0373943_0016035_1214_1966 | 222 |
| 15 | 3300035695 | Ga0373927_0014122 | Ga0373927_0014122_810_1562 | 222 |
| 16 | 3300035725 | Ga0373947_0010871 | Ga0373947_0010871_2341_3093 | 222 |
| 17 | 3300046455 | Ga0495603_0013820 | Ga0495603_0013820_2341_3093 | 222 |
| 18 | 3300046517 | Ga0495630_0442117 | Ga0495630_0442117_24_776 | 222 |
| 19 | 3300046531 | Ga0495665_0141139 | Ga0495665_0141139_303_1055 | 222 |
| 20 | 3300035695 | Ga0373927_0154369 | Ga0373927_0154369_510_1265 | 224 |
| 21 | 3300035725 | Ga0373947_0047088 | Ga0373947_0047088_1663_2418 | 224 |
| 22 | 3300005563 | Ga0068855_100320690 | Ga0068855_1003206902 | 225 |
| 23 | 3300005614 | Ga0068856_100084211 | Ga0068856_1000842112 | 225 |
| 24 | 3300005616 | Ga0068852_100078071 | Ga0068852_1000780712 | 225 |
| 25 | 3300005834 | Ga0068851_10240303 | Ga0068851_102403032 | 225 |
| 26 | 3300006028 | Ga0070717_10110378 | Ga0070717_101103783 | 225 |
| 27 | 3300026078 | Ga0207702_10047033 | Ga0207702_100470332 | 225 |
| 28 | 3300026142 | Ga0207698_10150001 | Ga0207698_101500012 | 225 |
| 29 | 3300048088 | Ga0495602_0626143 | Ga0495602_0626143_10_714 | 225 |
| 30 | 3300053136 | Ga0500559_0112820 | Ga0500559_0112820_116_856 | 225 |
| 31 | 3300005536 | Ga0070697_100100186 | Ga0070697_1001001862 | 226 |
| 32 | 3300021441 | Ga0213871_10001561 | Ga0213871_100015613 | 226 |
| 33 | 3300039438 | Ga0436360_0770248 | Ga0436360_0770248_1085_1819 | 226 |
| 34 | 3300048929 | Ga0496126_0169071 | Ga0496126_0169071_703_1449 | 226 |
| 35 | 3300021377 | Ga0213874_10016941 | Ga0213874_100169412 | 227 |
| 36 | 3300039450 | Ga0436363_1067356 | Ga0436363_1067356_2312_3046 | 227 |
| 37 | 3300036459 | Ga0372808_002808 | Ga0372808_002808_1038_1772 | 228 |
| 38 | 3300053119 | Ga0500595_003376 | Ga0500595_003376_2612_3355 | 228 |
| 39 | 3300005983 | Ga0081540_1017020 | Ga0081540_10170202 | 229 |
| 40 | 3300005435 | Ga0070714_100203092 | Ga0070714_1002030923 | 230 |
| 41 | 3300005436 | Ga0070713_100116181 | Ga0070713_1001161813 | 230 |
| 42 | 3300025929 | Ga0207664_10351326 | Ga0207664_103513262 | 230 |
| 43 | 3300005548 | Ga0070665_100097774 | Ga0070665_1000977742 | 231 |
| 44 | 3300031711 | Ga0265314_10078319 | Ga0265314_100783192 | 234 |
| 45 | 3300035118 | Ga0373954_0040759 | Ga0373954_0040759_723_1427 | 234 |
| 46 | 3300048904 | Ga0496101_0584126 | Ga0496101_0584126_96_800 | 234 |
| 47 | 3300048924 | Ga0496121_0000379 | Ga0496121_0000379_80557_81261 | 234 |
| 48 | 3300053078 | Ga0495612_0118719 | Ga0495612_0118719_62_766 | 234 |
| 49 | 3300053104 | Ga0500556_0038644 | Ga0500556_0038644_918_1622 | 234 |
| 50 | 3300053119 | Ga0500595_004070 | Ga0500595_004070_1264_1968 | 234 |
| 51 | 3300053139 | Ga0500568_0007172 | Ga0500568_0007172_2030_2734 | 234 |
| 52 | 3300005366 | Ga0070659_100024121 | Ga0070659_1000241212 | 235 |
| 53 | 3300006942 | Ga0099824_1006668 | Ga0099824_100666813 | 235 |
| 54 | 3300009093 | Ga0105240_10257882 | Ga0105240_102578822 | 235 |
| 55 | 3300009551 | Ga0105238_10003279 | Ga0105238_1000327914 | 235 |
| 56 | 3300010375 | Ga0105239_10182631 | Ga0105239_101826312 | 235 |
| 57 | 3300025938 | Ga0207704_10360061 | Ga0207704_103600611 | 235 |
| 58 | 3300046472 | Ga0495580_0549782 | Ga0495580_0549782_20_727 | 235 |
| 59 | 3300006178 | Ga0075367_10109936 | Ga0075367_101099361 | 236 |
| 60 | 3300050494 | nmdc:mga06z11_86843_c1 | nmdc:mga06z11_86843_c1_916_1644 | 236 |
| 61 | 3300003215 | JGI25153J46596_10004213 | JGI25153J46596_100042132 | 237 |
| 62 | 3300003659 | JGI25404J52841_10013554 | JGI25404J52841_100135542 | 237 |
| 63 | 3300005327 | Ga0070658_10023061 | Ga0070658_100230614 | 237 |
| 64 | 3300005329 | Ga0070683_100002376 | Ga0070683_10000237614 | 237 |
| 65 | 3300005329 | Ga0070683_100039720 | Ga0070683_1000397203 | 237 |
| 66 | 3300005334 | Ga0068869_100053873 | Ga0068869_1000538733 | 237 |
| 67 | 3300005334 | Ga0068869_100109397 | Ga0068869_1001093972 | 237 |
| 68 | 3300005336 | Ga0070680_100101164 | Ga0070680_1001011642 | 237 |
| 69 | 3300005336 | Ga0070680_100184226 | Ga0070680_1001842262 | 237 |
| 70 | 3300005336 | Ga0070680_100294063 | Ga0070680_1002940632 | 237 |
| 71 | 3300005336 | Ga0070680_100401665 | Ga0070680_1004016652 | 237 |
| 72 | 3300005337 | Ga0070682_100051594 | Ga0070682_1000515943 | 237 |
| 73 | 3300005338 | Ga0068868_100041269 | Ga0068868_1000412692 | 237 |
| 74 | 3300005339 | Ga0070660_100011623 | Ga0070660_1000116232 | 237 |
| 75 | 3300005339 | Ga0070660_100146256 | Ga0070660_1001462562 | 237 |
| 76 | 3300005341 | Ga0070691_10015392 | Ga0070691_100153922 | 237 |
| 77 | 3300005343 | Ga0070687_100068743 | Ga0070687_1000687432 | 237 |
| 78 | 3300005344 | Ga0070661_100121680 | Ga0070661_1001216802 | 237 |
| 79 | 3300005345 | Ga0070692_10351844 | Ga0070692_103518441 | 237 |
| 80 | 3300005347 | Ga0070668_100392405 | Ga0070668_1003924051 | 237 |
| 81 | 3300005347 | Ga0070668_100418139 | Ga0070668_1004181392 | 237 |
| 82 | 3300005353 | Ga0070669_100099354 | Ga0070669_1000993542 | 237 |
| 83 | 3300005355 | Ga0070671_100036389 | Ga0070671_1000363894 | 237 |
| 84 | 3300005355 | Ga0070671_100300834 | Ga0070671_1003008342 | 237 |
| 85 | 3300005356 | Ga0070674_100133845 | Ga0070674_1001338452 | 237 |
| 86 | 3300005364 | Ga0070673_100433193 | Ga0070673_1004331932 | 237 |
| 87 | 3300005365 | Ga0070688_100141458 | Ga0070688_1001414581 | 237 |
| 88 | 3300005366 | Ga0070659_100076973 | Ga0070659_1000769732 | 237 |
| 89 | 3300005366 | Ga0070659_100237090 | Ga0070659_1002370902 | 237 |
| 90 | 3300005434 | Ga0070709_10005136 | Ga0070709_100051366 | 237 |
| 91 | 3300005435 | Ga0070714_100030939 | Ga0070714_1000309395 | 237 |
| 92 | 3300005435 | Ga0070714_100054028 | Ga0070714_1000540282 | 237 |
| 93 | 3300005435 | Ga0070714_100062126 | Ga0070714_1000621265 | 237 |
| 94 | 3300005435 | Ga0070714_100426475 | Ga0070714_1004264752 | 237 |
| 95 | 3300005436 | Ga0070713_100006818 | Ga0070713_1000068187 | 237 |
| 96 | 3300005436 | Ga0070713_100121600 | Ga0070713_1001216002 | 237 |
| 97 | 3300005436 | Ga0070713_100215148 | Ga0070713_1002151482 | 237 |
| 98 | 3300005436 | Ga0070713_100286579 | Ga0070713_1002865791 | 237 |
| 99 | 3300005437 | Ga0070710_10006463 | Ga0070710_100064634 | 237 |
| 100 | 3300005437 | Ga0070710_10021427 | Ga0070710_100214272 | 237 |
| 101 | 3300005437 | Ga0070710_10098276 | Ga0070710_100982762 | 237 |
| 102 | 3300005439 | Ga0070711_100001065 | Ga0070711_10000106515 | 237 |
| 103 | 3300005439 | Ga0070711_100010729 | Ga0070711_1000107295 | 237 |
| 104 | 3300005439 | Ga0070711_100321816 | Ga0070711_1003218162 | 237 |
| 105 | 3300005445 | Ga0070708_100363178 | Ga0070708_1003631782 | 237 |
| 106 | 3300005455 | Ga0070663_100023081 | Ga0070663_1000230814 | 237 |
| 107 | 3300005455 | Ga0070663_100329952 | Ga0070663_1003299522 | 237 |
| 108 | 3300005456 | Ga0070678_100031818 | Ga0070678_1000318182 | 237 |
| 109 | 3300005456 | Ga0070678_100042358 | Ga0070678_1000423583 | 237 |
| 110 | 3300005456 | Ga0070678_100318952 | Ga0070678_1003189522 | 237 |
| 111 | 3300005457 | Ga0070662_100163692 | Ga0070662_1001636921 | 237 |
