F479417

General Info

Members Datasets Scaffolds Average Seq Length
757 403 713 247

Family's Representative Sequence

Representative Sequence 3300048913|Ga0496110_0147094|Ga0496110_0147094_1153_1998
Length 281
Sequence VRVCPSDRPLPIAPAAKAIGGCASAAIALNPAEGEAMMLPARKRADVLLVERGLFESRARAQAAIEAGLVTANGKAVAKPSETIATDAVLQAQAAHPFVSRGGVKLAGAQEQYPIDIEGHVCLDVGASTGGFTEVLLANGASLVFAIDVGREQMHPSLRGHPKVVSMEETDIRDFEGKRLPMRPDVVVIDVSFVSLKAVLPVALSLAAAPMHLLALIKPQFEAARKHSKRGIIRNAMVHQQICDDIAEFAASLGCSDIKVFPSSITGGDGNIEFFIGARRG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
12 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
13 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
14 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
15 2791355199
16 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
17 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
18 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
19 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
22 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
23 2904699407
24 2906610324
25 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
26 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
27 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
28 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
29 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
30 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
31 2922425934
32 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
33 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
34 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
35 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
36 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
44 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
107 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
108 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
109 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
193 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
218 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
235 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
236 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
246 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
252 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
308 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
330 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
331 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
332 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
336 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
367 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
368 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
372 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
377 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
378 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
383 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
384 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
385 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
386 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
387 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
390 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
396 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
397 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
398 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
399 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
400 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
401 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
402 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
403 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0.13
Isolates 5.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 4.89
Rhizoplane 6.08
Rhizosphere 73.84
Stem 0
Stem Tuber 0
Unclassified 8.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004213 3300003215 Bacteria 7795
2 JGI25404J52841_10013554 3300003659 Bacteria 1768
3 Ga0070658_10023061 3300005327 Bacteria 4997
4 Ga0070683_100002376 3300005329 Bacteria 14933
5 Ga0070683_100039720 3300005329 Bacteria 4322
6 Ga0068869_100053873 3300005334 Bacteria 2926
7 Ga0068869_100109397 3300005334 Bacteria 2100
8 Ga0070680_100101164 3300005336 Bacteria 2392
9 Ga0070680_100184226 3300005336 Bacteria 1759
10 Ga0070680_100294063 3300005336 Bacteria 1377
11 Ga0070680_100401665 3300005336 Bacteria 1168
12 Ga0070682_100051594 3300005337 Bacteria 2571
13 Ga0068868_100041269 3300005338 Bacteria 3595
14 Ga0070660_100011623 3300005339 Bacteria 6266
15 Ga0070660_100146256 3300005339 Bacteria 1898
16 Ga0070660_100438281 3300005339 Bacteria 1083
17 Ga0070691_10015392 3300005341 Bacteria 3515
18 Ga0070687_100068743 3300005343 Bacteria 1895
19 Ga0070661_100121680 3300005344 Bacteria 1955
20 Ga0070692_10351844 3300005345 Bacteria 916
21 Ga0070668_100392405 3300005347 Bacteria 1183
22 Ga0070668_100418139 3300005347 Bacteria 1147
23 Ga0070669_100099354 3300005353 Bacteria 2193
24 Ga0070671_100036389 3300005355 Bacteria 4082
25 Ga0070671_100300834 3300005355 Bacteria 1366
26 Ga0070674_100133845 3300005356 Bacteria 1852
27 Ga0070673_100433193 3300005364 Bacteria 1180
28 Ga0070688_100141458 3300005365 Bacteria 1635
29 Ga0070659_100024121 3300005366 Bacteria 4661
30 Ga0070659_100076973 3300005366 Bacteria 2660
31 Ga0070659_100237090 3300005366 Bacteria 1508
32 Ga0070709_10005136 3300005434 Bacteria 7082
33 Ga0070714_100030939 3300005435 Bacteria 4460
34 Ga0070714_100054028 3300005435 Bacteria 3430
35 Ga0070714_100062126 3300005435 Bacteria 3210
36 Ga0070714_100203092 3300005435 Bacteria 1813
37 Ga0070714_100426475 3300005435 Bacteria 1257
38 Ga0070713_100006818 3300005436 Bacteria 7958
39 Ga0070713_100116181 3300005436 Bacteria 2340
40 Ga0070713_100121600 3300005436 Bacteria 2291
41 Ga0070713_100215148 3300005436 Bacteria 1741
42 Ga0070713_100286579 3300005436 Bacteria 1512
43 Ga0070710_10006463 3300005437 Bacteria 5633
44 Ga0070710_10021427 3300005437 Bacteria 3369
45 Ga0070710_10098276 3300005437 Bacteria 1739
46 Ga0070711_100001065 3300005439 Bacteria 14649
47 Ga0070711_100010729 3300005439 Bacteria 5678
48 Ga0070711_100321816 3300005439 Bacteria 1236
49 Ga0070708_100363178 3300005445 Bacteria 1365
50 Ga0070663_100023081 3300005455 Bacteria 4165
51 Ga0070663_100329952 3300005455 Bacteria 1229
52 Ga0070678_100031818 3300005456 Bacteria 3644
53 Ga0070678_100042358 3300005456 Bacteria 3235
54 Ga0070678_100318952 3300005456 Bacteria 1326
55 Ga0070662_100163692 3300005457 Bacteria 1741
56 Ga0070681_10130390 3300005458 Bacteria 2446
57 Ga0070681_10135762 3300005458 Bacteria 2391
58 Ga0070706_100143695 3300005467 Bacteria 2228
59 Ga0070707_100037942 3300005468 Bacteria 4600
60 Ga0070698_100283818 3300005471 Bacteria 1587
61 Ga0070679_100160275 3300005530 Bacteria 2224
62 Ga0070684_100009910 3300005535 Bacteria 7529
63 Ga0070684_100032347 3300005535 Bacteria 4457
64 Ga0070697_100061661 3300005536 Bacteria 3059
65 Ga0070697_100100186 3300005536 Bacteria 2406
66 Ga0068853_100178979 3300005539 Bacteria 1922
67 Ga0068853_100188553 3300005539 Bacteria 1873
68 Ga0068853_100275033 3300005539 Bacteria 1551
69 Ga0068853_100782604 3300005539 Bacteria 913
70 Ga0070693_100054174 3300005547 Bacteria 2305
71 Ga0070665_100053304 3300005548 Bacteria 4056
72 Ga0070665_100080605 3300005548 Bacteria 3261
73 Ga0070665_100097774 3300005548 Bacteria 2940
74 Ga0070665_100210330 3300005548 Bacteria 1946
75 Ga0070665_100243303 3300005548 Bacteria 1799
76 Ga0070665_100248399 3300005548 Bacteria 1780
77 Ga0070665_100298908 3300005548 Bacteria 1612
78 Ga0068855_100010142 3300005563 Bacteria 11353
79 Ga0068855_100100282 3300005563 Bacteria 3334
80 Ga0068855_100119566 3300005563 Bacteria 3016
81 Ga0068855_100320690 3300005563 Bacteria 1713
82 Ga0068855_100356840 3300005563 Bacteria 1609
83 Ga0070664_100075491 3300005564 Bacteria 2895
84 Ga0070664_100422469 3300005564 Bacteria 1221
85 Ga0068857_100134758 3300005577 Bacteria 2230
86 Ga0068857_100537861 3300005577 Bacteria 1100
87 Ga0068856_100084211 3300005614 Bacteria 3158
88 Ga0068856_100096878 3300005614 Bacteria 2939
89 Ga0068856_100149968 3300005614 Bacteria 2340
90 Ga0068856_100404812 3300005614 Bacteria 1384
91 Ga0068852_100078071 3300005616 Bacteria 2929
92 Ga0068852_100342278 3300005616 Bacteria 1458
93 Ga0068864_100073721 3300005618 Bacteria 2976
94 Ga0068861_100027741 3300005719 Bacteria 4128
95 Ga0068851_10055833 3300005834 Bacteria 2013
96 Ga0068851_10240303 3300005834 Bacteria 1024
97 Ga0068870_10236031 3300005840 Bacteria 1127
98 Ga0068863_100222523 3300005841 Bacteria 1819
99 Ga0068863_100695341 3300005841 Bacteria 1010
100 Ga0068860_100000101 3300005843 Bacteria 142856
101 Ga0068862_100111617 3300005844 Bacteria 2400
102 Ga0081455_10011564 3300005937 Bacteria 8858
103 Ga0081538_10033376 3300005981 Bacteria 3428
104 Ga0081540_1016848 3300005983 Bacteria 4551
105 Ga0081540_1017020 3300005983 Bacteria 4518
106 Ga0081539_10039335 3300005985 Bacteria 2792
107 Ga0070717_10003637 3300006028 Bacteria 11057
108 Ga0070717_10036762 3300006028 Bacteria 3973
109 Ga0070717_10110378 3300006028 Bacteria 2345
110 Ga0070717_10182680 3300006028 Bacteria 1829
111 Ga0070715_10012718 3300006163 Bacteria 3072
112 Ga0070716_100003831 3300006173 Bacteria 7138
113 Ga0070716_100195616 3300006173 Bacteria 1340
114 Ga0070712_100034259 3300006175 Bacteria 3440
115 Ga0070712_100035835 3300006175 Bacteria 3371
116 Ga0070712_100047302 3300006175 Bacteria 2977
117 Ga0070712_100142349 3300006175 Bacteria 1832
118 Ga0075362_10030838 3300006177 Bacteria 2316
119 Ga0075367_10091566 3300006178 Bacteria 1850
120 Ga0075367_10109936 3300006178 Bacteria 1691
121 Ga0075369_10053052 3300006186 Bacteria 1758
122 Ga0075366_10082877 3300006195 Bacteria 1916
123 Ga0075370_10056629 3300006353 Bacteria 2228
124 Ga0075370_10218362 3300006353 Bacteria 1126
125 Ga0068871_100013006 3300006358 Bacteria 6165
126 Ga0075430_100274245 3300006846 Bacteria 1396
127 Ga0075434_100006666 3300006871 Bacteria 10600
128 Ga0075434_100133722 3300006871 Bacteria 2500
129 Ga0068865_100107794 3300006881 Bacteria 2049
130 Ga0097620_100408070 3300006931 Bacteria 1454
131 Ga0099824_1006668 3300006942 Bacteria 15714
132 Ga0099822_1000663 3300006943 Bacteria 34548
133 Ga0099794_10004750 3300007265 Bacteria 5382
134 Ga0099794_10010664 3300007265 Bacteria 3908
135 Ga0099794_10072307 3300007265 Bacteria 1690
136 Ga0099794_10211785 3300007265 Bacteria 994
137 Ga0099795_10040757 3300007788 Bacteria 1651