| 112 | 3300005458 | Ga0070681_10130390 | Ga0070681_101303902 | 237 |
| 113 | 3300005458 | Ga0070681_10135762 | Ga0070681_101357623 | 237 |
| 114 | 3300005467 | Ga0070706_100143695 | Ga0070706_1001436952 | 237 |
| 115 | 3300005468 | Ga0070707_100037942 | Ga0070707_1000379423 | 237 |
| 116 | 3300005471 | Ga0070698_100283818 | Ga0070698_1002838182 | 237 |
| 117 | 3300005530 | Ga0070679_100160275 | Ga0070679_1001602753 | 237 |
| 118 | 3300005535 | Ga0070684_100009910 | Ga0070684_1000099106 | 237 |
| 119 | 3300005535 | Ga0070684_100032347 | Ga0070684_1000323472 | 237 |
| 120 | 3300005536 | Ga0070697_100061661 | Ga0070697_1000616612 | 237 |
| 121 | 3300005539 | Ga0068853_100178979 | Ga0068853_1001789793 | 237 |
| 122 | 3300005539 | Ga0068853_100188553 | Ga0068853_1001885532 | 237 |
| 123 | 3300005539 | Ga0068853_100275033 | Ga0068853_1002750332 | 237 |
| 124 | 3300005539 | Ga0068853_100782604 | Ga0068853_1007826041 | 237 |
| 125 | 3300005547 | Ga0070693_100054174 | Ga0070693_1000541743 | 237 |
| 126 | 3300005548 | Ga0070665_100053304 | Ga0070665_1000533043 | 237 |
| 127 | 3300005548 | Ga0070665_100080605 | Ga0070665_1000806052 | 237 |
| 128 | 3300005548 | Ga0070665_100210330 | Ga0070665_1002103303 | 237 |
| 129 | 3300005548 | Ga0070665_100243303 | Ga0070665_1002433032 | 237 |
| 130 | 3300005548 | Ga0070665_100248399 | Ga0070665_1002483992 | 237 |
| 131 | 3300005548 | Ga0070665_100298908 | Ga0070665_1002989083 | 237 |
| 132 | 3300005563 | Ga0068855_100100282 | Ga0068855_1001002823 | 237 |
| 133 | 3300005563 | Ga0068855_100119566 | Ga0068855_1001195663 | 237 |
| 134 | 3300005563 | Ga0068855_100356840 | Ga0068855_1003568401 | 237 |
| 135 | 3300005564 | Ga0070664_100075491 | Ga0070664_1000754913 | 237 |
| 136 | 3300005564 | Ga0070664_100422469 | Ga0070664_1004224692 | 237 |
| 137 | 3300005577 | Ga0068857_100134758 | Ga0068857_1001347582 | 237 |
| 138 | 3300005577 | Ga0068857_100537861 | Ga0068857_1005378612 | 237 |
| 139 | 3300005614 | Ga0068856_100096878 | Ga0068856_1000968782 | 237 |
| 140 | 3300005614 | Ga0068856_100149968 | Ga0068856_1001499682 | 237 |
| 141 | 3300005614 | Ga0068856_100404812 | Ga0068856_1004048122 | 237 |
| 142 | 3300005616 | Ga0068852_100342278 | Ga0068852_1003422781 | 237 |
| 143 | 3300005618 | Ga0068864_100073721 | Ga0068864_1000737212 | 237 |
| 144 | 3300005719 | Ga0068861_100027741 | Ga0068861_1000277414 | 237 |
| 145 | 3300005834 | Ga0068851_10055833 | Ga0068851_100558333 | 237 |
| 146 | 3300005840 | Ga0068870_10236031 | Ga0068870_102360312 | 237 |
| 147 | 3300005841 | Ga0068863_100222523 | Ga0068863_1002225233 | 237 |
| 148 | 3300005841 | Ga0068863_100695341 | Ga0068863_1006953412 | 237 |
| 149 | 3300005843 | Ga0068860_100000101 | Ga0068860_100000101126 | 237 |
| 150 | 3300005844 | Ga0068862_100111617 | Ga0068862_1001116172 | 237 |
| 151 | 3300005937 | Ga0081455_10011564 | Ga0081455_1001156412 | 237 |
| 152 | 3300005981 | Ga0081538_10033376 | Ga0081538_100333763 | 237 |
| 153 | 3300005983 | Ga0081540_1016848 | Ga0081540_10168485 | 237 |
| 154 | 3300005985 | Ga0081539_10039335 | Ga0081539_100393352 | 237 |
| 155 | 3300006028 | Ga0070717_10003637 | Ga0070717_1000363712 | 237 |
| 156 | 3300006028 | Ga0070717_10036762 | Ga0070717_100367622 | 237 |
| 157 | 3300006028 | Ga0070717_10182680 | Ga0070717_101826802 | 237 |
| 158 | 3300006163 | Ga0070715_10012718 | Ga0070715_100127182 | 237 |
| 159 | 3300006173 | Ga0070716_100003831 | Ga0070716_1000038315 | 237 |
| 160 | 3300006173 | Ga0070716_100195616 | Ga0070716_1001956162 | 237 |
| 161 | 3300006175 | Ga0070712_100034259 | Ga0070712_1000342592 | 237 |
| 162 | 3300006175 | Ga0070712_100035835 | Ga0070712_1000358352 | 237 |
| 163 | 3300006175 | Ga0070712_100047302 | Ga0070712_1000473022 | 237 |
| 164 | 3300006175 | Ga0070712_100142349 | Ga0070712_1001423492 | 237 |
| 165 | 3300006177 | Ga0075362_10030838 | Ga0075362_100308383 | 237 |
| 166 | 3300006178 | Ga0075367_10091566 | Ga0075367_100915662 | 237 |
| 167 | 3300006186 | Ga0075369_10053052 | Ga0075369_100530522 | 237 |
| 168 | 3300006195 | Ga0075366_10082877 | Ga0075366_100828772 | 237 |
| 169 | 3300006353 | Ga0075370_10056629 | Ga0075370_100566292 | 237 |
| 170 | 3300006353 | Ga0075370_10218362 | Ga0075370_102183622 | 237 |
| 171 | 3300006358 | Ga0068871_100013006 | Ga0068871_1000130064 | 237 |
| 172 | 3300006846 | Ga0075430_100274245 | Ga0075430_1002742452 | 237 |
| 173 | 3300006871 | Ga0075434_100006666 | Ga0075434_1000066662 | 237 |
| 174 | 3300006871 | Ga0075434_100133722 | Ga0075434_1001337222 | 237 |
| 175 | 3300006881 | Ga0068865_100107794 | Ga0068865_1001077942 | 237 |
| 176 | 3300006931 | Ga0097620_100408070 | Ga0097620_1004080701 | 237 |
| 177 | 3300006943 | Ga0099822_1000663 | Ga0099822_100066319 | 237 |
| 178 | 3300007265 | Ga0099794_10004750 | Ga0099794_100047502 | 237 |
| 179 | 3300007265 | Ga0099794_10010664 | Ga0099794_100106646 | 237 |
| 180 | 3300007265 | Ga0099794_10072307 | Ga0099794_100723072 | 237 |
| 181 | 3300007265 | Ga0099794_10211785 | Ga0099794_102117852 | 237 |
| 182 | 3300007788 | Ga0099795_10040757 | Ga0099795_100407573 | 237 |
| 183 | 3300009093 | Ga0105240_10297895 | Ga0105240_102978952 | 237 |
| 184 | 3300009094 | Ga0111539_10177063 | Ga0111539_101770632 | 237 |
| 185 | 3300009098 | Ga0105245_10011127 | Ga0105245_100111273 | 237 |
| 186 | 3300009098 | Ga0105245_10016868 | Ga0105245_100168686 | 237 |
| 187 | 3300009101 | Ga0105247_10019655 | Ga0105247_100196552 | 237 |
| 188 | 3300009101 | Ga0105247_10117210 | Ga0105247_101172102 | 237 |
| 189 | 3300009148 | Ga0105243_10048436 | Ga0105243_100484362 | 237 |
| 190 | 3300009148 | Ga0105243_10403329 | Ga0105243_104033292 | 237 |
| 191 | 3300009174 | Ga0105241_10029647 | Ga0105241_100296473 | 237 |
| 192 | 3300009176 | Ga0105242_10316387 | Ga0105242_103163872 | 237 |
| 193 | 3300009177 | Ga0105248_10178264 | Ga0105248_101782642 | 237 |
| 194 | 3300009545 | Ga0105237_10054501 | Ga0105237_100545013 | 237 |
| 195 | 3300009545 | Ga0105237_10153004 | Ga0105237_101530043 | 237 |
| 196 | 3300009545 | Ga0105237_10303183 | Ga0105237_103031832 | 237 |
| 197 | 3300009551 | Ga0105238_10027788 | Ga0105238_100277882 | 237 |
| 198 | 3300009551 | Ga0105238_10094819 | Ga0105238_100948194 | 237 |
| 199 | 3300009551 | Ga0105238_10413754 | Ga0105238_104137542 | 237 |
| 200 | 3300009553 | Ga0105249_10215687 | Ga0105249_102156872 | 237 |
| 201 | 3300010375 | Ga0105239_10080497 | Ga0105239_100804971 | 237 |
| 202 | 3300010375 | Ga0105239_11122421 | Ga0105239_111224211 | 237 |
| 203 | 3300011119 | Ga0105246_10066670 | Ga0105246_100666702 | 237 |
| 204 | 3300011119 | Ga0105246_10200344 | Ga0105246_102003442 | 237 |
| 205 | 3300013100 | Ga0157373_10039405 | Ga0157373_100394053 | 237 |
| 206 | 3300013104 | Ga0157370_10261721 | Ga0157370_102617212 | 237 |
| 207 | 3300013105 | Ga0157369_10014404 | Ga0157369_1001440410 | 237 |
| 208 | 3300013105 | Ga0157369_10402758 | Ga0157369_104027582 | 237 |
| 209 | 3300013105 | Ga0157369_10611312 | Ga0157369_106113122 | 237 |
| 210 | 3300013296 | Ga0157374_10041407 | Ga0157374_100414073 | 237 |
| 211 | 3300013296 | Ga0157374_10441365 | Ga0157374_104413652 | 237 |
| 212 | 3300013297 | Ga0157378_10194808 | Ga0157378_101948082 | 237 |
| 213 | 3300013306 | Ga0163162_10031760 | Ga0163162_100317603 | 237 |
| 214 | 3300013306 | Ga0163162_10122697 | Ga0163162_101226973 | 237 |
| 215 | 3300013306 | Ga0163162_10369150 | Ga0163162_103691501 | 237 |
| 216 | 3300013307 | Ga0157372_10083592 | Ga0157372_100835923 | 237 |
| 217 | 3300013308 | Ga0157375_10008782 | Ga0157375_100087823 | 237 |
| 218 | 3300013308 | Ga0157375_11032035 | Ga0157375_110320352 | 237 |
| 219 | 3300014325 | Ga0163163_10097774 | Ga0163163_100977742 | 237 |
| 220 | 3300014497 | Ga0182008_10217802 | Ga0182008_102178021 | 237 |
| 221 | 3300014968 | Ga0157379_10082727 | Ga0157379_100827273 | 237 |
| 222 | 3300014969 | Ga0157376_10034599 | Ga0157376_100345994 | 237 |
| 223 | 3300021361 | Ga0213872_10029655 | Ga0213872_100296552 | 237 |
| 224 | 3300021361 | Ga0213872_10090683 | Ga0213872_100906832 | 237 |
| 225 | 3300021384 | Ga0213876_10220419 | Ga0213876_102204192 | 237 |
| 226 | 3300025261 | Ga0209233_1005435 | Ga0209233_10054353 | 237 |
| 227 | 3300025297 | Ga0209758_1003178 | Ga0209758_10031787 | 237 |
| 228 | 3300025297 | Ga0209758_1014636 | Ga0209758_10146362 | 237 |
| 229 | 3300025321 | Ga0207656_10075860 | Ga0207656_100758602 | 237 |
| 230 | 3300025893 | Ga0207682_10197215 | Ga0207682_101972151 | 237 |
| 231 | 3300025898 | Ga0207692_10063188 | Ga0207692_100631883 | 237 |
| 232 | 3300025899 | Ga0207642_10031730 | Ga0207642_100317302 | 237 |
| 233 | 3300025899 | Ga0207642_10041436 | Ga0207642_100414362 | 237 |
| 234 | 3300025900 | Ga0207710_10121530 | Ga0207710_101215302 | 237 |
| 235 | 3300025900 | Ga0207710_10266381 | Ga0207710_102663811 | 237 |
| 236 | 3300025905 | Ga0207685_10028399 | Ga0207685_100283992 | 237 |
| 237 | 3300025906 | Ga0207699_10027370 | Ga0207699_100273703 | 237 |
| 238 | 3300025906 | Ga0207699_10056996 | Ga0207699_100569962 | 237 |
| 239 | 3300025906 | Ga0207699_10070555 | Ga0207699_100705552 | 237 |
| 240 | 3300025909 | Ga0207705_10017157 | Ga0207705_100171574 | 237 |
| 241 | 3300025910 | Ga0207684_10261364 | Ga0207684_102613642 | 237 |
| 242 | 3300025911 | Ga0207654_10098056 | Ga0207654_100980562 | 237 |
| 243 | 3300025912 | Ga0207707_10028363 | Ga0207707_100283632 | 237 |
| 244 | 3300025912 | Ga0207707_10032980 | Ga0207707_100329805 | 237 |
| 245 | 3300025912 | Ga0207707_10118799 | Ga0207707_101187992 | 237 |
| 246 | 3300025912 | Ga0207707_10128284 | Ga0207707_101282843 | 237 |
| 247 | 3300025913 | Ga0207695_10015132 | Ga0207695_1001513210 | 237 |
| 248 | 3300025913 | Ga0207695_10099178 | Ga0207695_100991782 | 237 |
| 249 | 3300025914 | Ga0207671_10046204 | Ga0207671_100462042 | 237 |
| 250 | 3300025914 | Ga0207671_10095419 | Ga0207671_100954192 | 237 |
| 251 | 3300025914 | Ga0207671_10661420 | Ga0207671_106614201 | 237 |
| 252 | 3300025915 | Ga0207693_10003158 | Ga0207693_1000315811 | 237 |
| 253 | 3300025915 | Ga0207693_10029632 | Ga0207693_100296322 | 237 |
| 254 | 3300025915 | Ga0207693_10057236 | Ga0207693_100572362 | 237 |
| 255 | 3300025915 | Ga0207693_10067345 | Ga0207693_100673453 | 237 |
| 256 | 3300025915 | Ga0207693_10114691 | Ga0207693_101146912 | 237 |
| 257 | 3300025916 | Ga0207663_10000261 | Ga0207663_100002619 | 237 |
| 258 | 3300025916 | Ga0207663_10016206 | Ga0207663_100162062 | 237 |
| 259 | 3300025916 | Ga0207663_10100024 | Ga0207663_101000242 | 237 |
| 260 | 3300025917 | Ga0207660_10006085 | Ga0207660_100060854 | 237 |
| 261 | 3300025917 | Ga0207660_10086833 | Ga0207660_100868332 | 237 |
| 262 | 3300025917 | Ga0207660_10097559 | Ga0207660_100975592 | 237 |
| 263 | 3300025917 | Ga0207660_10112333 | Ga0207660_101123332 | 237 |
| 264 | 3300025918 | Ga0207662_10152089 | Ga0207662_101520892 | 237 |
| 265 | 3300025919 | Ga0207657_10002700 | Ga0207657_1000270010 | 237 |
| 266 | 3300025919 | Ga0207657_10092065 | Ga0207657_100920652 | 237 |
| 267 | 3300025921 | Ga0207652_10064850 | Ga0207652_100648503 | 237 |
| 268 | 3300025921 | Ga0207652_10227425 | Ga0207652_102274253 | 237 |
| 269 | 3300025921 | Ga0207652_10469074 | Ga0207652_104690742 | 237 |
| 270 | 3300025921 | Ga0207652_10755826 | Ga0207652_107558261 | 237 |
| 271 | 3300025922 | Ga0207646_10222946 | Ga0207646_102229462 | 237 |
| 272 | 3300025923 | Ga0207681_10115055 | Ga0207681_101150552 | 237 |
| 273 | 3300025924 | Ga0207694_10030821 | Ga0207694_100308212 | 237 |
| 274 | 3300025924 | Ga0207694_10084301 | Ga0207694_100843012 | 237 |
| 275 | 3300025924 | Ga0207694_10116430 | Ga0207694_101164302 | 237 |
| 276 | 3300025924 | Ga0207694_10162284 | Ga0207694_101622842 | 237 |
| 277 | 3300025927 | Ga0207687_10082362 | Ga0207687_100823622 | 237 |
| 278 | 3300025928 | Ga0207700_10005839 | Ga0207700_100058394 | 237 |
| 279 | 3300025928 | Ga0207700_10040740 | Ga0207700_100407402 | 237 |
| 280 | 3300025928 | Ga0207700_10056073 | Ga0207700_100560733 | 237 |
| 281 | 3300025928 | Ga0207700_10102973 | Ga0207700_101029732 | 237 |
| 282 | 3300025928 | Ga0207700_10164232 | Ga0207700_101642322 | 237 |
| 283 | 3300025928 | Ga0207700_10178218 | Ga0207700_101782182 | 237 |
| 284 | 3300025929 | Ga0207664_10063952 | Ga0207664_100639523 | 237 |
| 285 | 3300025929 | Ga0207664_10246784 | Ga0207664_102467842 | 237 |
| 286 | 3300025929 | Ga0207664_10317121 | Ga0207664_103171211 | 237 |
| 287 | 3300025931 | Ga0207644_10074360 | Ga0207644_100743602 | 237 |
| 288 | 3300025933 | Ga0207706_10172639 | Ga0207706_101726392 | 237 |
| 289 | 3300025934 | Ga0207686_10083003 | Ga0207686_100830033 | 237 |
| 290 | 3300025937 | Ga0207669_10209159 | Ga0207669_102091592 | 237 |
| 291 | 3300025939 | Ga0207665_10000280 | Ga0207665_1000028012 | 237 |
| 292 | 3300025939 | Ga0207665_10025582 | Ga0207665_100255822 | 237 |
| 293 | 3300025939 | Ga0207665_10122152 | Ga0207665_101221522 | 237 |
| 294 | 3300025940 | Ga0207691_10075400 | Ga0207691_100754003 | 237 |
| 295 | 3300025940 | Ga0207691_10198491 | Ga0207691_101984912 | 237 |
| 296 | 3300025942 | Ga0207689_10074481 | Ga0207689_100744812 | 237 |
| 297 | 3300025944 | Ga0207661_10000532 | Ga0207661_1000053219 | 237 |
| 298 | 3300025944 | Ga0207661_10002592 | Ga0207661_100025922 | 237 |
| 299 | 3300025944 | Ga0207661_10256249 | Ga0207661_102562492 | 237 |
| 300 | 3300025945 | Ga0207679_10076779 | Ga0207679_100767792 | 237 |
| 301 | 3300025945 | Ga0207679_10151350 | Ga0207679_101513502 | 237 |
| 302 | 3300025945 | Ga0207679_10554811 | Ga0207679_105548111 | 237 |
| 303 | 3300025949 | Ga0207667_10027486 | Ga0207667_100274862 | 237 |
| 304 | 3300025961 | Ga0207712_10095142 | Ga0207712_100951423 | 237 |
| 305 | 3300025972 | Ga0207668_10045470 | Ga0207668_100454702 | 237 |
| 306 | 3300026023 | Ga0207677_10080989 | Ga0207677_100809892 | 237 |
| 307 | 3300026023 | Ga0207677_10862502 | Ga0207677_108625021 | 237 |
| 308 | 3300026035 | Ga0207703_10053309 | Ga0207703_100533094 | 237 |
| 309 | 3300026041 | Ga0207639_10106811 | Ga0207639_101068112 | 237 |