138 Ga0105240_10032506 3300009093 Bacteria 6755
139 Ga0105240_10257882 3300009093 Bacteria 2013
140 Ga0105240_10297895 3300009093 Bacteria 1846
141 Ga0111539_10177063 3300009094 Bacteria 2492
142 Ga0105245_10011127 3300009098 Bacteria 7831
143 Ga0105245_10016868 3300009098 Bacteria 6375
144 Ga0105247_10019655 3300009101 Bacteria 4056
145 Ga0105247_10117210 3300009101 Bacteria 1721
146 Ga0105243_10048436 3300009148 Bacteria 3350
147 Ga0105243_10403329 3300009148 Bacteria 1271
148 Ga0105241_10029647 3300009174 Bacteria 4084
149 Ga0105242_10316387 3300009176 Bacteria 1430
150 Ga0105248_10178264 3300009177 Bacteria 2395
151 Ga0105237_10054501 3300009545 Bacteria 4007
152 Ga0105237_10153004 3300009545 Bacteria 2303
153 Ga0105237_10303183 3300009545 Bacteria 1601
154 Ga0105237_10333240 3300009545 Bacteria 1522
155 Ga0105238_10003279 3300009551 Bacteria 16156
156 Ga0105238_10027788 3300009551 Bacteria 5765
157 Ga0105238_10094819 3300009551 Bacteria 2972
158 Ga0105238_10413754 3300009551 Bacteria 1342
159 Ga0105249_10215687 3300009553 Bacteria 1886
160 Ga0105239_10080497 3300010375 Bacteria 3584
161 Ga0105239_10182631 3300010375 Bacteria 2347
162 Ga0105239_11122421 3300010375 Bacteria 905
163 Ga0105246_10066670 3300011119 Bacteria 2521
164 Ga0105246_10200344 3300011119 Bacteria 1551
165 Ga0157373_10039405 3300013100 Bacteria 3383
166 Ga0157370_10013258 3300013104 Bacteria 8495
167 Ga0157370_10261721 3300013104 Bacteria 1599
168 Ga0157369_10014404 3300013105 Bacteria 8930
169 Ga0157369_10402758 3300013105 Bacteria 1419
170 Ga0157369_10611312 3300013105 Bacteria 1125
171 Ga0157374_10041407 3300013296 Bacteria 4245
172 Ga0157374_10441365 3300013296 Bacteria 1302
173 Ga0157378_10194808 3300013297 Bacteria 1914
174 Ga0163162_10031760 3300013306 Bacteria 5239
175 Ga0163162_10122697 3300013306 Bacteria 2703
176 Ga0163162_10369150 3300013306 Bacteria 1568
177 Ga0157372_10083592 3300013307 Bacteria 3616
178 Ga0157375_10008782 3300013308 Bacteria 8855
179 Ga0157375_11032035 3300013308 Bacteria 961
180 Ga0163163_10097774 3300014325 Bacteria 2956
181 Ga0182008_10217802 3300014497 Bacteria 976
182 Ga0157379_10082727 3300014968 Bacteria 2876
183 Ga0157376_10034599 3300014969 Bacteria 4081
184 Ga0213872_10029655 3300021361 Bacteria 2509
185 Ga0213872_10090683 3300021361 Bacteria 1368
186 Ga0213874_10016941 3300021377 Bacteria 1948
187 Ga0213876_10220419 3300021384 Bacteria 1008
188 Ga0213871_10001561 3300021441 Bacteria 3887
189 Ga0209233_1005435 3300025261 Bacteria 4227
190 Ga0209758_1003178 3300025297 Bacteria 15387
191 Ga0209758_1014636 3300025297 Bacteria 4152
192 Ga0207656_10075860 3300025321 Bacteria 1503
193 Ga0207682_10197215 3300025893 Bacteria 925
194 Ga0207692_10063188 3300025898 Bacteria 1924
195 Ga0207642_10031730 3300025899 Bacteria 2216
196 Ga0207642_10041436 3300025899 Bacteria 2016
197 Ga0207710_10121530 3300025900 Bacteria 1248
198 Ga0207710_10266381 3300025900 Bacteria 860
199 Ga0207685_10028399 3300025905 Bacteria 1970
200 Ga0207699_10027370 3300025906 Bacteria 3156
201 Ga0207699_10056996 3300025906 Bacteria 2332
202 Ga0207699_10070555 3300025906 Bacteria 2133
203 Ga0207699_10337654 3300025906 Bacteria 1061
204 Ga0207705_10017157 3300025909 Bacteria 5186
205 Ga0207684_10261364 3300025910 Bacteria 1494
206 Ga0207654_10098056 3300025911 Bacteria 1800
207 Ga0207707_10028363 3300025912 Bacteria 4893
208 Ga0207707_10032980 3300025912 Bacteria 4533
209 Ga0207707_10118799 3300025912 Bacteria 2310
210 Ga0207707_10128284 3300025912 Bacteria 2218
211 Ga0207695_10015132 3300025913 Bacteria 9101
212 Ga0207695_10099178 3300025913 Bacteria 2911
213 Ga0207671_10046204 3300025914 Bacteria 3221
214 Ga0207671_10095419 3300025914 Bacteria 2246
215 Ga0207671_10661420 3300025914 Bacteria 832
216 Ga0207693_10003158 3300025915 Bacteria 14168
217 Ga0207693_10029632 3300025915 Bacteria 4321
218 Ga0207693_10057236 3300025915 Bacteria 3056
219 Ga0207693_10067345 3300025915 Bacteria 2804
220 Ga0207693_10114691 3300025915 Bacteria 2114
221 Ga0207663_10000261 3300025916 Bacteria 22957
222 Ga0207663_10016206 3300025916 Bacteria 4126
223 Ga0207663_10100024 3300025916 Bacteria 1945
224 Ga0207660_10006085 3300025917 Bacteria 7831
225 Ga0207660_10086833 3300025917 Bacteria 2310
226 Ga0207660_10097559 3300025917 Bacteria 2190
227 Ga0207660_10112333 3300025917 Bacteria 2052
228 Ga0207662_10152089 3300025918 Bacteria 1472
229 Ga0207657_10002700 3300025919 Bacteria 19128
230 Ga0207657_10092065 3300025919 Bacteria 2527
231 Ga0207652_10064850 3300025921 Bacteria 3161
232 Ga0207652_10210735 3300025921 Bacteria 1750
233 Ga0207652_10227425 3300025921 Bacteria 1681
234 Ga0207652_10469074 3300025921 Bacteria 1134
235 Ga0207652_10755826 3300025921 Bacteria 865
236 Ga0207646_10222946 3300025922 Bacteria 1703
237 Ga0207681_10115055 3300025923 Bacteria 1963
238 Ga0207694_10030821 3300025924 Bacteria 4094
239 Ga0207694_10084301 3300025924 Bacteria 2500
240 Ga0207694_10116430 3300025924 Bacteria 2130
241 Ga0207694_10162284 3300025924 Bacteria 1806
242 Ga0207687_10082362 3300025927 Bacteria 2328
243 Ga0207700_10005839 3300025928 Bacteria 7395
244 Ga0207700_10040740 3300025928 Bacteria 3392
245 Ga0207700_10056073 3300025928 Bacteria 2965
246 Ga0207700_10102973 3300025928 Bacteria 2281
247 Ga0207700_10164232 3300025928 Bacteria 1846
248 Ga0207700_10178218 3300025928 Bacteria 1778
249 Ga0207664_10063952 3300025929 Bacteria 2941
250 Ga0207664_10246784 3300025929 Bacteria 1556
251 Ga0207664_10317121 3300025929 Bacteria 1375
252 Ga0207664_10351326 3300025929 Bacteria 1305
253 Ga0207644_10074360 3300025931 Bacteria 2494
254 Ga0207706_10172639 3300025933 Bacteria 1900
255 Ga0207686_10083003 3300025934 Bacteria 2096
256 Ga0207669_10209159 3300025937 Bacteria 1422
257 Ga0207704_10360061 3300025938 Bacteria 1135
258 Ga0207665_10000280 3300025939 Bacteria 35528
259 Ga0207665_10025582 3300025939 Bacteria 3895
260 Ga0207665_10122152 3300025939 Bacteria 1841
261 Ga0207691_10075400 3300025940 Bacteria 3041
262 Ga0207691_10198491 3300025940 Bacteria 1747
263 Ga0207689_10074481 3300025942 Bacteria 2790
264 Ga0207661_10000532 3300025944 Bacteria 24432
265 Ga0207661_10002592 3300025944 Bacteria 12429
266 Ga0207661_10256249 3300025944 Bacteria 1557
267 Ga0207679_10076779 3300025945 Bacteria 2539
268 Ga0207679_10151350 3300025945 Bacteria 1889
269 Ga0207679_10554811 3300025945 Bacteria 1031
270 Ga0207667_10010882 3300025949 Bacteria 10609
271 Ga0207667_10027486 3300025949 Bacteria 6191
272 Ga0207712_10095142 3300025961 Bacteria 2202
273 Ga0207668_10045470 3300025972 Bacteria 2994
274 Ga0207677_10080989 3300026023 Bacteria 2328
275 Ga0207677_10862502 3300026023 Bacteria 814
276 Ga0207703_10053309 3300026035 Bacteria 3287
277 Ga0207639_10106811 3300026041 Bacteria 2273
278 Ga0207639_10134900 3300026041 Bacteria 2048
279 Ga0207639_10226902 3300026041 Bacteria 1616
280 Ga0207678_10041308 3300026067 Bacteria 3999
281 Ga0207678_10089150 3300026067 Bacteria 2636
282 Ga0207678_10545651 3300026067 Bacteria 1014
283 Ga0207678_10617478 3300026067 Bacteria 951
284 Ga0207708_10072759 3300026075 Bacteria 2634
285 Ga0207708_10159047 3300026075 Bacteria 1783
286 Ga0207702_10047033 3300026078 Bacteria 3634
287 Ga0207702_10203546 3300026078 Bacteria 1836
288 Ga0207676_10070281 3300026095 Bacteria 2807
289 Ga0207676_10123771 3300026095 Bacteria 2185
290 Ga0207674_10032600 3300026116 Bacteria 5463
291 Ga0207674_10565833 3300026116 Bacteria 1098
292 Ga0207675_100024689 3300026118 Bacteria 5590
293 Ga0207675_100062798 3300026118 Bacteria 3470
294 Ga0207675_100160430 3300026118 Bacteria 2144
295 Ga0207675_100244314 3300026118 Bacteria 1735
296 Ga0207683_10019717 3300026121 Bacteria 5762
297 Ga0207683_10160370 3300026121 Bacteria 2033
298 Ga0207698_10017361 3300026142 Bacteria 4879
299 Ga0207698_10150001 3300026142 Bacteria 2022
300 Ga0207698_10464639 3300026142 Bacteria 1224
301 Ga0209589_1000006 3300027357 Bacteria 436292
302 Ga0209489_100007 3300027361 Bacteria 436292
303 Ga0209700_100008 3300027363 Bacteria 436292
304 Ga0209588_1000499 3300027671 Bacteria 10047
305 Ga0268266_10016781 3300028379 Bacteria 6259
306 Ga0268266_10241277 3300028379 Bacteria 1668
307 Ga0268266_10344904 3300028379 Bacteria 1398
308 Ga0268265_10052898 3300028380 Bacteria 3073
309 Ga0268265_10084226 3300028380 Bacteria 2520
310 Ga0268265_10182911 3300028380 Bacteria 1802
311 Ga0268264_10000030 3300028381 Bacteria 418542
312 Ga0268264_10159718 3300028381 Bacteria 2029
313 Ga0307517_10000744 3300028786 Bacteria 56253
314 Ga0307515_10088090 3300028794 Bacteria 3929
315 Ga0265330_10006427 3300031235 Bacteria 5809
316 Ga0265330_10009777 3300031235 Bacteria 4544
317 Ga0265328_10080780 3300031239 Bacteria 1198
318 Ga0265340_10023276 3300031247 Bacteria 3160
319 Ga0265340_10026436 3300031247 Bacteria 2934
320 Ga0265339_10009136 3300031249 Bacteria 6257
321 Ga0265339_10011293 3300031249 Bacteria 5508
322 Ga0265331_10074521 3300031250 Bacteria 1584
323 Ga0307513_10296943 3300031456 Bacteria 1384
324 Ga0307509_10079363 3300031507 Bacteria 3397
325 Ga0307508_10000051 3300031616 Bacteria 134500
326 Ga0307508_10232304 3300031616 Bacteria 1442
327 Ga0265314_10078319 3300031711 Bacteria 2189
328 Ga0265342_10017850 3300031712 Bacteria 4606
329 Ga0265342_10092712 3300031712 Bacteria 1730
330 Ga0307516_10029187 3300031730 Bacteria 5577
331 Ga0307410_10173039 3300031852 Bacteria 1629
332 Ga0307406_10195330 3300031901 Bacteria 1485
333 Ga0307412_10204522 3300031911 Bacteria 1502
334 Ga0307411_10091699 3300032005 Bacteria 2123
335 Ga0307415_100028863 3300032126 Bacteria 3537
336 Ga0307507_10007677 3300033179 Bacteria 15449
337 Ga0307510_10024689 3300033180 Bacteria 6943
338 Ga0315911_1000003 3300033442 Bacteria 502217
339 Ga0316215_1000756 3300033544 Bacteria 3282
340 Ga0373926_0007807 3300035083 Bacteria 3564
341 Ga0373934_0000907 3300035086 Bacteria 10705
342 Ga0373944_0026229 3300035089 Bacteria 1720
343 Ga0373923_0002765 3300035111 Bacteria 5481
344 Ga0373936_0011613 3300035113 Bacteria 3340
345 Ga0373936_0022195 3300035113 Bacteria 2472
346 Ga0373945_0051470 3300035116 Bacteria 1515
347 Ga0373953_0016673 3300035117 Bacteria 2686
348 Ga0373953_0073895 3300035117 Bacteria 1410
349 Ga0373954_0007936 3300035118 Bacteria 4650
350 Ga0373954_0040759 3300035118 Bacteria 2164
351 Ga0373954_0050887 3300035118 Bacteria 1944
352 Ga0373954_0103775 3300035118 Bacteria 1372
353 Ga0373956_0081619 3300035119 Bacteria 1484
354 Ga0373957_0067375 3300035120 Bacteria 1395
355 Ga0373943_0016035 3300035170 Bacteria 3412