| 310 | 3300026041 | Ga0207639_10134900 | Ga0207639_101349002 | 237 |
| 311 | 3300026041 | Ga0207639_10226902 | Ga0207639_102269022 | 237 |
| 312 | 3300026067 | Ga0207678_10041308 | Ga0207678_100413083 | 237 |
| 313 | 3300026067 | Ga0207678_10089150 | Ga0207678_100891501 | 237 |
| 314 | 3300026067 | Ga0207678_10545651 | Ga0207678_105456512 | 237 |
| 315 | 3300026067 | Ga0207678_10617478 | Ga0207678_106174781 | 237 |
| 316 | 3300026075 | Ga0207708_10072759 | Ga0207708_100727593 | 237 |
| 317 | 3300026075 | Ga0207708_10159047 | Ga0207708_101590473 | 237 |
| 318 | 3300026078 | Ga0207702_10203546 | Ga0207702_102035463 | 237 |
| 319 | 3300026095 | Ga0207676_10070281 | Ga0207676_100702813 | 237 |
| 320 | 3300026095 | Ga0207676_10123771 | Ga0207676_101237712 | 237 |
| 321 | 3300026116 | Ga0207674_10032600 | Ga0207674_100326002 | 237 |
| 322 | 3300026116 | Ga0207674_10565833 | Ga0207674_105658332 | 237 |
| 323 | 3300026118 | Ga0207675_100024689 | Ga0207675_1000246892 | 237 |
| 324 | 3300026118 | Ga0207675_100062798 | Ga0207675_1000627983 | 237 |
| 325 | 3300026118 | Ga0207675_100160430 | Ga0207675_1001604303 | 237 |
| 326 | 3300026118 | Ga0207675_100244314 | Ga0207675_1002443141 | 237 |
| 327 | 3300026121 | Ga0207683_10019717 | Ga0207683_100197173 | 237 |
| 328 | 3300026121 | Ga0207683_10160370 | Ga0207683_101603702 | 237 |
| 329 | 3300026142 | Ga0207698_10017361 | Ga0207698_100173614 | 237 |
| 330 | 3300026142 | Ga0207698_10464639 | Ga0207698_104646392 | 237 |
| 331 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006134 | 237 |
| 332 | 3300027361 | Ga0209489_100007 | Ga0209489_100007134 | 237 |
| 333 | 3300027363 | Ga0209700_100008 | Ga0209700_100008134 | 237 |
| 334 | 3300027671 | Ga0209588_1000499 | Ga0209588_10004993 | 237 |
| 335 | 3300028379 | Ga0268266_10016781 | Ga0268266_100167813 | 237 |
| 336 | 3300028379 | Ga0268266_10241277 | Ga0268266_102412772 | 237 |
| 337 | 3300028379 | Ga0268266_10344904 | Ga0268266_103449042 | 237 |
| 338 | 3300028380 | Ga0268265_10052898 | Ga0268265_100528982 | 237 |
| 339 | 3300028380 | Ga0268265_10084226 | Ga0268265_100842262 | 237 |
| 340 | 3300028380 | Ga0268265_10182911 | Ga0268265_101829112 | 237 |
| 341 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030105 | 237 |
| 342 | 3300028381 | Ga0268264_10159718 | Ga0268264_101597182 | 237 |
| 343 | 3300028786 | Ga0307517_10000744 | Ga0307517_1000074430 | 237 |
| 344 | 3300028794 | Ga0307515_10088090 | Ga0307515_100880904 | 237 |
| 345 | 3300031235 | Ga0265330_10006427 | Ga0265330_100064275 | 237 |
| 346 | 3300031235 | Ga0265330_10009777 | Ga0265330_100097772 | 237 |
| 347 | 3300031239 | Ga0265328_10080780 | Ga0265328_100807801 | 237 |
| 348 | 3300031247 | Ga0265340_10023276 | Ga0265340_100232762 | 237 |
| 349 | 3300031247 | Ga0265340_10026436 | Ga0265340_100264362 | 237 |
| 350 | 3300031249 | Ga0265339_10009136 | Ga0265339_100091362 | 237 |
| 351 | 3300031249 | Ga0265339_10011293 | Ga0265339_100112933 | 237 |
| 352 | 3300031250 | Ga0265331_10074521 | Ga0265331_100745212 | 237 |
| 353 | 3300031456 | Ga0307513_10296943 | Ga0307513_102969432 | 237 |
| 354 | 3300031507 | Ga0307509_10079363 | Ga0307509_100793632 | 237 |
| 355 | 3300031616 | Ga0307508_10000051 | Ga0307508_1000005145 | 237 |
| 356 | 3300031616 | Ga0307508_10232304 | Ga0307508_102323042 | 237 |
| 357 | 3300031712 | Ga0265342_10017850 | Ga0265342_100178504 | 237 |
| 358 | 3300031712 | Ga0265342_10092712 | Ga0265342_100927122 | 237 |
| 359 | 3300031730 | Ga0307516_10029187 | Ga0307516_100291872 | 237 |
| 360 | 3300031852 | Ga0307410_10173039 | Ga0307410_101730392 | 237 |
| 361 | 3300031901 | Ga0307406_10195330 | Ga0307406_101953302 | 237 |
| 362 | 3300031911 | Ga0307412_10204522 | Ga0307412_102045222 | 237 |
| 363 | 3300032005 | Ga0307411_10091699 | Ga0307411_100916992 | 237 |
| 364 | 3300032126 | Ga0307415_100028863 | Ga0307415_1000288633 | 237 |
| 365 | 3300033179 | Ga0307507_10007677 | Ga0307507_1000767715 | 237 |
| 366 | 3300033180 | Ga0307510_10024689 | Ga0307510_100246892 | 237 |
| 367 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003297 | 237 |
| 368 | 3300033544 | Ga0316215_1000756 | Ga0316215_10007563 | 237 |
| 369 | 3300035083 | Ga0373926_0007807 | Ga0373926_0007807_1967_2755 | 237 |
| 370 | 3300035086 | Ga0373934_0000907 | Ga0373934_0000907_9470_10243 | 237 |
| 371 | 3300035089 | Ga0373944_0026229 | Ga0373944_0026229_189_923 | 237 |
| 372 | 3300035111 | Ga0373923_0002765 | Ga0373923_0002765_945_1718 | 237 |
| 373 | 3300035113 | Ga0373936_0011613 | Ga0373936_0011613_774_1547 | 237 |
| 374 | 3300035113 | Ga0373936_0022195 | Ga0373936_0022195_982_1770 | 237 |
| 375 | 3300035116 | Ga0373945_0051470 | Ga0373945_0051470_233_967 | 237 |
| 376 | 3300035117 | Ga0373953_0016673 | Ga0373953_0016673_1352_2140 | 237 |
| 377 | 3300035117 | Ga0373953_0073895 | Ga0373953_0073895_309_1043 | 237 |
| 378 | 3300035118 | Ga0373954_0007936 | Ga0373954_0007936_2488_3261 | 237 |
| 379 | 3300035118 | Ga0373954_0050887 | Ga0373954_0050887_22_756 | 237 |
| 380 | 3300035118 | Ga0373954_0103775 | Ga0373954_0103775_307_1062 | 237 |
| 381 | 3300035119 | Ga0373956_0081619 | Ga0373956_0081619_67_801 | 237 |
| 382 | 3300035120 | Ga0373957_0067375 | Ga0373957_0067375_39_812 | 237 |
| 383 | 3300035170 | Ga0373943_0051712 | Ga0373943_0051712_821_1555 | 237 |
| 384 | 3300035170 | Ga0373943_0083857 | Ga0373943_0083857_296_1051 | 237 |
| 385 | 3300035170 | Ga0373943_0140326 | Ga0373943_0140326_501_1253 | 237 |
| 386 | 3300035171 | Ga0373946_0154492 | Ga0373946_0154492_274_1026 | 237 |
| 387 | 3300035172 | Ga0373955_0040004 | Ga0373955_0040004_1571_2326 | 237 |
| 388 | 3300035172 | Ga0373955_0058865 | Ga0373955_0058865_789_1562 | 237 |
| 389 | 3300035172 | Ga0373955_0142564 | Ga0373955_0142564_112_846 | 237 |
| 390 | 3300035410 | Ga0373924_0003083 | Ga0373924_0003083_3366_4139 | 237 |
| 391 | 3300035410 | Ga0373924_0022158 | Ga0373924_0022158_166_900 | 237 |
| 392 | 3300035410 | Ga0373924_0091753 | Ga0373924_0091753_490_1245 | 237 |
| 393 | 3300035691 | Ga0373931_0349001 | Ga0373931_0349001_169_903 | 237 |
| 394 | 3300035692 | Ga0373935_0035466 | Ga0373935_0035466_1815_2549 | 237 |
| 395 | 3300035692 | Ga0373935_0131415 | Ga0373935_0131415_882_1670 | 237 |
| 396 | 3300035695 | Ga0373927_0013792 | Ga0373927_0013792_4162_4896 | 237 |
| 397 | 3300035695 | Ga0373927_0021149 | Ga0373927_0021149_321_1109 | 237 |
| 398 | 3300035695 | Ga0373927_0086692 | Ga0373927_0086692_530_1279 | 237 |
| 399 | 3300035695 | Ga0373927_0087324 | Ga0373927_0087324_133_867 | 237 |
| 400 | 3300035695 | Ga0373927_0143422 | Ga0373927_0143422_703_1455 | 237 |
| 401 | 3300035695 | Ga0373927_0170553 | Ga0373927_0170553_229_963 | 237 |
| 402 | 3300035724 | Ga0373933_0007801 | Ga0373933_0007801_713_1486 | 237 |
| 403 | 3300035725 | Ga0373947_0014913 | Ga0373947_0014913_577_1311 | 237 |
| 404 | 3300035725 | Ga0373947_0015785 | Ga0373947_0015785_3375_4109 | 237 |
| 405 | 3300035725 | Ga0373947_0569474 | Ga0373947_0569474_12_761 | 237 |