356 Ga0373943_0051712 3300035170 Bacteria 2024
357 Ga0373943_0083857 3300035170 Bacteria 1639
358 Ga0373943_0140326 3300035170 Bacteria 1301
359 Ga0373946_0154492 3300035171 Bacteria 1073
360 Ga0373955_0040004 3300035172 Bacteria 2505
361 Ga0373955_0058865 3300035172 Bacteria 2114
362 Ga0373955_0142564 3300035172 Bacteria 1406
363 Ga0373924_0003083 3300035410 Bacteria 5689
364 Ga0373924_0022158 3300035410 Bacteria 2482
365 Ga0373924_0091753 3300035410 Bacteria 1300
366 Ga0373931_0349001 3300035691 Bacteria 926
367 Ga0373935_0035466 3300035692 Bacteria 3114
368 Ga0373935_0131415 3300035692 Bacteria 1682
369 Ga0373927_0013792 3300035695 Bacteria 5364
370 Ga0373927_0014122 3300035695 Bacteria 5296
371 Ga0373927_0021149 3300035695 Bacteria 4262
372 Ga0373927_0086692 3300035695 Bacteria 2032
373 Ga0373927_0087324 3300035695 Bacteria 2024
374 Ga0373927_0143422 3300035695 Bacteria 1563
375 Ga0373927_0154369 3300035695 Bacteria 1503
376 Ga0373927_0170553 3300035695 Bacteria 1426
377 Ga0373933_0007801 3300035724 Bacteria 5847
378 Ga0373947_0010871 3300035725 Bacteria 5224
379 Ga0373947_0014913 3300035725 Bacteria 4460
380 Ga0373947_0015785 3300035725 Bacteria 4337
381 Ga0373947_0047088 3300035725 Bacteria 2583
382 Ga0373947_0569474 3300035725 Bacteria 771
383 Ga0373937_0014045 3300036401 Bacteria 7062
384 Ga0373937_0024360 3300036401 Bacteria 5457
385 Ga0373937_0668975 3300036401 Bacteria 984
386 Ga0372808_002808 3300036459 Bacteria 2060
387 Ga0373925_0029763 3300037068 Bacteria 4006
388 Ga0373925_0048085 3300037068 Bacteria 3177
389 Ga0373925_0054307 3300037068 Bacteria 2996
390 Ga0395899_0283966 3300037312 Bacteria 1125
391 Ga0395900_0007637 3300037418 Bacteria 11163
392 Ga0395900_0114406 3300037418 Bacteria 2769
393 Ga0395900_0400035 3300037418 Bacteria 1338
394 Ga0395898_0025630 3300037466 Bacteria 5940
395 Ga0395898_0032258 3300037466 Bacteria 5228
396 Ga0395905_0082234 3300037471 Bacteria 3018
397 Ga0436364_1423996 3300037853 Bacteria 5123
398 Ga0395901_0136742 3300038443 Bacteria 2575
399 Ga0395901_0228139 3300038443 Bacteria 1945
400 Ga0395901_0242841 3300038443 Bacteria 1878
401 Ga0395901_0578620 3300038443 Bacteria 1135
402 Ga0436365_0615168 3300039437 Bacteria 1018
403 Ga0436365_1781661 3300039437 Bacteria 1790
404 Ga0436365_1883906 3300039437 Bacteria 1355
405 Ga0436360_0770248 3300039438 Bacteria 2660
406 Ga0436360_1259955 3300039438 Bacteria 1083
407 Ga0436361_0128647 3300039447 Bacteria 2492
408 Ga0436363_1067356 3300039450 Bacteria 5627
409 Ga0439465_0021320 3300041413 Bacteria 2031
410 Ga0439465_0038196 3300041413 Bacteria 1546
411 Ga0451853_0502755 3300041512 Bacteria 1857
412 Ga0466961_0179080 3300044693 Bacteria 1316
413 Ga0466970_0081668 3300044765 Bacteria 1748
414 Ga0466957_0026170 3300044842 Bacteria 3460
415 Ga0466967_0098515 3300045976 Bacteria 2669
416 Ga0466967_0181087 3300045976 Bacteria 1988
417 Ga0466967_0229819 3300045976 Bacteria 1766
418 Ga0495592_0012012 3300046454 Bacteria 6562
419 Ga0495592_0013641 3300046454 Bacteria 6180
420 Ga0495603_0003046 3300046455 Bacteria 9937
421 Ga0495603_0011007 3300046455 Bacteria 5487
422 Ga0495603_0013820 3300046455 Bacteria 4886
423 Ga0495603_0068579 3300046455 Bacteria 2087
424 Ga0495629_0000439 3300046459 Bacteria 34692
425 Ga0495629_0000957 3300046459 Bacteria 23286
426 Ga0495629_0030921 3300046459 Bacteria 3793
427 Ga0495651_0019087 3300046462 Bacteria 5313
428 Ga0495653_0080143 3300046463 Bacteria 2416
429 Ga0495580_0022668 3300046472 Bacteria 4617
430 Ga0495580_0090574 3300046472 Bacteria 2129
431 Ga0495580_0549782 3300046472 Bacteria 767
432 Ga0495582_0003251 3300046473 Bacteria 9124
433 Ga0495582_0020537 3300046473 Bacteria 3616
434 Ga0495582_0212507 3300046473 Bacteria 1106
435 Ga0495639_0006764 3300046475 Bacteria 4931
436 Ga0495639_0051304 3300046475 Bacteria 1875
437 Ga0495662_0011192 3300046476 Bacteria 4385
438 Ga0495662_0022869 3300046476 Bacteria 3017
439 Ga0495664_0014457 3300046477 Bacteria 4475
440 Ga0495664_0018231 3300046477 Bacteria 4018
441 Ga0495664_0025032 3300046477 Bacteria 3473
442 Ga0495664_0057675 3300046477 Bacteria 2310
443 Ga0495664_0117847 3300046477 Bacteria 1605
444 Ga0495585_0116922 3300046492 Bacteria 1414
445 Ga0495608_0009342 3300046511 Bacteria 6855
446 Ga0495608_0068668 3300046511 Bacteria 2317
447 Ga0495616_0158056 3300046513 Bacteria 1021
448 Ga0495618_0004727 3300046514 Bacteria 8329
449 Ga0495618_0055842 3300046514 Bacteria 2500
450 Ga0495628_0009529 3300046516 Bacteria 8290
451 Ga0495628_0052614 3300046516 Bacteria 3216
452 Ga0495630_0072137 3300046517 Bacteria 2599
453 Ga0495630_0204690 3300046517 Bacteria 1506
454 Ga0495630_0442117 3300046517 Bacteria 996
455 Ga0495631_0106413 3300046518 Bacteria 1206
456 Ga0495644_0035488 3300046523 Bacteria 1883
457 Ga0495644_0071767 3300046523 Bacteria 1301
458 Ga0495666_0017968 3300046526 Bacteria 3522
459 Ga0495666_0044605 3300046526 Bacteria 2140
460 Ga0495652_0034465 3300046529 Bacteria 4411
461 Ga0495652_0042026 3300046529 Bacteria 3942
462 Ga0495652_0042477 3300046529 Bacteria 3920
463 Ga0495652_0143257 3300046529 Bacteria 1877
464 Ga0495665_0005732 3300046531 Bacteria 6703
465 Ga0495665_0009314 3300046531 Bacteria 5318
466 Ga0495665_0141139 3300046531 Bacteria 1259
467 Ga0495640_0001232 3300046533 Bacteria 20045
468 Ga0495640_0015529 3300046533 Bacteria 5727
469 Ga0495640_0032451 3300046533 Bacteria 3720
470 Ga0495640_0160191 3300046533 Bacteria 1442
471 Ga0495586_0040423 3300046535 Bacteria 2509
472 Ga0495587_0013476 3300046536 Bacteria 5137
473 Ga0495587_0092079 3300046536 Bacteria 1750
474 Ga0495609_0071925 3300046538 Bacteria 1519
475 Ga0495621_0025425 3300046539 Bacteria 1989
476 Ga0495645_0007838 3300046543 Bacteria 7432
477 Ga0495645_0031972 3300046543 Bacteria 3837
478 Ga0495622_0025591 3300046557 Bacteria 2756
479 Ga0495667_0003416 3300046559 Bacteria 10642
480 Ga0495667_0021483 3300046559 Bacteria 4356
481 Ga0495667_0027235 3300046559 Bacteria 3853
482 Ga0495667_0105989 3300046559 Bacteria 1817
483 Ga0495667_0204346 3300046559 Bacteria 1263
484 Ga0495668_0029805 3300046616 Bacteria 3083
485 Ga0495634_0019547 3300046642 Bacteria 4812
486 Ga0495611_0047528 3300046648 Bacteria 1926
487 Ga0495611_0086703 3300046648 Bacteria 1444
488 Ga0495625_0094620 3300046660 Bacteria 2061
489 Ga0495635_0009930 3300046663 Bacteria 6653
490 Ga0495635_0027261 3300046663 Bacteria 3974
491 Ga0495635_0087696 3300046663 Bacteria 2129
492 Ga0495635_0111512 3300046663 Bacteria 1868
493 Ga0495635_0121454 3300046663 Bacteria 1782
494 Ga0495659_0026482 3300046664 Bacteria 1993
495 Ga0495588_0129327 3300046674 Bacteria 1332
496 Ga0495657_0018194 3300046675 Bacteria 5090
497 Ga0495599_0001369 3300046678 Bacteria 13928
498 Ga0495599_0005440 3300046678 Bacteria 7612
499 Ga0495599_0213937 3300046678 Bacteria 1181
500 Ga0495646_0025605 3300046680 Bacteria 3711
501 Ga0495646_0028973 3300046680 Bacteria 3464
502 Ga0495647_0019993 3300046681 Bacteria 2400
503 Ga0495669_0004668 3300046684 Bacteria 5679
504 Ga0495613_0022008 3300046689 Bacteria 4753
505 Ga0495613_0081708 3300046689 Bacteria 2347
506 Ga0495624_0171663 3300046690 Bacteria 1323
507 Ga0495624_0285742 3300046690 Bacteria 996
508 Ga0495600_0001020 3300046809 Bacteria 15122
509 Ga0495600_0035995 3300046809 Bacteria 3217
510 Ga0495600_0098171 3300046809 Bacteria 1909
511 Ga0495581_0000019 3300047315 Bacteria 57810
512 Ga0495604_0244650 3300047317 Bacteria 1225
513 Ga0495674_0000458 3300047319 Bacteria 36828
514 Ga0495674_0009039 3300047319 Bacteria 9465
515 Ga0495674_0064351 3300047319 Bacteria 3188
516 Ga0495674_0110158 3300047319 Bacteria 2335
517 Ga0495674_0122742 3300047319 Bacteria 2194
518 Ga0495672_0073410 3300047320 Bacteria 1929
519 Ga0495680_0013039 3300047322 Bacteria 7270
520 Ga0495680_0015630 3300047322 Bacteria 6542
521 Ga0495675_0080493 3300047444 Bacteria 2051
522 Ga0495675_0088933 3300047444 Bacteria 1939
523 Ga0495673_0082853 3300047469 Bacteria 1325
524 Ga0495684_0007607 3300047471 Bacteria 8383
525 Ga0495684_0011461 3300047471 Bacteria 6847
526 Ga0495593_0000687 3300047673 Bacteria 19500
527 Ga0495593_0079891 3300047673 Bacteria 1693
528 Ga0495593_0124640 3300047673 Bacteria 1310
529 Ga0495602_0118820 3300048088 Bacteria 2131
530 Ga0495602_0173768 3300048088 Bacteria 1669
531 Ga0495602_0314863 3300048088 Bacteria 1141
532 Ga0495602_0626143 3300048088 Bacteria 737
533 Ga0496100_0015649 3300048903 Bacteria 4433
534 Ga0496100_0092825 3300048903 Bacteria 2064
535 Ga0496100_0205623 3300048903 Bacteria 1437
536 Ga0496101_0004392 3300048904 Bacteria 8864
537 Ga0496101_0043859 3300048904 Bacteria 3198
538 Ga0496101_0194526 3300048904 Bacteria 1566
539 Ga0496101_0584126 3300048904 Bacteria 883
540 Ga0496102_0013777 3300048905 Bacteria 7013
541 Ga0496102_0052436 3300048905 Bacteria 3717
542 Ga0496102_0112622 3300048905 Bacteria 2538
543 Ga0496102_0113133 3300048905 Bacteria 2532
544 Ga0496103_0237018 3300048906 Bacteria 1174
545 Ga0496103_0361053 3300048906 Bacteria 934
546 Ga0496104_0041945 3300048907 Bacteria 4291
547 Ga0496104_0246531 3300048907 Bacteria 1699
548 Ga0496104_0405554 3300048907 Bacteria 1275
549 Ga0496106_0000740 3300048909 Bacteria 23552
550 Ga0496106_0018748 3300048909 Bacteria 5124
551 Ga0496106_0019707 3300048909 Bacteria 5002
552 Ga0496106_0296176 3300048909 Bacteria 1297
553 Ga0496106_0494628 3300048909 Bacteria 982
554 Ga0496107_0002930 3300048910 Bacteria 11282
555 Ga0496107_0004783 3300048910 Bacteria 9200
556 Ga0496107_0033894 3300048910 Bacteria 3655
557 Ga0496107_0090860 3300048910 Bacteria 2231
558 Ga0496108_0000938 3300048911 Bacteria 22748
559 Ga0496108_0199011 3300048911 Bacteria 1738
560 Ga0496109_0000977 3300048912 Bacteria 23646
561 Ga0496109_0200987 3300048912 Bacteria 1873
562 Ga0496109_0224879 3300048912 Bacteria 1765
563 Ga0496110_0003174 3300048913 Bacteria 12507
564 Ga0496110_0147094 3300048913 Bacteria 2132
565 Ga0496110_0272332 3300048913 Bacteria 1541
566 Ga0496111_0043521 3300048914 Bacteria 3227
567 Ga0496111_0330929 3300048914 Bacteria 1128
568 Ga0496112_0000590 3300048915 Bacteria 24921
569 Ga0496112_0067674 3300048915 Bacteria 3525
570 Ga0496112_0070093 3300048915 Bacteria 3464
571 Ga0496112_0310661 3300048915 Bacteria 1521
572 Ga0496113_0014433 3300048916 Bacteria 5389
573 Ga0496113_0080348 3300048916 Bacteria 2497
574 Ga0496113_0484088 3300048916 Bacteria 994
575 Ga0496114_0236009 3300048917 Bacteria 1607
576 Ga0496115_0003730 3300048918 Bacteria 10956
577 Ga0496115_0034314 3300048918 Bacteria 4010
578 Ga0496117_0005455 3300048920 Bacteria 13342
579 Ga0496118_0001758 3300048921 Bacteria 31406
580 Ga0496119_0040839 3300048922 Bacteria 2962
581 Ga0496119_0047723 3300048922 Bacteria 2662
582 Ga0496119_0192163 3300048922 Bacteria 1063
583 Ga0496121_0000089 3300048924 Bacteria 219007
584 Ga0496121_0000379 3300048924 Bacteria 91131
585 Ga0496121_0004013 3300048924 Bacteria 20280
586 Ga0496121_0027921 3300048924 Bacteria 5271
587 Ga0496121_0064256 3300048924 Bacteria 2993
588 Ga0496121_0143040 3300048924 Bacteria 1771
589 Ga0496121_0145075 3300048924 Bacteria 1755
590 Ga0496121_0150606 3300048924 Bacteria 1712
591 Ga0496121_0150845 3300048924 Bacteria 1710
592 Ga0496122_0063008 3300048925 Bacteria 2710
593 Ga0496123_0125075 3300048926 Bacteria 1437
594 Ga0496124_0001073 3300048927 Bacteria 43225
595 Ga0496124_0174267 3300048927 Bacteria 1662
596 Ga0496125_0000199 3300048928 Bacteria 126676
597 Ga0496125_0000964 3300048928 Bacteria 45175
598 Ga0496125_0088892 3300048928 Bacteria 2326
599 Ga0496126_0036354 3300048929 Bacteria 4605
600 Ga0496126_0038119 3300048929 Bacteria 4474
601 Ga0496126_0046484 3300048929 Bacteria 3980
602 Ga0496126_0046563 3300048929 Bacteria 3976
603 Ga0496126_0097347 3300048929 Bacteria 2579
604 Ga0496126_0126845 3300048929 Bacteria 2208
605 Ga0496126_0138554 3300048929 Bacteria 2096
606 Ga0496126_0159847 3300048929 Bacteria 1926
607 Ga0496126_0169071 3300048929 Bacteria 1864
608 Ga0496126_0183917 3300048929 Bacteria 1773
609 Ga0496126_0190677 3300048929 Bacteria 1736
610 Ga0495678_071311 3300049459 Bacteria 1273
611 Ga0501032_0081894 3300049569 Bacteria 2147
612 Ga0501034_0209385 3300049571 Bacteria 1905
613 Ga0501036_0051917 3300049572 Bacteria 3472
614 Ga0501036_0413587 3300049572 Bacteria 1125
615 Ga0501037_0020258 3300049573 Bacteria 4911
616 Ga0501037_0060414 3300049573 Bacteria 2764
617 Ga0501037_0271825 3300049573 Bacteria 1182
618 Ga0501038_0003168 3300049574 Bacteria 15342
619 Ga0501038_0013686 3300049574 Bacteria 7393
620 Ga0501038_0047759 3300049574 Bacteria 3707
621 Ga0501038_0348908 3300049574 Bacteria 1153
622 Ga0501039_0084531 3300049575 Bacteria 2471
623 Ga0501039_0186473 3300049575 Bacteria 1631
624 Ga0501041_0041190 3300049577 Bacteria 2805
625 Ga0501042_0003280 3300049578 Bacteria 10124
626 Ga0501042_0271419 3300049578 Bacteria 1225
627 Ga0501043_0039322 3300049579 Bacteria 3717
628 Ga0501043_0051727 3300049579 Bacteria 3228
629 Ga0501043_0127714 3300049579 Bacteria 1993
630 Ga0501046_0185115 3300049580 Bacteria 1555
631 Ga0501047_0064889 3300049581 Bacteria 3521
632 Ga0501047_0319027 3300049581 Bacteria 1394
633 Ga0501067_0051336 3300049583 Bacteria 2286
634 Ga0501068_0002163 3300049584 Bacteria 10474
635 Ga0501071_0150775 3300049587 Bacteria 1734
636 Ga0501071_0213616 3300049587 Bacteria 1451
637 Ga0501073_0169581 3300049589 Bacteria 1511
638 Ga0501074_0011129 3300049590 Bacteria 6534
639 Ga0501074_0247647 3300049590 Bacteria 1267
640 Ga0501076_0024085 3300049592 Bacteria 4702
641 Ga0501077_0022001 3300049593 Bacteria 4038
642 Ga0501080_0066728 3300049742 Bacteria 3346
643 Ga0501080_0177440 3300049742 Bacteria 1962
644 Ga0501080_0219875 3300049742 Bacteria 1738
645 Ga0501080_0295717 3300049742 Bacteria 1469
646 Ga0501035_0017052 3300049822 Bacteria 6692
647 Ga0501035_0088576 3300049822 Bacteria 2727
648 Ga0501044_0098065 3300049823 Bacteria 2951
649 Ga0501044_0109545 3300049823 Bacteria 2770
650 Ga0501044_0181161 3300049823 Bacteria 2073
651 nmdc:mga00v17_89867_c1 3300050491 Bacteria 1928
652 nmdc:mga0k408_45189_c1 3300050493 Bacteria 2541
653 nmdc:mga0k408_77948_c1 3300050493 Bacteria 1938
654 nmdc:mga06z11_282780_c1 3300050494 Bacteria 983
655 nmdc:mga06z11_407666_c1 3300050494 Bacteria 819
656 nmdc:mga06z11_86843_c1 3300050494 Bacteria 1690
657 nmdc:mga07m45_46230_c1 3300050496 Bacteria 2445
658 nmdc:mga08y16_136202_c1 3300050511 Bacteria 2552
659 nmdc:mga0n895_18842_c1 3300050512 Bacteria 6398
660 nmdc:mga0rr50_174308_c1 3300050513 Bacteria 1754
661 nmdc:mga08x19_253571_c1 3300050514 Bacteria 1215
662 nmdc:mga0a205_376832_c1 3300050515 Bacteria 1284
663 Ga0495601_0031878 3300053077 Bacteria 3277
664 Ga0495601_0057472 3300053077 Bacteria 2464
665 Ga0495601_0129943 3300053077 Bacteria 1640
666 Ga0495601_0207496 3300053077 Bacteria 1280
667 Ga0495612_0013526 3300053078 Bacteria 3286
668 Ga0495612_0118719 3300053078 Bacteria 1136
669 Ga0495655_0002763 3300053083 Bacteria 2823
670 Ga0495595_0004450 3300053084 Bacteria 5640
671 Ga0495595_0016779 3300053084 Bacteria 3138
672 Ga0495619_0001280 3300053085 Bacteria 16510
673 Ga0495619_0222484 3300053085 Bacteria 1307
674 Ga0495619_0289819 3300053085 Bacteria 1134
675 Ga0495619_0524069 3300053085 Bacteria 814
676 Ga0500646_0044954 3300053090 Bacteria 1255
677 Ga0500647_0030111 3300053091 Bacteria 2577
678 Ga0500583_0228905 3300053092 Bacteria 921
679 Ga0500566_0000046 3300053094 Bacteria 59187
680 Ga0500566_0096422 3300053094 Bacteria 1628
681 Ga0500641_0001509 3300053096 Bacteria 8318
682 Ga0500641_0058753 3300053096 Bacteria 1597
683 Ga0500554_001571 3300053102 Bacteria 4401
684 Ga0500556_0038644 3300053104 Bacteria 1667
685 Ga0500595_001395 3300053119 Bacteria 12953
686 Ga0500595_003376 3300053119 Bacteria 7480
687 Ga0500595_004070 3300053119 Bacteria 6646
688 Ga0500595_009512 3300053119 Bacteria 3919
689 Ga0500595_014720 3300053119 Bacteria 2960
690 Ga0500642_0159753 3300053130 Bacteria 1056
691 Ga0500652_109798 3300053131 Bacteria 1153
692 Ga0500559_0001633 3300053136 Bacteria 12428
693 Ga0500559_0112820 3300053136 Bacteria 1260
694 Ga0500568_0007172 3300053139 Bacteria 5498
695 Ga0500568_0051503 3300053139 Bacteria 1619
696 Ga0500577_0113997 3300053142 Bacteria 1118
697 Ga0500588_0065533 3300053146 Bacteria 1176
698 Ga0500603_000071 3300053150 Bacteria 23487
699 Ga0500603_000328 3300053150 Bacteria 12422
700 Ga0500603_021589 3300053150 Bacteria 1585
701 Ga0500633_0048777 3300053160 Bacteria 1454
702 Ga0500639_000009 3300053163 Bacteria 139043
703 Ga0500636_0026626 3300053177 Bacteria 3415
704 Ga0500637_0000262 3300053178 Bacteria 19711
705 Ga0500637_0001994 3300053178 Bacteria 8887
706 Ga0500637_0051276 3300053178 Bacteria 2352
707 Ga0500637_0158607 3300053178 Bacteria 1305
708 Ga0500609_006359 3300053731 Bacteria 1610
709 Ga0501084_0498017 3300054114 Bacteria 1030
710 Ga0500661_001756 3300055283 Bacteria 4085
711 Ga0501082_0192295 3300060353 Bacteria 1775
712 Ga0466962_0239302 3300061719 Bacteria 891
713 Ga0530510_0323810 3300061734 Bacteria 1156

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100438281 Ga0070660_1004382811 218
2 3300005563 Ga0068855_100010142 Ga0068855_1000101423 218
3 3300009093 Ga0105240_10032506 Ga0105240_100325066 218
4 3300009545 Ga0105237_10333240 Ga0105237_103332402 218
5 3300013104 Ga0157370_10013258 Ga0157370_100132582 218
6 3300025949 Ga0207667_10010882 Ga0207667_100108822 218
7 3300048929 Ga0496126_0159847 Ga0496126_0159847_103_864 218
8 3300053119 Ga0500595_001395 Ga0500595_001395_1848_2603 220
9 3300053150 Ga0500603_021589 Ga0500603_021589_96_851 220
10 3300053178 Ga0500637_0000262 Ga0500637_0000262_3510_4265 220
11 3300055283 Ga0500661_001756 Ga0500661_001756_2197_2952 220
12 3300025906 Ga0207699_10337654 Ga0207699_103376541 222
13 3300025921 Ga0207652_10210735 Ga0207652_102107352 222
14 3300035170 Ga0373943_0016035 Ga0373943_0016035_1214_1966 222
15 3300035695 Ga0373927_0014122 Ga0373927_0014122_810_1562 222
16 3300035725 Ga0373947_0010871 Ga0373947_0010871_2341_3093 222
17 3300046455 Ga0495603_0013820 Ga0495603_0013820_2341_3093 222
18 3300046517 Ga0495630_0442117 Ga0495630_0442117_24_776 222
19 3300046531 Ga0495665_0141139 Ga0495665_0141139_303_1055 222
20 3300035695 Ga0373927_0154369 Ga0373927_0154369_510_1265 224
21 3300035725 Ga0373947_0047088 Ga0373947_0047088_1663_2418 224
22 3300005563 Ga0068855_100320690 Ga0068855_1003206902 225
23 3300005614 Ga0068856_100084211 Ga0068856_1000842112 225
24 3300005616 Ga0068852_100078071 Ga0068852_1000780712 225
25 3300005834 Ga0068851_10240303 Ga0068851_102403032 225
26 3300006028 Ga0070717_10110378 Ga0070717_101103783 225
27 3300026078 Ga0207702_10047033 Ga0207702_100470332 225
28 3300026142 Ga0207698_10150001 Ga0207698_101500012 225
29 3300048088 Ga0495602_0626143 Ga0495602_0626143_10_714 225
30 3300053136 Ga0500559_0112820 Ga0500559_0112820_116_856 225
31 3300005536 Ga0070697_100100186 Ga0070697_1001001862 226
32 3300021441 Ga0213871_10001561 Ga0213871_100015613 226
33 3300039438 Ga0436360_0770248 Ga0436360_0770248_1085_1819 226
34 3300048929 Ga0496126_0169071 Ga0496126_0169071_703_1449 226
35 3300021377 Ga0213874_10016941 Ga0213874_100169412 227
36 3300039450 Ga0436363_1067356 Ga0436363_1067356_2312_3046 227
37 3300036459 Ga0372808_002808 Ga0372808_002808_1038_1772 228
38 3300053119 Ga0500595_003376 Ga0500595_003376_2612_3355 228
39 3300005983 Ga0081540_1017020 Ga0081540_10170202 229
40 3300005435 Ga0070714_100203092 Ga0070714_1002030923 230
41 3300005436 Ga0070713_100116181 Ga0070713_1001161813 230
42 3300025929 Ga0207664_10351326 Ga0207664_103513262 230
43 3300005548 Ga0070665_100097774 Ga0070665_1000977742 231
44 3300031711 Ga0265314_10078319 Ga0265314_100783192 234
45 3300035118 Ga0373954_0040759 Ga0373954_0040759_723_1427 234
46 3300048904 Ga0496101_0584126 Ga0496101_0584126_96_800 234
47 3300048924 Ga0496121_0000379 Ga0496121_0000379_80557_81261 234
48 3300053078 Ga0495612_0118719 Ga0495612_0118719_62_766 234
49 3300053104 Ga0500556_0038644 Ga0500556_0038644_918_1622 234
50 3300053119 Ga0500595_004070 Ga0500595_004070_1264_1968 234
51 3300053139 Ga0500568_0007172 Ga0500568_0007172_2030_2734 234
52 3300005366 Ga0070659_100024121 Ga0070659_1000241212 235
53 3300006942 Ga0099824_1006668 Ga0099824_100666813 235
54 3300009093 Ga0105240_10257882 Ga0105240_102578822 235
55 3300009551 Ga0105238_10003279 Ga0105238_1000327914 235
56 3300010375 Ga0105239_10182631 Ga0105239_101826312 235
57 3300025938 Ga0207704_10360061 Ga0207704_103600611 235
58 3300046472 Ga0495580_0549782 Ga0495580_0549782_20_727 235
59 3300006178 Ga0075367_10109936 Ga0075367_101099361 236
60 3300050494 nmdc:mga06z11_86843_c1 nmdc:mga06z11_86843_c1_916_1644 236
61 3300003215 JGI25153J46596_10004213 JGI25153J46596_100042132 237
62 3300003659 JGI25404J52841_10013554 JGI25404J52841_100135542 237
63 3300005327 Ga0070658_10023061 Ga0070658_100230614 237
64 3300005329 Ga0070683_100002376 Ga0070683_10000237614 237
65 3300005329 Ga0070683_100039720 Ga0070683_1000397203 237
66 3300005334 Ga0068869_100053873 Ga0068869_1000538733 237