| 406 | 3300036401 | Ga0373937_0014045 | Ga0373937_0014045_3419_4153 | 237 |
| 407 | 3300036401 | Ga0373937_0024360 | Ga0373937_0024360_401_1174 | 237 |
| 408 | 3300036401 | Ga0373937_0668975 | Ga0373937_0668975_148_903 | 237 |
| 409 | 3300037068 | Ga0373925_0029763 | Ga0373925_0029763_2360_3097 | 237 |
| 410 | 3300037068 | Ga0373925_0048085 | Ga0373925_0048085_2304_3092 | 237 |
| 411 | 3300037068 | Ga0373925_0054307 | Ga0373925_0054307_1551_2285 | 237 |
| 412 | 3300037312 | Ga0395899_0283966 | Ga0395899_0283966_305_1039 | 237 |
| 413 | 3300037418 | Ga0395900_0007637 | Ga0395900_0007637_1715_2449 | 237 |
| 414 | 3300037418 | Ga0395900_0114406 | Ga0395900_0114406_678_1430 | 237 |
| 415 | 3300037418 | Ga0395900_0400035 | Ga0395900_0400035_396_1130 | 237 |
| 416 | 3300037466 | Ga0395898_0025630 | Ga0395898_0025630_3644_4378 | 237 |
| 417 | 3300037466 | Ga0395898_0032258 | Ga0395898_0032258_2884_3618 | 237 |
| 418 | 3300037471 | Ga0395905_0082234 | Ga0395905_0082234_545_1297 | 237 |
| 419 | 3300037853 | Ga0436364_1423996 | Ga0436364_1423996_3221_3955 | 237 |
| 420 | 3300038443 | Ga0395901_0136742 | Ga0395901_0136742_1311_2063 | 237 |
| 421 | 3300038443 | Ga0395901_0228139 | Ga0395901_0228139_1106_1858 | 237 |
| 422 | 3300038443 | Ga0395901_0242841 | Ga0395901_0242841_980_1714 | 237 |
| 423 | 3300038443 | Ga0395901_0578620 | Ga0395901_0578620_192_944 | 237 |
| 424 | 3300039437 | Ga0436365_0615168 | Ga0436365_0615168_239_973 | 237 |
| 425 | 3300039437 | Ga0436365_1781661 | Ga0436365_1781661_465_1199 | 237 |
| 426 | 3300039437 | Ga0436365_1883906 | Ga0436365_1883906_292_1026 | 237 |
| 427 | 3300039438 | Ga0436360_1259955 | Ga0436360_1259955_73_807 | 237 |
| 428 | 3300039447 | Ga0436361_0128647 | Ga0436361_0128647_1549_2283 | 237 |
| 429 | 3300041413 | Ga0439465_0021320 | Ga0439465_0021320_250_1005 | 237 |
| 430 | 3300041413 | Ga0439465_0038196 | Ga0439465_0038196_737_1450 | 237 |
| 431 | 3300041512 | Ga0451853_0502755 | Ga0451853_0502755_783_1538 | 237 |
| 432 | 3300044693 | Ga0466961_0179080 | Ga0466961_0179080_442_1176 | 237 |
| 433 | 3300044765 | Ga0466970_0081668 | Ga0466970_0081668_1001_1735 | 237 |
| 434 | 3300044842 | Ga0466957_0026170 | Ga0466957_0026170_970_1704 | 237 |
| 435 | 3300045976 | Ga0466967_0098515 | Ga0466967_0098515_1791_2525 | 237 |
| 436 | 3300045976 | Ga0466967_0181087 | Ga0466967_0181087_824_1558 | 237 |
| 437 | 3300045976 | Ga0466967_0229819 | Ga0466967_0229819_992_1744 | 237 |
| 438 | 3300046454 | Ga0495592_0012012 | Ga0495592_0012012_3689_4462 | 237 |
| 439 | 3300046454 | Ga0495592_0013641 | Ga0495592_0013641_1539_2273 | 237 |
| 440 | 3300046455 | Ga0495603_0003046 | Ga0495603_0003046_3474_4208 | 237 |
| 441 | 3300046455 | Ga0495603_0011007 | Ga0495603_0011007_403_1137 | 237 |
| 442 | 3300046455 | Ga0495603_0068579 | Ga0495603_0068579_163_918 | 237 |
| 443 | 3300046459 | Ga0495629_0000439 | Ga0495629_0000439_23477_24250 | 237 |
| 444 | 3300046459 | Ga0495629_0000957 | Ga0495629_0000957_18508_19242 | 237 |
| 445 | 3300046459 | Ga0495629_0030921 | Ga0495629_0030921_1358_2113 | 237 |
| 446 | 3300046462 | Ga0495651_0019087 | Ga0495651_0019087_1453_2208 | 237 |
| 447 | 3300046463 | Ga0495653_0080143 | Ga0495653_0080143_554_1327 | 237 |
| 448 | 3300046472 | Ga0495580_0022668 | Ga0495580_0022668_3635_4369 | 237 |
| 449 | 3300046472 | Ga0495580_0090574 | Ga0495580_0090574_22_756 | 237 |
| 450 | 3300046473 | Ga0495582_0003251 | Ga0495582_0003251_241_975 | 237 |
| 451 | 3300046473 | Ga0495582_0020537 | Ga0495582_0020537_619_1407 | 237 |
| 452 | 3300046473 | Ga0495582_0212507 | Ga0495582_0212507_254_1009 | 237 |
| 453 | 3300046475 | Ga0495639_0006764 | Ga0495639_0006764_1533_2321 | 237 |
| 454 | 3300046475 | Ga0495639_0051304 | Ga0495639_0051304_129_863 | 237 |
| 455 | 3300046476 | Ga0495662_0011192 | Ga0495662_0011192_3630_4364 | 237 |
| 456 | 3300046476 | Ga0495662_0022869 | Ga0495662_0022869_2061_2795 | 237 |
| 457 | 3300046477 | Ga0495664_0014457 | Ga0495664_0014457_2185_2919 | 237 |
| 458 | 3300046477 | Ga0495664_0018231 | Ga0495664_0018231_473_1261 | 237 |
| 459 | 3300046477 | Ga0495664_0025032 | Ga0495664_0025032_599_1333 | 237 |
| 460 | 3300046477 | Ga0495664_0057675 | Ga0495664_0057675_946_1701 | 237 |
| 461 | 3300046477 | Ga0495664_0117847 | Ga0495664_0117847_312_1046 | 237 |
| 462 | 3300046492 | Ga0495585_0116922 | Ga0495585_0116922_354_1109 | 237 |
| 463 | 3300046511 | Ga0495608_0009342 | Ga0495608_0009342_5682_6455 | 237 |
| 464 | 3300046511 | Ga0495608_0068668 | Ga0495608_0068668_1041_1775 | 237 |
| 465 | 3300046513 | Ga0495616_0158056 | Ga0495616_0158056_200_955 | 237 |
| 466 | 3300046514 | Ga0495618_0004727 | Ga0495618_0004727_7115_7870 | 237 |
| 467 | 3300046514 | Ga0495618_0055842 | Ga0495618_0055842_1608_2396 | 237 |
| 468 | 3300046516 | Ga0495628_0009529 | Ga0495628_0009529_4368_5102 | 237 |
| 469 | 3300046516 | Ga0495628_0052614 | Ga0495628_0052614_1654_2427 | 237 |
| 470 | 3300046517 | Ga0495630_0072137 | Ga0495630_0072137_69_857 | 237 |
| 471 | 3300046517 | Ga0495630_0204690 | Ga0495630_0204690_346_1080 | 237 |
| 472 | 3300046518 | Ga0495631_0106413 | Ga0495631_0106413_84_839 | 237 |
| 473 | 3300046523 | Ga0495644_0035488 | Ga0495644_0035488_392_1147 | 237 |
| 474 | 3300046523 | Ga0495644_0071767 | Ga0495644_0071767_177_932 | 237 |
| 475 | 3300046526 | Ga0495666_0017968 | Ga0495666_0017968_1139_1873 | 237 |
| 476 | 3300046526 | Ga0495666_0044605 | Ga0495666_0044605_1277_2065 | 237 |
| 477 | 3300046529 | Ga0495652_0034465 | Ga0495652_0034465_13_768 | 237 |
| 478 | 3300046529 | Ga0495652_0042026 | Ga0495652_0042026_2616_3389 | 237 |
| 479 | 3300046529 | Ga0495652_0042477 | Ga0495652_0042477_1787_2521 | 237 |
| 480 | 3300046529 | Ga0495652_0143257 | Ga0495652_0143257_399_1154 | 237 |
| 481 | 3300046531 | Ga0495665_0005732 | Ga0495665_0005732_2936_3670 | 237 |
| 482 | 3300046531 | Ga0495665_0009314 | Ga0495665_0009314_2611_3399 | 237 |
| 483 | 3300046533 | Ga0495640_0001232 | Ga0495640_0001232_3272_4006 | 237 |
| 484 | 3300046533 | Ga0495640_0015529 | Ga0495640_0015529_1492_2265 | 237 |
| 485 | 3300046533 | Ga0495640_0032451 | Ga0495640_0032451_504_1292 | 237 |
| 486 | 3300046533 | Ga0495640_0160191 | Ga0495640_0160191_424_1179 | 237 |
| 487 | 3300046535 | Ga0495586_0040423 | Ga0495586_0040423_1258_2013 | 237 |
| 488 | 3300046536 | Ga0495587_0013476 | Ga0495587_0013476_1979_2734 | 237 |
| 489 | 3300046536 | Ga0495587_0092079 | Ga0495587_0092079_426_1199 | 237 |
| 490 | 3300046538 | Ga0495609_0071925 | Ga0495609_0071925_453_1208 | 237 |
| 491 | 3300046539 | Ga0495621_0025425 | Ga0495621_0025425_164_919 | 237 |
| 492 | 3300046543 | Ga0495645_0007838 | Ga0495645_0007838_4281_5054 | 237 |
| 493 | 3300046543 | Ga0495645_0031972 | Ga0495645_0031972_65_820 | 237 |
| 494 | 3300046557 | Ga0495622_0025591 | Ga0495622_0025591_1163_1897 | 237 |
| 495 | 3300046559 | Ga0495667_0003416 | Ga0495667_0003416_8480_9253 | 237 |
| 496 | 3300046559 | Ga0495667_0021483 | Ga0495667_0021483_1409_2143 | 237 |