67 3300005334 Ga0068869_100109397 Ga0068869_1001093972 237
68 3300005336 Ga0070680_100101164 Ga0070680_1001011642 237
69 3300005336 Ga0070680_100184226 Ga0070680_1001842262 237
70 3300005336 Ga0070680_100294063 Ga0070680_1002940632 237
71 3300005336 Ga0070680_100401665 Ga0070680_1004016652 237
72 3300005337 Ga0070682_100051594 Ga0070682_1000515943 237
73 3300005338 Ga0068868_100041269 Ga0068868_1000412692 237
74 3300005339 Ga0070660_100011623 Ga0070660_1000116232 237
75 3300005339 Ga0070660_100146256 Ga0070660_1001462562 237
76 3300005341 Ga0070691_10015392 Ga0070691_100153922 237
77 3300005343 Ga0070687_100068743 Ga0070687_1000687432 237
78 3300005344 Ga0070661_100121680 Ga0070661_1001216802 237
79 3300005345 Ga0070692_10351844 Ga0070692_103518441 237
80 3300005347 Ga0070668_100392405 Ga0070668_1003924051 237
81 3300005347 Ga0070668_100418139 Ga0070668_1004181392 237
82 3300005353 Ga0070669_100099354 Ga0070669_1000993542 237
83 3300005355 Ga0070671_100036389 Ga0070671_1000363894 237
84 3300005355 Ga0070671_100300834 Ga0070671_1003008342 237
85 3300005356 Ga0070674_100133845 Ga0070674_1001338452 237
86 3300005364 Ga0070673_100433193 Ga0070673_1004331932 237
87 3300005365 Ga0070688_100141458 Ga0070688_1001414581 237
88 3300005366 Ga0070659_100076973 Ga0070659_1000769732 237
89 3300005366 Ga0070659_100237090 Ga0070659_1002370902 237
90 3300005434 Ga0070709_10005136 Ga0070709_100051366 237
91 3300005435 Ga0070714_100030939 Ga0070714_1000309395 237
92 3300005435 Ga0070714_100054028 Ga0070714_1000540282 237
93 3300005435 Ga0070714_100062126 Ga0070714_1000621265 237
94 3300005435 Ga0070714_100426475 Ga0070714_1004264752 237
95 3300005436 Ga0070713_100006818 Ga0070713_1000068187 237
96 3300005436 Ga0070713_100121600 Ga0070713_1001216002 237
97 3300005436 Ga0070713_100215148 Ga0070713_1002151482 237
98 3300005436 Ga0070713_100286579 Ga0070713_1002865791 237
99 3300005437 Ga0070710_10006463 Ga0070710_100064634 237
100 3300005437 Ga0070710_10021427 Ga0070710_100214272 237
101 3300005437 Ga0070710_10098276 Ga0070710_100982762 237
102 3300005439 Ga0070711_100001065 Ga0070711_10000106515 237
103 3300005439 Ga0070711_100010729 Ga0070711_1000107295 237
104 3300005439 Ga0070711_100321816 Ga0070711_1003218162 237
105 3300005445 Ga0070708_100363178 Ga0070708_1003631782 237
106 3300005455 Ga0070663_100023081 Ga0070663_1000230814 237
107 3300005455 Ga0070663_100329952 Ga0070663_1003299522 237
108 3300005456 Ga0070678_100031818 Ga0070678_1000318182 237
109 3300005456 Ga0070678_100042358 Ga0070678_1000423583 237
110 3300005456 Ga0070678_100318952 Ga0070678_1003189522 237
111 3300005457 Ga0070662_100163692 Ga0070662_1001636921 237
112 3300005458 Ga0070681_10130390 Ga0070681_101303902 237
113 3300005458 Ga0070681_10135762 Ga0070681_101357623 237
114 3300005467 Ga0070706_100143695 Ga0070706_1001436952 237
115 3300005468 Ga0070707_100037942 Ga0070707_1000379423 237
116 3300005471 Ga0070698_100283818 Ga0070698_1002838182 237
117 3300005530 Ga0070679_100160275 Ga0070679_1001602753 237
118 3300005535 Ga0070684_100009910 Ga0070684_1000099106 237
119 3300005535 Ga0070684_100032347 Ga0070684_1000323472 237
120 3300005536 Ga0070697_100061661 Ga0070697_1000616612 237
121 3300005539 Ga0068853_100178979 Ga0068853_1001789793 237
122 3300005539 Ga0068853_100188553 Ga0068853_1001885532 237
123 3300005539 Ga0068853_100275033 Ga0068853_1002750332 237
124 3300005539 Ga0068853_100782604 Ga0068853_1007826041 237
125 3300005547 Ga0070693_100054174 Ga0070693_1000541743 237
126 3300005548 Ga0070665_100053304 Ga0070665_1000533043 237
127 3300005548 Ga0070665_100080605 Ga0070665_1000806052 237
128 3300005548 Ga0070665_100210330 Ga0070665_1002103303 237
129 3300005548 Ga0070665_100243303 Ga0070665_1002433032 237
130 3300005548 Ga0070665_100248399 Ga0070665_1002483992 237
131 3300005548 Ga0070665_100298908 Ga0070665_1002989083 237
132 3300005563 Ga0068855_100100282 Ga0068855_1001002823 237
133 3300005563 Ga0068855_100119566 Ga0068855_1001195663 237
134 3300005563 Ga0068855_100356840 Ga0068855_1003568401 237
135 3300005564 Ga0070664_100075491 Ga0070664_1000754913 237
136 3300005564 Ga0070664_100422469 Ga0070664_1004224692 237
137 3300005577 Ga0068857_100134758 Ga0068857_1001347582 237
138 3300005577 Ga0068857_100537861 Ga0068857_1005378612 237
139 3300005614 Ga0068856_100096878 Ga0068856_1000968782 237
140 3300005614 Ga0068856_100149968 Ga0068856_1001499682 237
141 3300005614 Ga0068856_100404812 Ga0068856_1004048122 237
142 3300005616 Ga0068852_100342278 Ga0068852_1003422781 237
143 3300005618 Ga0068864_100073721 Ga0068864_1000737212 237
144 3300005719 Ga0068861_100027741 Ga0068861_1000277414 237
145 3300005834 Ga0068851_10055833 Ga0068851_100558333 237
146 3300005840 Ga0068870_10236031 Ga0068870_102360312 237
147 3300005841 Ga0068863_100222523 Ga0068863_1002225233 237
148 3300005841 Ga0068863_100695341 Ga0068863_1006953412 237
149 3300005843 Ga0068860_100000101 Ga0068860_100000101126 237
150 3300005844 Ga0068862_100111617 Ga0068862_1001116172 237
151 3300005937 Ga0081455_10011564 Ga0081455_1001156412 237
152 3300005981 Ga0081538_10033376 Ga0081538_100333763 237
153 3300005983 Ga0081540_1016848 Ga0081540_10168485 237
154 3300005985 Ga0081539_10039335 Ga0081539_100393352 237
155 3300006028 Ga0070717_10003637 Ga0070717_1000363712 237
156 3300006028 Ga0070717_10036762 Ga0070717_100367622 237
157 3300006028 Ga0070717_10182680 Ga0070717_101826802 237
158 3300006163 Ga0070715_10012718 Ga0070715_100127182 237
159 3300006173 Ga0070716_100003831 Ga0070716_1000038315 237
160 3300006173 Ga0070716_100195616 Ga0070716_1001956162 237
161 3300006175 Ga0070712_100034259 Ga0070712_1000342592 237
162 3300006175 Ga0070712_100035835 Ga0070712_1000358352 237
163 3300006175 Ga0070712_100047302 Ga0070712_1000473022 237
164 3300006175 Ga0070712_100142349 Ga0070712_1001423492 237
165 3300006177 Ga0075362_10030838 Ga0075362_100308383 237
166 3300006178 Ga0075367_10091566 Ga0075367_100915662 237
167 3300006186 Ga0075369_10053052 Ga0075369_100530522 237
168 3300006195 Ga0075366_10082877 Ga0075366_100828772 237
169 3300006353 Ga0075370_10056629 Ga0075370_100566292 237
170 3300006353 Ga0075370_10218362 Ga0075370_102183622 237
171 3300006358 Ga0068871_100013006 Ga0068871_1000130064 237
172 3300006846 Ga0075430_100274245 Ga0075430_1002742452 237
173 3300006871 Ga0075434_100006666 Ga0075434_1000066662 237
174 3300006871 Ga0075434_100133722 Ga0075434_1001337222 237
175 3300006881 Ga0068865_100107794 Ga0068865_1001077942 237
176 3300006931 Ga0097620_100408070 Ga0097620_1004080701 237
177 3300006943 Ga0099822_1000663 Ga0099822_100066319 237
178 3300007265 Ga0099794_10004750 Ga0099794_100047502 237
179 3300007265 Ga0099794_10010664 Ga0099794_100106646 237
180 3300007265 Ga0099794_10072307 Ga0099794_100723072 237
181 3300007265 Ga0099794_10211785 Ga0099794_102117852 237
182 3300007788 Ga0099795_10040757 Ga0099795_100407573 237
183 3300009093 Ga0105240_10297895 Ga0105240_102978952 237
184 3300009094 Ga0111539_10177063 Ga0111539_101770632 237
185 3300009098 Ga0105245_10011127 Ga0105245_100111273 237
186 3300009098 Ga0105245_10016868 Ga0105245_100168686 237
187 3300009101 Ga0105247_10019655 Ga0105247_100196552 237
188 3300009101 Ga0105247_10117210 Ga0105247_101172102 237
189 3300009148 Ga0105243_10048436 Ga0105243_100484362 237
190 3300009148 Ga0105243_10403329 Ga0105243_104033292 237
191 3300009174 Ga0105241_10029647 Ga0105241_100296473 237
192 3300009176 Ga0105242_10316387 Ga0105242_103163872 237
193 3300009177 Ga0105248_10178264 Ga0105248_101782642 237
194 3300009545 Ga0105237_10054501 Ga0105237_100545013 237
195 3300009545 Ga0105237_10153004 Ga0105237_101530043 237
196 3300009545 Ga0105237_10303183 Ga0105237_103031832 237
197 3300009551 Ga0105238_10027788 Ga0105238_100277882 237
198 3300009551 Ga0105238_10094819 Ga0105238_100948194 237
199 3300009551 Ga0105238_10413754 Ga0105238_104137542 237
200 3300009553 Ga0105249_10215687 Ga0105249_102156872 237
201 3300010375 Ga0105239_10080497 Ga0105239_100804971 237
202 3300010375 Ga0105239_11122421 Ga0105239_111224211 237
203 3300011119 Ga0105246_10066670 Ga0105246_100666702 237
204 3300011119 Ga0105246_10200344 Ga0105246_102003442 237
205 3300013100 Ga0157373_10039405 Ga0157373_100394053 237
206 3300013104 Ga0157370_10261721 Ga0157370_102617212 237
207 3300013105 Ga0157369_10014404 Ga0157369_1001440410 237
208 3300013105 Ga0157369_10402758 Ga0157369_104027582 237
209 3300013105 Ga0157369_10611312 Ga0157369_106113122 237
210 3300013296 Ga0157374_10041407 Ga0157374_100414073 237
211 3300013296 Ga0157374_10441365 Ga0157374_104413652 237
212 3300013297 Ga0157378_10194808 Ga0157378_101948082 237
213 3300013306 Ga0163162_10031760 Ga0163162_100317603 237
214 3300013306 Ga0163162_10122697 Ga0163162_101226973 237
215 3300013306 Ga0163162_10369150 Ga0163162_103691501 237
216 3300013307 Ga0157372_10083592 Ga0157372_100835923 237
217 3300013308 Ga0157375_10008782 Ga0157375_100087823 237
218 3300013308 Ga0157375_11032035 Ga0157375_110320352 237
219 3300014325 Ga0163163_10097774 Ga0163163_100977742 237
220 3300014497 Ga0182008_10217802 Ga0182008_102178021 237
221 3300014968 Ga0157379_10082727 Ga0157379_100827273 237
222 3300014969 Ga0157376_10034599 Ga0157376_100345994 237
223 3300021361 Ga0213872_10029655 Ga0213872_100296552 237
224 3300021361 Ga0213872_10090683 Ga0213872_100906832 237
225 3300021384 Ga0213876_10220419 Ga0213876_102204192 237
226 3300025261 Ga0209233_1005435 Ga0209233_10054353 237
227 3300025297 Ga0209758_1003178 Ga0209758_10031787 237
228 3300025297 Ga0209758_1014636 Ga0209758_10146362 237
229 3300025321 Ga0207656_10075860 Ga0207656_100758602 237
230 3300025893 Ga0207682_10197215 Ga0207682_101972151 237
231 3300025898 Ga0207692_10063188 Ga0207692_100631883 237
232 3300025899 Ga0207642_10031730 Ga0207642_100317302 237
233 3300025899 Ga0207642_10041436 Ga0207642_100414362 237
234 3300025900 Ga0207710_10121530 Ga0207710_101215302 237
235 3300025900 Ga0207710_10266381 Ga0207710_102663811 237
236 3300025905 Ga0207685_10028399 Ga0207685_100283992 237
237 3300025906 Ga0207699_10027370 Ga0207699_100273703 237
238 3300025906 Ga0207699_10056996 Ga0207699_100569962 237
239 3300025906 Ga0207699_10070555 Ga0207699_100705552 237
240 3300025909 Ga0207705_10017157 Ga0207705_100171574 237
241 3300025910 Ga0207684_10261364 Ga0207684_102613642 237
242 3300025911 Ga0207654_10098056 Ga0207654_100980562 237
243 3300025912 Ga0207707_10028363 Ga0207707_100283632 237
244 3300025912 Ga0207707_10032980 Ga0207707_100329805 237
245 3300025912 Ga0207707_10118799 Ga0207707_101187992 237
246 3300025912 Ga0207707_10128284 Ga0207707_101282843 237
247 3300025913 Ga0207695_10015132 Ga0207695_1001513210 237
248 3300025913 Ga0207695_10099178 Ga0207695_100991782 237
249 3300025914 Ga0207671_10046204 Ga0207671_100462042 237
250 3300025914 Ga0207671_10095419 Ga0207671_100954192 237
251 3300025914 Ga0207671_10661420 Ga0207671_106614201 237
252 3300025915 Ga0207693_10003158 Ga0207693_1000315811 237
253 3300025915 Ga0207693_10029632 Ga0207693_100296322 237
254 3300025915 Ga0207693_10057236 Ga0207693_100572362 237
255 3300025915 Ga0207693_10067345 Ga0207693_100673453 237
256 3300025915 Ga0207693_10114691 Ga0207693_101146912 237
257 3300025916 Ga0207663_10000261 Ga0207663_100002619 237
258 3300025916 Ga0207663_10016206 Ga0207663_100162062 237
259 3300025916 Ga0207663_10100024 Ga0207663_101000242 237
260 3300025917 Ga0207660_10006085 Ga0207660_100060854 237
261 3300025917 Ga0207660_10086833 Ga0207660_100868332 237
262 3300025917 Ga0207660_10097559 Ga0207660_100975592 237
263 3300025917 Ga0207660_10112333 Ga0207660_101123332 237
264 3300025918 Ga0207662_10152089 Ga0207662_101520892 237
265 3300025919 Ga0207657_10002700 Ga0207657_1000270010 237
266 3300025919 Ga0207657_10092065 Ga0207657_100920652 237
267 3300025921 Ga0207652_10064850 Ga0207652_100648503 237
268 3300025921 Ga0207652_10227425 Ga0207652_102274253 237
269 3300025921 Ga0207652_10469074 Ga0207652_104690742 237
270 3300025921 Ga0207652_10755826 Ga0207652_107558261 237
271 3300025922 Ga0207646_10222946 Ga0207646_102229462 237
272 3300025923 Ga0207681_10115055 Ga0207681_101150552 237
273 3300025924 Ga0207694_10030821 Ga0207694_100308212 237
274 3300025924 Ga0207694_10084301 Ga0207694_100843012 237
275 3300025924 Ga0207694_10116430 Ga0207694_101164302 237
276 3300025924 Ga0207694_10162284 Ga0207694_101622842 237
277 3300025927 Ga0207687_10082362 Ga0207687_100823622 237
278 3300025928 Ga0207700_10005839 Ga0207700_100058394 237
279 3300025928 Ga0207700_10040740 Ga0207700_100407402 237
280 3300025928 Ga0207700_10056073 Ga0207700_100560733 237
281 3300025928 Ga0207700_10102973 Ga0207700_101029732 237
282 3300025928 Ga0207700_10164232 Ga0207700_101642322 237
283 3300025928 Ga0207700_10178218 Ga0207700_101782182 237
284 3300025929 Ga0207664_10063952 Ga0207664_100639523 237
285 3300025929 Ga0207664_10246784 Ga0207664_102467842 237
286 3300025929 Ga0207664_10317121 Ga0207664_103171211 237
287 3300025931 Ga0207644_10074360 Ga0207644_100743602 237
288 3300025933 Ga0207706_10172639 Ga0207706_101726392 237
289 3300025934 Ga0207686_10083003 Ga0207686_100830033 237
290 3300025937 Ga0207669_10209159 Ga0207669_102091592 237
291 3300025939 Ga0207665_10000280 Ga0207665_1000028012 237
292 3300025939 Ga0207665_10025582 Ga0207665_100255822 237
293 3300025939 Ga0207665_10122152 Ga0207665_101221522 237
294 3300025940 Ga0207691_10075400 Ga0207691_100754003 237
295 3300025940 Ga0207691_10198491 Ga0207691_101984912 237
296 3300025942 Ga0207689_10074481 Ga0207689_100744812 237
297 3300025944 Ga0207661_10000532 Ga0207661_1000053219 237
298 3300025944 Ga0207661_10002592 Ga0207661_100025922 237
299 3300025944 Ga0207661_10256249 Ga0207661_102562492 237
300 3300025945 Ga0207679_10076779 Ga0207679_100767792 237
301 3300025945 Ga0207679_10151350 Ga0207679_101513502 237
302 3300025945 Ga0207679_10554811 Ga0207679_105548111 237
303 3300025949 Ga0207667_10027486 Ga0207667_100274862 237
304 3300025961 Ga0207712_10095142 Ga0207712_100951423 237
305 3300025972 Ga0207668_10045470 Ga0207668_100454702 237
306 3300026023 Ga0207677_10080989 Ga0207677_100809892 237
307 3300026023 Ga0207677_10862502 Ga0207677_108625021 237
308 3300026035 Ga0207703_10053309 Ga0207703_100533094 237
309 3300026041 Ga0207639_10106811 Ga0207639_101068112 237
310 3300026041 Ga0207639_10134900 Ga0207639_101349002 237
311 3300026041 Ga0207639_10226902 Ga0207639_102269022 237
312 3300026067 Ga0207678_10041308 Ga0207678_100413083 237
313 3300026067 Ga0207678_10089150 Ga0207678_100891501 237
314 3300026067 Ga0207678_10545651 Ga0207678_105456512 237
315 3300026067 Ga0207678_10617478 Ga0207678_106174781 237
316 3300026075 Ga0207708_10072759 Ga0207708_100727593 237
317 3300026075 Ga0207708_10159047 Ga0207708_101590473 237
318 3300026078 Ga0207702_10203546 Ga0207702_102035463 237
319 3300026095 Ga0207676_10070281 Ga0207676_100702813 237
320 3300026095 Ga0207676_10123771 Ga0207676_101237712 237
321 3300026116 Ga0207674_10032600 Ga0207674_100326002 237
322 3300026116 Ga0207674_10565833 Ga0207674_105658332 237
323 3300026118 Ga0207675_100024689 Ga0207675_1000246892 237
324 3300026118 Ga0207675_100062798 Ga0207675_1000627983 237
325 3300026118 Ga0207675_100160430 Ga0207675_1001604303 237
326 3300026118 Ga0207675_100244314 Ga0207675_1002443141 237
327 3300026121 Ga0207683_10019717 Ga0207683_100197173 237
328 3300026121 Ga0207683_10160370 Ga0207683_101603702 237
329 3300026142 Ga0207698_10017361 Ga0207698_100173614 237
330 3300026142 Ga0207698_10464639 Ga0207698_104646392 237
331 3300027357 Ga0209589_1000006 Ga0209589_1000006134 237
332 3300027361 Ga0209489_100007 Ga0209489_100007134 237
333 3300027363 Ga0209700_100008 Ga0209700_100008134 237
334 3300027671 Ga0209588_1000499 Ga0209588_10004993 237
335 3300028379 Ga0268266_10016781 Ga0268266_100167813 237
336 3300028379 Ga0268266_10241277 Ga0268266_102412772 237
337 3300028379 Ga0268266_10344904 Ga0268266_103449042 237
338 3300028380 Ga0268265_10052898 Ga0268265_100528982 237
339 3300028380 Ga0268265_10084226 Ga0268265_100842262 237
340 3300028380 Ga0268265_10182911 Ga0268265_101829112 237
341 3300028381 Ga0268264_10000030 Ga0268264_10000030105 237
342 3300028381 Ga0268264_10159718 Ga0268264_101597182 237
343 3300028786 Ga0307517_10000744 Ga0307517_1000074430 237
344 3300028794 Ga0307515_10088090 Ga0307515_100880904 237
345 3300031235 Ga0265330_10006427 Ga0265330_100064275 237
346 3300031235 Ga0265330_10009777 Ga0265330_100097772 237
347 3300031239 Ga0265328_10080780 Ga0265328_100807801 237
348 3300031247 Ga0265340_10023276 Ga0265340_100232762 237
349 3300031247 Ga0265340_10026436 Ga0265340_100264362 237
350 3300031249 Ga0265339_10009136 Ga0265339_100091362 237
351 3300031249 Ga0265339_10011293 Ga0265339_100112933 237
352 3300031250 Ga0265331_10074521 Ga0265331_100745212 237
353 3300031456 Ga0307513_10296943 Ga0307513_102969432 237
354 3300031507 Ga0307509_10079363 Ga0307509_100793632 237
355 3300031616 Ga0307508_10000051 Ga0307508_1000005145 237
356 3300031616 Ga0307508_10232304 Ga0307508_102323042 237
357 3300031712 Ga0265342_10017850 Ga0265342_100178504 237
358 3300031712 Ga0265342_10092712 Ga0265342_100927122 237
359 3300031730 Ga0307516_10029187 Ga0307516_100291872 237
360 3300031852 Ga0307410_10173039 Ga0307410_101730392 237
361 3300031901 Ga0307406_10195330 Ga0307406_101953302 237
362 3300031911 Ga0307412_10204522 Ga0307412_102045222 237
363 3300032005 Ga0307411_10091699 Ga0307411_100916992 237
364 3300032126 Ga0307415_100028863 Ga0307415_1000288633 237
365 3300033179 Ga0307507_10007677 Ga0307507_1000767715 237
366 3300033180 Ga0307510_10024689 Ga0307510_100246892 237
367 3300033442 Ga0315911_1000003 Ga0315911_1000003297 237
368 3300033544 Ga0316215_1000756 Ga0316215_10007563 237
369 3300035083 Ga0373926_0007807 Ga0373926_0007807_1967_2755 237
370 3300035086 Ga0373934_0000907 Ga0373934_0000907_9470_10243 237
371 3300035089 Ga0373944_0026229 Ga0373944_0026229_189_923 237
372 3300035111 Ga0373923_0002765 Ga0373923_0002765_945_1718 237
373 3300035113 Ga0373936_0011613 Ga0373936_0011613_774_1547 237
374 3300035113 Ga0373936_0022195 Ga0373936_0022195_982_1770 237
375 3300035116 Ga0373945_0051470 Ga0373945_0051470_233_967 237
376 3300035117 Ga0373953_0016673 Ga0373953_0016673_1352_2140 237
377 3300035117 Ga0373953_0073895 Ga0373953_0073895_309_1043 237
378 3300035118 Ga0373954_0007936 Ga0373954_0007936_2488_3261 237
379 3300035118 Ga0373954_0050887 Ga0373954_0050887_22_756 237
380 3300035118 Ga0373954_0103775 Ga0373954_0103775_307_1062 237
381 3300035119 Ga0373956_0081619 Ga0373956_0081619_67_801 237
382 3300035120 Ga0373957_0067375 Ga0373957_0067375_39_812 237
383 3300035170 Ga0373943_0051712 Ga0373943_0051712_821_1555 237
384 3300035170 Ga0373943_0083857 Ga0373943_0083857_296_1051 237
385 3300035170 Ga0373943_0140326 Ga0373943_0140326_501_1253 237
386 3300035171 Ga0373946_0154492 Ga0373946_0154492_274_1026 237
387 3300035172 Ga0373955_0040004 Ga0373955_0040004_1571_2326 237
388 3300035172 Ga0373955_0058865 Ga0373955_0058865_789_1562 237
389 3300035172 Ga0373955_0142564 Ga0373955_0142564_112_846 237
390 3300035410 Ga0373924_0003083 Ga0373924_0003083_3366_4139 237
391 3300035410 Ga0373924_0022158 Ga0373924_0022158_166_900 237
392 3300035410 Ga0373924_0091753 Ga0373924_0091753_490_1245 237
393 3300035691 Ga0373931_0349001 Ga0373931_0349001_169_903 237
394 3300035692 Ga0373935_0035466 Ga0373935_0035466_1815_2549 237
395 3300035692 Ga0373935_0131415 Ga0373935_0131415_882_1670 237
396 3300035695 Ga0373927_0013792 Ga0373927_0013792_4162_4896 237
397 3300035695 Ga0373927_0021149 Ga0373927_0021149_321_1109 237
398 3300035695 Ga0373927_0086692 Ga0373927_0086692_530_1279 237
399 3300035695 Ga0373927_0087324 Ga0373927_0087324_133_867 237
400 3300035695 Ga0373927_0143422 Ga0373927_0143422_703_1455 237
401 3300035695 Ga0373927_0170553 Ga0373927_0170553_229_963 237
402 3300035724 Ga0373933_0007801 Ga0373933_0007801_713_1486 237
403 3300035725 Ga0373947_0014913 Ga0373947_0014913_577_1311 237
404 3300035725 Ga0373947_0015785 Ga0373947_0015785_3375_4109 237
405 3300035725 Ga0373947_0569474 Ga0373947_0569474_12_761 237
406 3300036401 Ga0373937_0014045 Ga0373937_0014045_3419_4153 237
407 3300036401 Ga0373937_0024360 Ga0373937_0024360_401_1174 237
408 3300036401 Ga0373937_0668975 Ga0373937_0668975_148_903 237
409 3300037068 Ga0373925_0029763 Ga0373925_0029763_2360_3097 237
410 3300037068 Ga0373925_0048085 Ga0373925_0048085_2304_3092 237
411 3300037068 Ga0373925_0054307 Ga0373925_0054307_1551_2285 237
412 3300037312 Ga0395899_0283966 Ga0395899_0283966_305_1039 237
413 3300037418 Ga0395900_0007637 Ga0395900_0007637_1715_2449 237
414 3300037418 Ga0395900_0114406 Ga0395900_0114406_678_1430 237
415 3300037418 Ga0395900_0400035 Ga0395900_0400035_396_1130 237
416 3300037466 Ga0395898_0025630 Ga0395898_0025630_3644_4378 237
417 3300037466 Ga0395898_0032258 Ga0395898_0032258_2884_3618 237
418 3300037471 Ga0395905_0082234 Ga0395905_0082234_545_1297 237