| 497 | 3300046559 | Ga0495667_0027235 | Ga0495667_0027235_1262_2017 | 237 |
| 498 | 3300046559 | Ga0495667_0105989 | Ga0495667_0105989_73_861 | 237 |
| 499 | 3300046559 | Ga0495667_0204346 | Ga0495667_0204346_121_876 | 237 |
| 500 | 3300046616 | Ga0495668_0029805 | Ga0495668_0029805_1409_2164 | 237 |
| 501 | 3300046642 | Ga0495634_0019547 | Ga0495634_0019547_1132_1905 | 237 |
| 502 | 3300046648 | Ga0495611_0047528 | Ga0495611_0047528_461_1216 | 237 |
| 503 | 3300046648 | Ga0495611_0086703 | Ga0495611_0086703_116_829 | 237 |
| 504 | 3300046660 | Ga0495625_0094620 | Ga0495625_0094620_380_1135 | 237 |
| 505 | 3300046663 | Ga0495635_0009930 | Ga0495635_0009930_3291_4064 | 237 |
| 506 | 3300046663 | Ga0495635_0027261 | Ga0495635_0027261_1158_1892 | 237 |
| 507 | 3300046663 | Ga0495635_0087696 | Ga0495635_0087696_82_870 | 237 |
| 508 | 3300046663 | Ga0495635_0111512 | Ga0495635_0111512_980_1735 | 237 |
| 509 | 3300046663 | Ga0495635_0121454 | Ga0495635_0121454_316_1071 | 237 |
| 510 | 3300046664 | Ga0495659_0026482 | Ga0495659_0026482_1165_1920 | 237 |
| 511 | 3300046674 | Ga0495588_0129327 | Ga0495588_0129327_244_996 | 237 |
| 512 | 3300046675 | Ga0495657_0018194 | Ga0495657_0018194_3766_4539 | 237 |
| 513 | 3300046678 | Ga0495599_0001369 | Ga0495599_0001369_10540_11313 | 237 |
| 514 | 3300046678 | Ga0495599_0005440 | Ga0495599_0005440_5384_6139 | 237 |
| 515 | 3300046678 | Ga0495599_0213937 | Ga0495599_0213937_415_1170 | 237 |
| 516 | 3300046680 | Ga0495646_0025605 | Ga0495646_0025605_2780_3514 | 237 |
| 517 | 3300046680 | Ga0495646_0028973 | Ga0495646_0028973_554_1327 | 237 |
| 518 | 3300046681 | Ga0495647_0019993 | Ga0495647_0019993_167_901 | 237 |
| 519 | 3300046684 | Ga0495669_0004668 | Ga0495669_0004668_3731_4486 | 237 |
| 520 | 3300046689 | Ga0495613_0022008 | Ga0495613_0022008_301_1074 | 237 |
| 521 | 3300046689 | Ga0495613_0081708 | Ga0495613_0081708_1402_2157 | 237 |
| 522 | 3300046690 | Ga0495624_0171663 | Ga0495624_0171663_232_987 | 237 |
| 523 | 3300046690 | Ga0495624_0285742 | Ga0495624_0285742_116_916 | 237 |
| 524 | 3300046809 | Ga0495600_0001020 | Ga0495600_0001020_35_808 | 237 |
| 525 | 3300046809 | Ga0495600_0035995 | Ga0495600_0035995_559_1314 | 237 |
| 526 | 3300046809 | Ga0495600_0098171 | Ga0495600_0098171_49_804 | 237 |
| 527 | 3300047315 | Ga0495581_0000019 | Ga0495581_0000019_3380_4114 | 237 |
| 528 | 3300047317 | Ga0495604_0244650 | Ga0495604_0244650_67_822 | 237 |
| 529 | 3300047319 | Ga0495674_0000458 | Ga0495674_0000458_11744_12478 | 237 |
| 530 | 3300047319 | Ga0495674_0009039 | Ga0495674_0009039_3271_4059 | 237 |
| 531 | 3300047319 | Ga0495674_0064351 | Ga0495674_0064351_251_1006 | 237 |
| 532 | 3300047319 | Ga0495674_0110158 | Ga0495674_0110158_808_1581 | 237 |
| 533 | 3300047319 | Ga0495674_0122742 | Ga0495674_0122742_365_1099 | 237 |
| 534 | 3300047320 | Ga0495672_0073410 | Ga0495672_0073410_335_1090 | 237 |
| 535 | 3300047322 | Ga0495680_0013039 | Ga0495680_0013039_5946_6719 | 237 |
| 536 | 3300047322 | Ga0495680_0015630 | Ga0495680_0015630_4334_5089 | 237 |
| 537 | 3300047444 | Ga0495675_0080493 | Ga0495675_0080493_1168_1923 | 237 |
| 538 | 3300047444 | Ga0495675_0088933 | Ga0495675_0088933_35_808 | 237 |
| 539 | 3300047469 | Ga0495673_0082853 | Ga0495673_0082853_296_1051 | 237 |
| 540 | 3300047471 | Ga0495684_0007607 | Ga0495684_0007607_5149_5922 | 237 |
| 541 | 3300047471 | Ga0495684_0011461 | Ga0495684_0011461_3327_4115 | 237 |
| 542 | 3300047673 | Ga0495593_0000687 | Ga0495593_0000687_3290_4063 | 237 |
| 543 | 3300047673 | Ga0495593_0079891 | Ga0495593_0079891_586_1341 | 237 |
| 544 | 3300047673 | Ga0495593_0124640 | Ga0495593_0124640_440_1195 | 237 |
| 545 | 3300048088 | Ga0495602_0118820 | Ga0495602_0118820_416_1150 | 237 |
| 546 | 3300048088 | Ga0495602_0173768 | Ga0495602_0173768_187_942 | 237 |
| 547 | 3300048088 | Ga0495602_0314863 | Ga0495602_0314863_264_998 | 237 |
| 548 | 3300048903 | Ga0496100_0015649 | Ga0496100_0015649_2263_3024 | 237 |
| 549 | 3300048903 | Ga0496100_0092825 | Ga0496100_0092825_451_1203 | 237 |
| 550 | 3300048903 | Ga0496100_0205623 | Ga0496100_0205623_685_1419 | 237 |
| 551 | 3300048904 | Ga0496101_0004392 | Ga0496101_0004392_5606_6361 | 237 |
| 552 | 3300048904 | Ga0496101_0043859 | Ga0496101_0043859_2043_2795 | 237 |
| 553 | 3300048904 | Ga0496101_0194526 | Ga0496101_0194526_642_1397 | 237 |
| 554 | 3300048905 | Ga0496102_0013777 | Ga0496102_0013777_3981_4742 | 237 |
| 555 | 3300048905 | Ga0496102_0052436 | Ga0496102_0052436_957_1712 | 237 |
| 556 | 3300048905 | Ga0496102_0112622 | Ga0496102_0112622_1391_2143 | 237 |
| 557 | 3300048905 | Ga0496102_0113133 | Ga0496102_0113133_1780_2514 | 237 |
| 558 | 3300048906 | Ga0496103_0237018 | Ga0496103_0237018_83_856 | 237 |
| 559 | 3300048906 | Ga0496103_0361053 | Ga0496103_0361053_46_801 | 237 |
| 560 | 3300048907 | Ga0496104_0041945 | Ga0496104_0041945_912_1673 | 237 |
| 561 | 3300048907 | Ga0496104_0246531 | Ga0496104_0246531_885_1640 | 237 |
| 562 | 3300048907 | Ga0496104_0405554 | Ga0496104_0405554_175_909 | 237 |
| 563 | 3300048909 | Ga0496106_0000740 | Ga0496106_0000740_18964_19698 | 237 |
| 564 | 3300048909 | Ga0496106_0018748 | Ga0496106_0018748_1975_2736 | 237 |
| 565 | 3300048909 | Ga0496106_0019707 | Ga0496106_0019707_2653_3387 | 237 |
| 566 | 3300048909 | Ga0496106_0296176 | Ga0496106_0296176_124_837 | 237 |
| 567 | 3300048909 | Ga0496106_0494628 | Ga0496106_0494628_35_787 | 237 |
| 568 | 3300048910 | Ga0496107_0002930 | Ga0496107_0002930_3455_4216 | 237 |
| 569 | 3300048910 | Ga0496107_0004783 | Ga0496107_0004783_7344_8078 | 237 |
| 570 | 3300048910 | Ga0496107_0033894 | Ga0496107_0033894_63_815 | 237 |
| 571 | 3300048910 | Ga0496107_0090860 | Ga0496107_0090860_432_1205 | 237 |
| 572 | 3300048911 | Ga0496108_0000938 | Ga0496108_0000938_12490_13224 | 237 |
| 573 | 3300048911 | Ga0496108_0199011 | Ga0496108_0199011_289_1044 | 237 |
| 574 | 3300048912 | Ga0496109_0000977 | Ga0496109_0000977_2114_2848 | 237 |
| 575 | 3300048912 | Ga0496109_0200987 | Ga0496109_0200987_193_948 | 237 |
| 576 | 3300048912 | Ga0496109_0224879 | Ga0496109_0224879_448_1203 | 237 |
| 577 | 3300048913 | Ga0496110_0003174 | Ga0496110_0003174_8597_9358 | 237 |
| 578 | 3300048913 | Ga0496110_0147094 | Ga0496110_0147094_1153_1998 | 237 |
| 579 | 3300048913 | Ga0496110_0272332 | Ga0496110_0272332_328_1062 | 237 |
| 580 | 3300048914 | Ga0496111_0043521 | Ga0496111_0043521_1234_1989 | 237 |
| 581 | 3300048914 | Ga0496111_0330929 | Ga0496111_0330929_24_761 | 237 |
| 582 | 3300048915 | Ga0496112_0000590 | Ga0496112_0000590_6296_7030 | 237 |
| 583 | 3300048915 | Ga0496112_0067674 | Ga0496112_0067674_415_1170 | 237 |
| 584 | 3300048915 | Ga0496112_0070093 | Ga0496112_0070093_1545_2300 | 237 |
| 585 | 3300048915 | Ga0496112_0310661 | Ga0496112_0310661_386_1141 | 237 |
| 586 | 3300048916 | Ga0496113_0014433 | Ga0496113_0014433_3831_4565 | 237 |
| 587 | 3300048916 | Ga0496113_0080348 | Ga0496113_0080348_532_1287 | 237 |
| 588 | 3300048916 | Ga0496113_0484088 | Ga0496113_0484088_102_947 | 237 |