419 3300037853 Ga0436364_1423996 Ga0436364_1423996_3221_3955 237
420 3300038443 Ga0395901_0136742 Ga0395901_0136742_1311_2063 237
421 3300038443 Ga0395901_0228139 Ga0395901_0228139_1106_1858 237
422 3300038443 Ga0395901_0242841 Ga0395901_0242841_980_1714 237
423 3300038443 Ga0395901_0578620 Ga0395901_0578620_192_944 237
424 3300039437 Ga0436365_0615168 Ga0436365_0615168_239_973 237
425 3300039437 Ga0436365_1781661 Ga0436365_1781661_465_1199 237
426 3300039437 Ga0436365_1883906 Ga0436365_1883906_292_1026 237
427 3300039438 Ga0436360_1259955 Ga0436360_1259955_73_807 237
428 3300039447 Ga0436361_0128647 Ga0436361_0128647_1549_2283 237
429 3300041413 Ga0439465_0021320 Ga0439465_0021320_250_1005 237
430 3300041413 Ga0439465_0038196 Ga0439465_0038196_737_1450 237
431 3300041512 Ga0451853_0502755 Ga0451853_0502755_783_1538 237
432 3300044693 Ga0466961_0179080 Ga0466961_0179080_442_1176 237
433 3300044765 Ga0466970_0081668 Ga0466970_0081668_1001_1735 237
434 3300044842 Ga0466957_0026170 Ga0466957_0026170_970_1704 237
435 3300045976 Ga0466967_0098515 Ga0466967_0098515_1791_2525 237
436 3300045976 Ga0466967_0181087 Ga0466967_0181087_824_1558 237
437 3300045976 Ga0466967_0229819 Ga0466967_0229819_992_1744 237
438 3300046454 Ga0495592_0012012 Ga0495592_0012012_3689_4462 237
439 3300046454 Ga0495592_0013641 Ga0495592_0013641_1539_2273 237
440 3300046455 Ga0495603_0003046 Ga0495603_0003046_3474_4208 237
441 3300046455 Ga0495603_0011007 Ga0495603_0011007_403_1137 237
442 3300046455 Ga0495603_0068579 Ga0495603_0068579_163_918 237
443 3300046459 Ga0495629_0000439 Ga0495629_0000439_23477_24250 237
444 3300046459 Ga0495629_0000957 Ga0495629_0000957_18508_19242 237
445 3300046459 Ga0495629_0030921 Ga0495629_0030921_1358_2113 237
446 3300046462 Ga0495651_0019087 Ga0495651_0019087_1453_2208 237
447 3300046463 Ga0495653_0080143 Ga0495653_0080143_554_1327 237
448 3300046472 Ga0495580_0022668 Ga0495580_0022668_3635_4369 237
449 3300046472 Ga0495580_0090574 Ga0495580_0090574_22_756 237
450 3300046473 Ga0495582_0003251 Ga0495582_0003251_241_975 237
451 3300046473 Ga0495582_0020537 Ga0495582_0020537_619_1407 237
452 3300046473 Ga0495582_0212507 Ga0495582_0212507_254_1009 237
453 3300046475 Ga0495639_0006764 Ga0495639_0006764_1533_2321 237
454 3300046475 Ga0495639_0051304 Ga0495639_0051304_129_863 237
455 3300046476 Ga0495662_0011192 Ga0495662_0011192_3630_4364 237
456 3300046476 Ga0495662_0022869 Ga0495662_0022869_2061_2795 237
457 3300046477 Ga0495664_0014457 Ga0495664_0014457_2185_2919 237
458 3300046477 Ga0495664_0018231 Ga0495664_0018231_473_1261 237
459 3300046477 Ga0495664_0025032 Ga0495664_0025032_599_1333 237
460 3300046477 Ga0495664_0057675 Ga0495664_0057675_946_1701 237
461 3300046477 Ga0495664_0117847 Ga0495664_0117847_312_1046 237
462 3300046492 Ga0495585_0116922 Ga0495585_0116922_354_1109 237
463 3300046511 Ga0495608_0009342 Ga0495608_0009342_5682_6455 237
464 3300046511 Ga0495608_0068668 Ga0495608_0068668_1041_1775 237
465 3300046513 Ga0495616_0158056 Ga0495616_0158056_200_955 237
466 3300046514 Ga0495618_0004727 Ga0495618_0004727_7115_7870 237
467 3300046514 Ga0495618_0055842 Ga0495618_0055842_1608_2396 237
468 3300046516 Ga0495628_0009529 Ga0495628_0009529_4368_5102 237
469 3300046516 Ga0495628_0052614 Ga0495628_0052614_1654_2427 237
470 3300046517 Ga0495630_0072137 Ga0495630_0072137_69_857 237
471 3300046517 Ga0495630_0204690 Ga0495630_0204690_346_1080 237
472 3300046518 Ga0495631_0106413 Ga0495631_0106413_84_839 237
473 3300046523 Ga0495644_0035488 Ga0495644_0035488_392_1147 237
474 3300046523 Ga0495644_0071767 Ga0495644_0071767_177_932 237
475 3300046526 Ga0495666_0017968 Ga0495666_0017968_1139_1873 237
476 3300046526 Ga0495666_0044605 Ga0495666_0044605_1277_2065 237
477 3300046529 Ga0495652_0034465 Ga0495652_0034465_13_768 237
478 3300046529 Ga0495652_0042026 Ga0495652_0042026_2616_3389 237
479 3300046529 Ga0495652_0042477 Ga0495652_0042477_1787_2521 237
480 3300046529 Ga0495652_0143257 Ga0495652_0143257_399_1154 237
481 3300046531 Ga0495665_0005732 Ga0495665_0005732_2936_3670 237
482 3300046531 Ga0495665_0009314 Ga0495665_0009314_2611_3399 237
483 3300046533 Ga0495640_0001232 Ga0495640_0001232_3272_4006 237
484 3300046533 Ga0495640_0015529 Ga0495640_0015529_1492_2265 237
485 3300046533 Ga0495640_0032451 Ga0495640_0032451_504_1292 237
486 3300046533 Ga0495640_0160191 Ga0495640_0160191_424_1179 237
487 3300046535 Ga0495586_0040423 Ga0495586_0040423_1258_2013 237
488 3300046536 Ga0495587_0013476 Ga0495587_0013476_1979_2734 237
489 3300046536 Ga0495587_0092079 Ga0495587_0092079_426_1199 237
490 3300046538 Ga0495609_0071925 Ga0495609_0071925_453_1208 237
491 3300046539 Ga0495621_0025425 Ga0495621_0025425_164_919 237
492 3300046543 Ga0495645_0007838 Ga0495645_0007838_4281_5054 237
493 3300046543 Ga0495645_0031972 Ga0495645_0031972_65_820 237
494 3300046557 Ga0495622_0025591 Ga0495622_0025591_1163_1897 237
495 3300046559 Ga0495667_0003416 Ga0495667_0003416_8480_9253 237
496 3300046559 Ga0495667_0021483 Ga0495667_0021483_1409_2143 237
497 3300046559 Ga0495667_0027235 Ga0495667_0027235_1262_2017 237
498 3300046559 Ga0495667_0105989 Ga0495667_0105989_73_861 237
499 3300046559 Ga0495667_0204346 Ga0495667_0204346_121_876 237
500 3300046616 Ga0495668_0029805 Ga0495668_0029805_1409_2164 237
501 3300046642 Ga0495634_0019547 Ga0495634_0019547_1132_1905 237
502 3300046648 Ga0495611_0047528 Ga0495611_0047528_461_1216 237
503 3300046648 Ga0495611_0086703 Ga0495611_0086703_116_829 237
504 3300046660 Ga0495625_0094620 Ga0495625_0094620_380_1135 237
505 3300046663 Ga0495635_0009930 Ga0495635_0009930_3291_4064 237
506 3300046663 Ga0495635_0027261 Ga0495635_0027261_1158_1892 237
507 3300046663 Ga0495635_0087696 Ga0495635_0087696_82_870 237
508 3300046663 Ga0495635_0111512 Ga0495635_0111512_980_1735 237
509 3300046663 Ga0495635_0121454 Ga0495635_0121454_316_1071 237
510 3300046664 Ga0495659_0026482 Ga0495659_0026482_1165_1920 237
511 3300046674 Ga0495588_0129327 Ga0495588_0129327_244_996 237
512 3300046675 Ga0495657_0018194 Ga0495657_0018194_3766_4539 237
513 3300046678 Ga0495599_0001369 Ga0495599_0001369_10540_11313 237
514 3300046678 Ga0495599_0005440 Ga0495599_0005440_5384_6139 237
515 3300046678 Ga0495599_0213937 Ga0495599_0213937_415_1170 237
516 3300046680 Ga0495646_0025605 Ga0495646_0025605_2780_3514 237
517 3300046680 Ga0495646_0028973 Ga0495646_0028973_554_1327 237
518 3300046681 Ga0495647_0019993 Ga0495647_0019993_167_901 237
519 3300046684 Ga0495669_0004668 Ga0495669_0004668_3731_4486 237
520 3300046689 Ga0495613_0022008 Ga0495613_0022008_301_1074 237
521 3300046689 Ga0495613_0081708 Ga0495613_0081708_1402_2157 237
522 3300046690 Ga0495624_0171663 Ga0495624_0171663_232_987 237
523 3300046690 Ga0495624_0285742 Ga0495624_0285742_116_916 237
524 3300046809 Ga0495600_0001020 Ga0495600_0001020_35_808 237
525 3300046809 Ga0495600_0035995 Ga0495600_0035995_559_1314 237
526 3300046809 Ga0495600_0098171 Ga0495600_0098171_49_804 237
527 3300047315 Ga0495581_0000019 Ga0495581_0000019_3380_4114 237
528 3300047317 Ga0495604_0244650 Ga0495604_0244650_67_822 237
529 3300047319 Ga0495674_0000458 Ga0495674_0000458_11744_12478 237
530 3300047319 Ga0495674_0009039 Ga0495674_0009039_3271_4059 237
531 3300047319 Ga0495674_0064351 Ga0495674_0064351_251_1006 237
532 3300047319 Ga0495674_0110158 Ga0495674_0110158_808_1581 237
533 3300047319 Ga0495674_0122742 Ga0495674_0122742_365_1099 237
534 3300047320 Ga0495672_0073410 Ga0495672_0073410_335_1090 237
535 3300047322 Ga0495680_0013039 Ga0495680_0013039_5946_6719 237
536 3300047322 Ga0495680_0015630 Ga0495680_0015630_4334_5089 237
537 3300047444 Ga0495675_0080493 Ga0495675_0080493_1168_1923 237
538 3300047444 Ga0495675_0088933 Ga0495675_0088933_35_808 237
539 3300047469 Ga0495673_0082853 Ga0495673_0082853_296_1051 237
540 3300047471 Ga0495684_0007607 Ga0495684_0007607_5149_5922 237
541 3300047471 Ga0495684_0011461 Ga0495684_0011461_3327_4115 237
542 3300047673 Ga0495593_0000687 Ga0495593_0000687_3290_4063 237
543 3300047673 Ga0495593_0079891 Ga0495593_0079891_586_1341 237
544 3300047673 Ga0495593_0124640 Ga0495593_0124640_440_1195 237
545 3300048088 Ga0495602_0118820 Ga0495602_0118820_416_1150 237
546 3300048088 Ga0495602_0173768 Ga0495602_0173768_187_942 237
547 3300048088 Ga0495602_0314863 Ga0495602_0314863_264_998 237
548 3300048903 Ga0496100_0015649 Ga0496100_0015649_2263_3024 237
549 3300048903 Ga0496100_0092825 Ga0496100_0092825_451_1203 237
550 3300048903 Ga0496100_0205623 Ga0496100_0205623_685_1419 237
551 3300048904 Ga0496101_0004392 Ga0496101_0004392_5606_6361 237
552 3300048904 Ga0496101_0043859 Ga0496101_0043859_2043_2795 237
553 3300048904 Ga0496101_0194526 Ga0496101_0194526_642_1397 237
554 3300048905 Ga0496102_0013777 Ga0496102_0013777_3981_4742 237
555 3300048905 Ga0496102_0052436 Ga0496102_0052436_957_1712 237
556 3300048905 Ga0496102_0112622 Ga0496102_0112622_1391_2143 237
557 3300048905 Ga0496102_0113133 Ga0496102_0113133_1780_2514 237
558 3300048906 Ga0496103_0237018 Ga0496103_0237018_83_856 237
559 3300048906 Ga0496103_0361053 Ga0496103_0361053_46_801 237
560 3300048907 Ga0496104_0041945 Ga0496104_0041945_912_1673 237
561 3300048907 Ga0496104_0246531 Ga0496104_0246531_885_1640 237
562 3300048907 Ga0496104_0405554 Ga0496104_0405554_175_909 237
563 3300048909 Ga0496106_0000740 Ga0496106_0000740_18964_19698 237
564 3300048909 Ga0496106_0018748 Ga0496106_0018748_1975_2736 237
565 3300048909 Ga0496106_0019707 Ga0496106_0019707_2653_3387 237
566 3300048909 Ga0496106_0296176 Ga0496106_0296176_124_837 237
567 3300048909 Ga0496106_0494628 Ga0496106_0494628_35_787 237
568 3300048910 Ga0496107_0002930 Ga0496107_0002930_3455_4216 237
569 3300048910 Ga0496107_0004783 Ga0496107_0004783_7344_8078 237
570 3300048910 Ga0496107_0033894 Ga0496107_0033894_63_815 237
571 3300048910 Ga0496107_0090860 Ga0496107_0090860_432_1205 237
572 3300048911 Ga0496108_0000938 Ga0496108_0000938_12490_13224 237
573 3300048911 Ga0496108_0199011 Ga0496108_0199011_289_1044 237
574 3300048912 Ga0496109_0000977 Ga0496109_0000977_2114_2848 237
575 3300048912 Ga0496109_0200987 Ga0496109_0200987_193_948 237
576 3300048912 Ga0496109_0224879 Ga0496109_0224879_448_1203 237
577 3300048913 Ga0496110_0003174 Ga0496110_0003174_8597_9358 237
578 3300048913 Ga0496110_0147094 Ga0496110_0147094_1153_1998 237
579 3300048913 Ga0496110_0272332 Ga0496110_0272332_328_1062 237
580 3300048914 Ga0496111_0043521 Ga0496111_0043521_1234_1989 237
581 3300048914 Ga0496111_0330929 Ga0496111_0330929_24_761 237
582 3300048915 Ga0496112_0000590 Ga0496112_0000590_6296_7030 237
583 3300048915 Ga0496112_0067674 Ga0496112_0067674_415_1170 237
584 3300048915 Ga0496112_0070093 Ga0496112_0070093_1545_2300 237
585 3300048915 Ga0496112_0310661 Ga0496112_0310661_386_1141 237
586 3300048916 Ga0496113_0014433 Ga0496113_0014433_3831_4565 237
587 3300048916 Ga0496113_0080348 Ga0496113_0080348_532_1287 237
588 3300048916 Ga0496113_0484088 Ga0496113_0484088_102_947 237
589 3300048917 Ga0496114_0236009 Ga0496114_0236009_363_1097 237
590 3300048918 Ga0496115_0003730 Ga0496115_0003730_6212_6973 237
591 3300048918 Ga0496115_0034314 Ga0496115_0034314_3091_3846 237
592 3300048920 Ga0496117_0005455 Ga0496117_0005455_3810_4544 237
593 3300048921 Ga0496118_0001758 Ga0496118_0001758_27723_28457 237
594 3300048922 Ga0496119_0040839 Ga0496119_0040839_1015_1770 237
595 3300048922 Ga0496119_0047723 Ga0496119_0047723_1495_2250 237
596 3300048922 Ga0496119_0192163 Ga0496119_0192163_136_849 237
597 3300048924 Ga0496121_0000089 Ga0496121_0000089_217685_218419 237
598 3300048924 Ga0496121_0004013 Ga0496121_0004013_1400_2134 237
599 3300048924 Ga0496121_0027921 Ga0496121_0027921_2404_3141 237
600 3300048924 Ga0496121_0064256 Ga0496121_0064256_1248_2003 237
601 3300048924 Ga0496121_0143040 Ga0496121_0143040_115_870 237
602 3300048924 Ga0496121_0145075 Ga0496121_0145075_866_1621 237
603 3300048924 Ga0496121_0150606 Ga0496121_0150606_610_1383 237
604 3300048924 Ga0496121_0150845 Ga0496121_0150845_205_960 237
605 3300048925 Ga0496122_0063008 Ga0496122_0063008_1536_2288 237
606 3300048926 Ga0496123_0125075 Ga0496123_0125075_536_1288 237
607 3300048927 Ga0496124_0001073 Ga0496124_0001073_40828_41562 237
608 3300048927 Ga0496124_0174267 Ga0496124_0174267_348_1103 237
609 3300048928 Ga0496125_0000199 Ga0496125_0000199_116660_117415 237
610 3300048928 Ga0496125_0000964 Ga0496125_0000964_330_1085 237
611 3300048928 Ga0496125_0088892 Ga0496125_0088892_526_1260 237
612 3300048929 Ga0496126_0036354 Ga0496126_0036354_3344_4078 237
613 3300048929 Ga0496126_0038119 Ga0496126_0038119_317_1069 237
614 3300048929 Ga0496126_0046484 Ga0496126_0046484_2614_3348 237
615 3300048929 Ga0496126_0046563 Ga0496126_0046563_1632_2387 237
616 3300048929 Ga0496126_0097347 Ga0496126_0097347_1001_1735 237
617 3300048929 Ga0496126_0126845 Ga0496126_0126845_1350_2111 237
618 3300048929 Ga0496126_0138554 Ga0496126_0138554_608_1357 237
619 3300048929 Ga0496126_0183917 Ga0496126_0183917_228_962 237
620 3300048929 Ga0496126_0190677 Ga0496126_0190677_697_1452 237
621 3300049459 Ga0495678_071311 Ga0495678_071311_215_970 237
622 3300049569 Ga0501032_0081894 Ga0501032_0081894_30_785 237
623 3300049571 Ga0501034_0209385 Ga0501034_0209385_773_1528 237
624 3300049572 Ga0501036_0051917 Ga0501036_0051917_19_753 237
625 3300049572 Ga0501036_0413587 Ga0501036_0413587_17_772 237
626 3300049573 Ga0501037_0020258 Ga0501037_0020258_3312_4067 237
627 3300049573 Ga0501037_0060414 Ga0501037_0060414_1470_2225 237
628 3300049573 Ga0501037_0271825 Ga0501037_0271825_67_798 237
629 3300049574 Ga0501038_0003168 Ga0501038_0003168_11855_12610 237
630 3300049574 Ga0501038_0013686 Ga0501038_0013686_3722_4477 237
631 3300049574 Ga0501038_0047759 Ga0501038_0047759_644_1399 237
632 3300049574 Ga0501038_0348908 Ga0501038_0348908_180_935 237
633 3300049575 Ga0501039_0084531 Ga0501039_0084531_313_1068 237
634 3300049575 Ga0501039_0186473 Ga0501039_0186473_303_1058 237
635 3300049577 Ga0501041_0041190 Ga0501041_0041190_280_1035 237
636 3300049578 Ga0501042_0003280 Ga0501042_0003280_1095_1850 237
637 3300049578 Ga0501042_0271419 Ga0501042_0271419_26_781 237
638 3300049579 Ga0501043_0039322 Ga0501043_0039322_833_1588 237
639 3300049579 Ga0501043_0051727 Ga0501043_0051727_1164_1919 237
640 3300049579 Ga0501043_0127714 Ga0501043_0127714_518_1273 237
641 3300049580 Ga0501046_0185115 Ga0501046_0185115_457_1212 237
642 3300049581 Ga0501047_0064889 Ga0501047_0064889_1934_2689 237
643 3300049581 Ga0501047_0319027 Ga0501047_0319027_466_1200 237
644 3300049583 Ga0501067_0051336 Ga0501067_0051336_594_1349 237
645 3300049584 Ga0501068_0002163 Ga0501068_0002163_757_1512 237
646 3300049587 Ga0501071_0150775 Ga0501071_0150775_631_1386 237
647 3300049587 Ga0501071_0213616 Ga0501071_0213616_336_1091 237
648 3300049589 Ga0501073_0169581 Ga0501073_0169581_430_1164 237
649 3300049590 Ga0501074_0011129 Ga0501074_0011129_4340_5095 237
650 3300049590 Ga0501074_0247647 Ga0501074_0247647_210_941 237
651 3300049592 Ga0501076_0024085 Ga0501076_0024085_3712_4467 237
652 3300049593 Ga0501077_0022001 Ga0501077_0022001_275_1030 237
653 3300049742 Ga0501080_0066728 Ga0501080_0066728_1362_2111 237
654 3300049742 Ga0501080_0177440 Ga0501080_0177440_983_1738 237
655 3300049742 Ga0501080_0219875 Ga0501080_0219875_237_992 237
656 3300049742 Ga0501080_0295717 Ga0501080_0295717_25_756 237
657 3300049822 Ga0501035_0017052 Ga0501035_0017052_4989_5744 237
658 3300049822 Ga0501035_0088576 Ga0501035_0088576_812_1567 237
659 3300049823 Ga0501044_0098065 Ga0501044_0098065_598_1347 237
660 3300049823 Ga0501044_0109545 Ga0501044_0109545_1646_2401 237
661 3300049823 Ga0501044_0181161 Ga0501044_0181161_297_1052 237
662 3300050491 nmdc:mga00v17_89867_c1 nmdc:mga00v17_89867_c1_742_1497 237
663 3300050493 nmdc:mga0k408_45189_c1 nmdc:mga0k408_45189_c1_1557_2312 237
664 3300050493 nmdc:mga0k408_77948_c1 nmdc:mga0k408_77948_c1_1083_1796 237
665 3300050494 nmdc:mga06z11_282780_c1 nmdc:mga06z11_282780_c1_99_812 237
666 3300050494 nmdc:mga06z11_407666_c1 nmdc:mga06z11_407666_c1_50_805 237
667 3300050496 nmdc:mga07m45_46230_c1 nmdc:mga07m45_46230_c1_76_789 237
668 3300050511 nmdc:mga08y16_136202_c1 nmdc:mga08y16_136202_c1_1114_1869 237
669 3300050512 nmdc:mga0n895_18842_c1 nmdc:mga0n895_18842_c1_689_1423 237
670 3300050513 nmdc:mga0rr50_174308_c1 nmdc:mga0rr50_174308_c1_371_1126 237
671 3300050514 nmdc:mga08x19_253571_c1 nmdc:mga08x19_253571_c1_257_991 237
672 3300050515 nmdc:mga0a205_376832_c1 nmdc:mga0a205_376832_c1_416_1171 237
673 3300053077 Ga0495601_0031878 Ga0495601_0031878_78_833 237
674 3300053077 Ga0495601_0057472 Ga0495601_0057472_1217_1990 237
675 3300053077 Ga0495601_0129943 Ga0495601_0129943_836_1570 237
676 3300053077 Ga0495601_0207496 Ga0495601_0207496_277_1011 237
677 3300053078 Ga0495612_0013526 Ga0495612_0013526_136_891 237
678 3300053083 Ga0495655_0002763 Ga0495655_0002763_477_1232 237
679 3300053084 Ga0495595_0004450 Ga0495595_0004450_1095_1868 237
680 3300053084 Ga0495595_0016779 Ga0495595_0016779_1820_2575 237
681 3300053085 Ga0495619_0001280 Ga0495619_0001280_11363_12136 237
682 3300053085 Ga0495619_0222484 Ga0495619_0222484_62_817 237
683 3300053085 Ga0495619_0289819 Ga0495619_0289819_49_804 237
684 3300053085 Ga0495619_0524069 Ga0495619_0524069_63_797 237
685 3300053090 Ga0500646_0044954 Ga0500646_0044954_166_921 237
686 3300053091 Ga0500647_0030111 Ga0500647_0030111_1380_2114 237
687 3300053092 Ga0500583_0228905 Ga0500583_0228905_122_862 237
688 3300053094 Ga0500566_0000046 Ga0500566_0000046_38224_38964 237
689 3300053094 Ga0500566_0096422 Ga0500566_0096422_536_1270 237
690 3300053096 Ga0500641_0001509 Ga0500641_0001509_6559_7314 237
691 3300053096 Ga0500641_0058753 Ga0500641_0058753_809_1564 237
692 3300053102 Ga0500554_001571 Ga0500554_001571_1802_2536 237
693 3300053119 Ga0500595_009512 Ga0500595_009512_576_1289 237
694 3300053119 Ga0500595_014720 Ga0500595_014720_764_1498 237
695 3300053130 Ga0500642_0159753 Ga0500642_0159753_177_926 237
696 3300053131 Ga0500652_109798 Ga0500652_109798_267_980 237
697 3300053136 Ga0500559_0001633 Ga0500559_0001633_10963_11703 237
698 3300053139 Ga0500568_0051503 Ga0500568_0051503_204_947 237
699 3300053142 Ga0500577_0113997 Ga0500577_0113997_368_1081 237
700 3300053146 Ga0500588_0065533 Ga0500588_0065533_241_996 237
701 3300053150 Ga0500603_000071 Ga0500603_000071_11053_11793 237
702 3300053150 Ga0500603_000328 Ga0500603_000328_135_869 237
703 3300053160 Ga0500633_0048777 Ga0500633_0048777_94_849 237
704 3300053163 Ga0500639_000009 Ga0500639_000009_130469_131209 237
705 3300053177 Ga0500636_0026626 Ga0500636_0026626_84_818 237
706 3300053178 Ga0500637_0001994 Ga0500637_0001994_3241_3975 237
707 3300053178 Ga0500637_0051276 Ga0500637_0051276_319_1074 237
708 3300053178 Ga0500637_0158607 Ga0500637_0158607_179_925 237
709 3300053731 Ga0500609_006359 Ga0500609_006359_640_1353 237
710 3300054114 Ga0501084_0498017 Ga0501084_0498017_192_947 237
711 3300060353 Ga0501082_0192295 Ga0501082_0192295_185_940 237
712 3300061719 Ga0466962_0239302 Ga0466962_0239302_96_830 237
713 3300061734 Ga0530510_0323810 Ga0530510_0323810_382_1137 237
714 iso_pu_bacteria 2508501128 2509151028 237
715 iso_pu_bacteria 2513237096 2513657292 237
716 iso_pu_bacteria 2513237098 2513678787 237
717 iso_pu_bacteria 2513237104 2513722073 237
718 iso_pu_bacteria 2513237137 2513857763 237
719 iso_pu_bacteria 2513237145 2513919300 237
720 iso_pu_bacteria 2517572143 2517891008 237
721 iso_pu_bacteria 2524023205 2524441219 237
722 iso_pu_bacteria 2524023210 2524464977 237
723 iso_pu_bacteria 2524023228 2524537547 237
724 iso_pu_bacteria 2667528175 2671120075 237
725 iso_pu_bacteria 2728368998 2728752655 237
726 iso_pu_bacteria 2744054633 2745078680 237
727 iso_pu_bacteria 2791355197 2793066364 237
728 iso_pu_bacteria 2791355199 2793080692 237
729 iso_pu_bacteria 2879110137 2879110883 237
730 iso_pu_bacteria 2885374607 2885377329 237
731 iso_pu_bacteria 2885383462 2885390525 237
732 iso_pu_bacteria 2889033259 2889037633 237
733 iso_pu_bacteria 2903748898 2903749659 237
734 iso_pu_bacteria 2903768456 2903773686 237
735 iso_pu_bacteria 2904690495 2904694466 237
736 iso_pu_bacteria 2904699407 2904700539 237
737 iso_pu_bacteria 2906610324 2906616207 237
738 iso_pu_bacteria 2906635258 2906636950 237
739 iso_pu_bacteria 2906660503 2906664456 237
740 iso_pu_bacteria 2908739725 2908741275 237
741 iso_pu_bacteria 2908756301 2908763398 237
742 iso_pu_bacteria 2922361189 2922361592 237
743 iso_pu_bacteria 2922386360 2922387182 237
744 iso_pu_bacteria 2922425934 2922431817 237
745 iso_pu_bacteria 2935630451 2935635341 237
746 iso_pu_bacteria 2941507105 2941512145 237
747 iso_pu_bacteria 2941515067 2941519847 237
748 iso_pu_bacteria 2941523033 2941527866 237
749 iso_pu_bacteria 3005474847 3005481758 237
750 iso_pu_bacteria 8006933436 8006939112 237
751 iso_pu_bacteria 8006964411 8006972354 237
752 iso_pu_bacteria 8006973647 8006978769 237
753 iso_pu_bacteria 8019555841 8019559935 237
754 iso_pu_bacteria 8019