| 589 | 3300048917 | Ga0496114_0236009 | Ga0496114_0236009_363_1097 | 237 |
| 590 | 3300048918 | Ga0496115_0003730 | Ga0496115_0003730_6212_6973 | 237 |
| 591 | 3300048918 | Ga0496115_0034314 | Ga0496115_0034314_3091_3846 | 237 |
| 592 | 3300048920 | Ga0496117_0005455 | Ga0496117_0005455_3810_4544 | 237 |
| 593 | 3300048921 | Ga0496118_0001758 | Ga0496118_0001758_27723_28457 | 237 |
| 594 | 3300048922 | Ga0496119_0040839 | Ga0496119_0040839_1015_1770 | 237 |
| 595 | 3300048922 | Ga0496119_0047723 | Ga0496119_0047723_1495_2250 | 237 |
| 596 | 3300048922 | Ga0496119_0192163 | Ga0496119_0192163_136_849 | 237 |
| 597 | 3300048924 | Ga0496121_0000089 | Ga0496121_0000089_217685_218419 | 237 |
| 598 | 3300048924 | Ga0496121_0004013 | Ga0496121_0004013_1400_2134 | 237 |
| 599 | 3300048924 | Ga0496121_0027921 | Ga0496121_0027921_2404_3141 | 237 |
| 600 | 3300048924 | Ga0496121_0064256 | Ga0496121_0064256_1248_2003 | 237 |
| 601 | 3300048924 | Ga0496121_0143040 | Ga0496121_0143040_115_870 | 237 |
| 602 | 3300048924 | Ga0496121_0145075 | Ga0496121_0145075_866_1621 | 237 |
| 603 | 3300048924 | Ga0496121_0150606 | Ga0496121_0150606_610_1383 | 237 |
| 604 | 3300048924 | Ga0496121_0150845 | Ga0496121_0150845_205_960 | 237 |
| 605 | 3300048925 | Ga0496122_0063008 | Ga0496122_0063008_1536_2288 | 237 |
| 606 | 3300048926 | Ga0496123_0125075 | Ga0496123_0125075_536_1288 | 237 |
| 607 | 3300048927 | Ga0496124_0001073 | Ga0496124_0001073_40828_41562 | 237 |
| 608 | 3300048927 | Ga0496124_0174267 | Ga0496124_0174267_348_1103 | 237 |
| 609 | 3300048928 | Ga0496125_0000199 | Ga0496125_0000199_116660_117415 | 237 |
| 610 | 3300048928 | Ga0496125_0000964 | Ga0496125_0000964_330_1085 | 237 |
| 611 | 3300048928 | Ga0496125_0088892 | Ga0496125_0088892_526_1260 | 237 |
| 612 | 3300048929 | Ga0496126_0036354 | Ga0496126_0036354_3344_4078 | 237 |
| 613 | 3300048929 | Ga0496126_0038119 | Ga0496126_0038119_317_1069 | 237 |
| 614 | 3300048929 | Ga0496126_0046484 | Ga0496126_0046484_2614_3348 | 237 |
| 615 | 3300048929 | Ga0496126_0046563 | Ga0496126_0046563_1632_2387 | 237 |
| 616 | 3300048929 | Ga0496126_0097347 | Ga0496126_0097347_1001_1735 | 237 |
| 617 | 3300048929 | Ga0496126_0126845 | Ga0496126_0126845_1350_2111 | 237 |
| 618 | 3300048929 | Ga0496126_0138554 | Ga0496126_0138554_608_1357 | 237 |
| 619 | 3300048929 | Ga0496126_0183917 | Ga0496126_0183917_228_962 | 237 |
| 620 | 3300048929 | Ga0496126_0190677 | Ga0496126_0190677_697_1452 | 237 |
| 621 | 3300049459 | Ga0495678_071311 | Ga0495678_071311_215_970 | 237 |
| 622 | 3300049569 | Ga0501032_0081894 | Ga0501032_0081894_30_785 | 237 |
| 623 | 3300049571 | Ga0501034_0209385 | Ga0501034_0209385_773_1528 | 237 |
| 624 | 3300049572 | Ga0501036_0051917 | Ga0501036_0051917_19_753 | 237 |
| 625 | 3300049572 | Ga0501036_0413587 | Ga0501036_0413587_17_772 | 237 |
| 626 | 3300049573 | Ga0501037_0020258 | Ga0501037_0020258_3312_4067 | 237 |
| 627 | 3300049573 | Ga0501037_0060414 | Ga0501037_0060414_1470_2225 | 237 |
| 628 | 3300049573 | Ga0501037_0271825 | Ga0501037_0271825_67_798 | 237 |
| 629 | 3300049574 | Ga0501038_0003168 | Ga0501038_0003168_11855_12610 | 237 |
| 630 | 3300049574 | Ga0501038_0013686 | Ga0501038_0013686_3722_4477 | 237 |
| 631 | 3300049574 | Ga0501038_0047759 | Ga0501038_0047759_644_1399 | 237 |
| 632 | 3300049574 | Ga0501038_0348908 | Ga0501038_0348908_180_935 | 237 |
| 633 | 3300049575 | Ga0501039_0084531 | Ga0501039_0084531_313_1068 | 237 |
| 634 | 3300049575 | Ga0501039_0186473 | Ga0501039_0186473_303_1058 | 237 |
| 635 | 3300049577 | Ga0501041_0041190 | Ga0501041_0041190_280_1035 | 237 |
| 636 | 3300049578 | Ga0501042_0003280 | Ga0501042_0003280_1095_1850 | 237 |
| 637 | 3300049578 | Ga0501042_0271419 | Ga0501042_0271419_26_781 | 237 |
| 638 | 3300049579 | Ga0501043_0039322 | Ga0501043_0039322_833_1588 | 237 |
| 639 | 3300049579 | Ga0501043_0051727 | Ga0501043_0051727_1164_1919 | 237 |
| 640 | 3300049579 | Ga0501043_0127714 | Ga0501043_0127714_518_1273 | 237 |
| 641 | 3300049580 | Ga0501046_0185115 | Ga0501046_0185115_457_1212 | 237 |
| 642 | 3300049581 | Ga0501047_0064889 | Ga0501047_0064889_1934_2689 | 237 |
| 643 | 3300049581 | Ga0501047_0319027 | Ga0501047_0319027_466_1200 | 237 |
| 644 | 3300049583 | Ga0501067_0051336 | Ga0501067_0051336_594_1349 | 237 |
| 645 | 3300049584 | Ga0501068_0002163 | Ga0501068_0002163_757_1512 | 237 |
| 646 | 3300049587 | Ga0501071_0150775 | Ga0501071_0150775_631_1386 | 237 |
| 647 | 3300049587 | Ga0501071_0213616 | Ga0501071_0213616_336_1091 | 237 |
| 648 | 3300049589 | Ga0501073_0169581 | Ga0501073_0169581_430_1164 | 237 |
| 649 | 3300049590 | Ga0501074_0011129 | Ga0501074_0011129_4340_5095 | 237 |
| 650 | 3300049590 | Ga0501074_0247647 | Ga0501074_0247647_210_941 | 237 |
| 651 | 3300049592 | Ga0501076_0024085 | Ga0501076_0024085_3712_4467 | 237 |
| 652 | 3300049593 | Ga0501077_0022001 | Ga0501077_0022001_275_1030 | 237 |
| 653 | 3300049742 | Ga0501080_0066728 | Ga0501080_0066728_1362_2111 | 237 |
| 654 | 3300049742 | Ga0501080_0177440 | Ga0501080_0177440_983_1738 | 237 |
| 655 | 3300049742 | Ga0501080_0219875 | Ga0501080_0219875_237_992 | 237 |
| 656 | 3300049742 | Ga0501080_0295717 | Ga0501080_0295717_25_756 | 237 |
| 657 | 3300049822 | Ga0501035_0017052 | Ga0501035_0017052_4989_5744 | 237 |
| 658 | 3300049822 | Ga0501035_0088576 | Ga0501035_0088576_812_1567 | 237 |
| 659 | 3300049823 | Ga0501044_0098065 | Ga0501044_0098065_598_1347 | 237 |
| 660 | 3300049823 | Ga0501044_0109545 | Ga0501044_0109545_1646_2401 | 237 |
| 661 | 3300049823 | Ga0501044_0181161 | Ga0501044_0181161_297_1052 | 237 |
| 662 | 3300050491 | nmdc:mga00v17_89867_c1 | nmdc:mga00v17_89867_c1_742_1497 | 237 |
| 663 | 3300050493 | nmdc:mga0k408_45189_c1 | nmdc:mga0k408_45189_c1_1557_2312 | 237 |
| 664 | 3300050493 | nmdc:mga0k408_77948_c1 | nmdc:mga0k408_77948_c1_1083_1796 | 237 |
| 665 | 3300050494 | nmdc:mga06z11_282780_c1 | nmdc:mga06z11_282780_c1_99_812 | 237 |
| 666 | 3300050494 | nmdc:mga06z11_407666_c1 | nmdc:mga06z11_407666_c1_50_805 | 237 |
| 667 | 3300050496 | nmdc:mga07m45_46230_c1 | nmdc:mga07m45_46230_c1_76_789 | 237 |
| 668 | 3300050511 | nmdc:mga08y16_136202_c1 | nmdc:mga08y16_136202_c1_1114_1869 | 237 |
| 669 | 3300050512 | nmdc:mga0n895_18842_c1 | nmdc:mga0n895_18842_c1_689_1423 | 237 |
| 670 | 3300050513 | nmdc:mga0rr50_174308_c1 | nmdc:mga0rr50_174308_c1_371_1126 | 237 |
| 671 | 3300050514 | nmdc:mga08x19_253571_c1 | nmdc:mga08x19_253571_c1_257_991 | 237 |
| 672 | 3300050515 | nmdc:mga0a205_376832_c1 | nmdc:mga0a205_376832_c1_416_1171 | 237 |
| 673 | 3300053077 | Ga0495601_0031878 | Ga0495601_0031878_78_833 | 237 |
| 674 | 3300053077 | Ga0495601_0057472 | Ga0495601_0057472_1217_1990 | 237 |
| 675 | 3300053077 | Ga0495601_0129943 | Ga0495601_0129943_836_1570 | 237 |
| 676 | 3300053077 | Ga0495601_0207496 | Ga0495601_0207496_277_1011 | 237 |
| 677 | 3300053078 | Ga0495612_0013526 | Ga0495612_0013526_136_891 | 237 |
| 678 | 3300053083 | Ga0495655_0002763 | Ga0495655_0002763_477_1232 | 237 |
| 679 | 3300053084 | Ga0495595_0004450 | Ga0495595_0004450_1095_1868 | 237 |
| 680 | 3300053084 | Ga0495595_0016779 | Ga0495595_0016779_1820_2575 | 237 |
| 681 | 3300053085 | Ga0495619_0001280 | Ga0495619_0001280_11363_12136 | 237 |
| 682 | 3300053085 | Ga0495619_0222484 | Ga0495619_0222484_62_817 | 237 |
| 683 | 3300053085 | Ga0495619_0289819 | Ga0495619_0289819_49_804 | 237 |
| 684 | 3300053085 | Ga0495619_0524069 | Ga0495619_0524069_63_797 | 237 |
| 685 | 3300053090 | Ga0500646_0044954 | Ga0500646_0044954_166_921 | 237 |
| 686 | 3300053091 | Ga0500647_0030111 | Ga0500647_0030111_1380_2114 | 237 |
| 687 | 3300053092 | Ga0500583_0228905 | Ga0500583_0228905_122_862 | 237 |
| 688 | 3300053094 | Ga0500566_0000046 | Ga0500566_0000046_38224_38964 | 237 |
| 689 | 3300053094 | Ga0500566_0096422 | Ga0500566_0096422_536_1270 | 237 |
| 690 | 3300053096 | Ga0500641_0001509 | Ga0500641_0001509_6559_7314 | 237 |
| 691 | 3300053096 | Ga0500641_0058753 | Ga0500641_0058753_809_1564 | 237 |
| 692 | 3300053102 | Ga0500554_001571 | Ga0500554_001571_1802_2536 | 237 |
| 693 | 3300053119 | Ga0500595_009512 | Ga0500595_009512_576_1289 | 237 |
| 694 | 3300053119 | Ga0500595_014720 | Ga0500595_014720_764_1498 | 237 |
| 695 | 3300053130 | Ga0500642_0159753 | Ga0500642_0159753_177_926 | 237 |
| 696 | 3300053131 | Ga0500652_109798 | Ga0500652_109798_267_980 | 237 |
| 697 | 3300053136 | Ga0500559_0001633 | Ga0500559_0001633_10963_11703 | 237 |
| 698 | 3300053139 | Ga0500568_0051503 | Ga0500568_0051503_204_947 | 237 |
| 699 | 3300053142 | Ga0500577_0113997 | Ga0500577_0113997_368_1081 | 237 |
| 700 | 3300053146 | Ga0500588_0065533 | Ga0500588_0065533_241_996 | 237 |
| 701 | 3300053150 | Ga0500603_000071 | Ga0500603_000071_11053_11793 | 237 |
| 702 | 3300053150 | Ga0500603_000328 | Ga0500603_000328_135_869 | 237 |
| 703 | 3300053160 | Ga0500633_0048777 | Ga0500633_0048777_94_849 | 237 |
| 704 | 3300053163 | Ga0500639_000009 | Ga0500639_000009_130469_131209 | 237 |
| 705 | 3300053177 | Ga0500636_0026626 | Ga0500636_0026626_84_818 | 237 |
| 706 | 3300053178 | Ga0500637_0001994 | Ga0500637_0001994_3241_3975 | 237 |
| 707 | 3300053178 | Ga0500637_0051276 | Ga0500637_0051276_319_1074 | 237 |
| 708 | 3300053178 | Ga0500637_0158607 | Ga0500637_0158607_179_925 | 237 |
| 709 | 3300053731 | Ga0500609_006359 | Ga0500609_006359_640_1353 | 237 |
| 710 | 3300054114 | Ga0501084_0498017 | Ga0501084_0498017_192_947 | 237 |
| 711 | 3300060353 | Ga0501082_0192295 | Ga0501082_0192295_185_940 | 237 |
| 712 | 3300061719 | Ga0466962_0239302 | Ga0466962_0239302_96_830 | 237 |
| 713 | 3300061734 | Ga0530510_0323810 | Ga0530510_0323810_382_1137 | 237 |
| 714 | iso_pu_bacteria | 2508501128 | 2509151028 | 237 |
| 715 | iso_pu_bacteria | 2513237096 | 2513657292 | 237 |
| 716 | iso_pu_bacteria | 2513237098 | 2513678787 | 237 |
| 717 | iso_pu_bacteria | 2513237104 | 2513722073 | 237 |
| 718 | iso_pu_bacteria | 2513237137 | 2513857763 | 237 |
| 719 | iso_pu_bacteria | 2513237145 | 2513919300 | 237 |
| 720 | iso_pu_bacteria | 2517572143 | 2517891008 | 237 |
| 721 | iso_pu_bacteria | 2524023205 | 2524441219 | 237 |
| 722 | iso_pu_bacteria | 2524023210 | 2524464977 | 237 |
| 723 | iso_pu_bacteria | 2524023228 | 2524537547 | 237 |
| 724 | iso_pu_bacteria | 2667528175 | 2671120075 | 237 |
| 725 | iso_pu_bacteria | 2728368998 | 2728752655 | 237 |
| 726 | iso_pu_bacteria | 2744054633 | 2745078680 | 237 |
| 727 | iso_pu_bacteria | 2791355197 | 2793066364 | 237 |
| 728 | iso_pu_bacteria | 2791355199 | 2793080692 | 237 |
| 729 | iso_pu_bacteria | 2879110137 | 2879110883 | 237 |
| 730 | iso_pu_bacteria | 2885374607 | 2885377329 | 237 |
| 731 | iso_pu_bacteria | 2885383462 | 2885390525 | 237 |
| 732 | iso_pu_bacteria | 2889033259 | 2889037633 | 237 |
| 733 | iso_pu_bacteria | 2903748898 | 2903749659 | 237 |
| 734 | iso_pu_bacteria | 2903768456 | 2903773686 | 237 |
| 735 | iso_pu_bacteria | 2904690495 | 2904694466 | 237 |
| 736 | iso_pu_bacteria | 2904699407 | 2904700539 | 237 |
| 737 | iso_pu_bacteria | 2906610324 | 2906616207 | 237 |
| 738 | iso_pu_bacteria | 2906635258 | 2906636950 | 237 |
| 739 | iso_pu_bacteria | 2906660503 | 2906664456 | 237 |
| 740 | iso_pu_bacteria | 2908739725 | 2908741275 | 237 |
| 741 | iso_pu_bacteria | 2908756301 | 2908763398 | 237 |
| 742 | iso_pu_bacteria | 2922361189 | 2922361592 | 237 |
| 743 | iso_pu_bacteria | 2922386360 | 2922387182 | 237 |
| 744 | iso_pu_bacteria | 2922425934 | 2922431817 | 237 |
| 745 | iso_pu_bacteria | 2935630451 | 2935635341 | 237 |
| 746 | iso_pu_bacteria | 2941507105 | 2941512145 | 237 |
| 747 | iso_pu_bacteria | 2941515067 | 2941519847 | 237 |
| 748 | iso_pu_bacteria | 2941523033 | 2941527866 | 237 |
| 749 | iso_pu_bacteria | 3005474847 | 3005481758 | 237 |
| 750 | iso_pu_bacteria | 8006933436 | 8006939112 | 237 |
| 751 | iso_pu_bacteria | 8006964411 | 8006972354 | 237 |
| 752 | iso_pu_bacteria | 8006973647 | 8006978769 | 237 |
| 753 | iso_pu_bacteria | 8019555841 | 8019559935 | 237 |
| 754 | iso_pu_bacteria | 8019565922 | 8019570038 | 237 |
| 755 | iso_pu_bacteria | 8056673599 | 8056678767 | 237 |
| 756 | iso_pu_bacteria | 8056681323 | 8056687840 | 237 |
| 757 | iso_pu_bacteria | 8056689827 | 8056690503 | 237 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6th6-assembly1.cif.gz_Ae | cryo-em structure of t. kodakarensis 70s ribosome | 0.9519 | 2 | 40 |
| 8d8k-assembly1.cif.gz_D | yeast mitochondrial small subunit assembly intermediate (state 2) | 0.9378 | 2 | 41 |
| 8d8l-assembly1.cif.gz_D | yeast mitochondrial small subunit assembly intermediate (state 3) | 0.9374 | 2 | 41 |
| 3jbn-assembly1.cif.gz_E | cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to p-trna | 0.9371 | 2 | 40 |
| 7zag-assembly1.cif.gz_D | cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. | 0.9353 | 2 | 40 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2janC03 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9517 | 1 | 41 | 3.10.290.10 |
| af_Q9LSV5_49_110_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9255 | 2 | 48 | 3.10.290.10 |
| af_C0P590_106_292_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9236 | 61 | 235 | 3.40.50.150 |
| 3opnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9233 | 52 | 236 | 3.40.50.150 |
| af_Q8I5D3_12_67_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9226 | 1 | 48 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A453HFZ1-F1-model_v4 | Ribosomal RNA methyltransferase FtsJ domain-containing protein | 0.9522 | 58 | 151 |
GO:0008168
GO:0032259 |
| AF-A0A7C3U522-F1-model_v4 | TlyA family RNA methyltransferase | 0.9517 | 71 | 236 |
GO:0008168
GO:0032259 |
| AF-A0A6J7LEE1-F1-model_v4 | Unannotated protein | 0.9487 | 70 | 236 |
GO:0008168
GO:0032259 |
| AF-A0A0W8G7W9-F1-model_v4 | Rna binding methyltransferase ftsj like | 0.9454 | 65 | 235 |
GO:0008168
GO:0032259 |
| AF-A0A7Z9ZZR2-F1-model_v4 | TlyA family RNA methyltransferase | 0.9405 | 64 | 234 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar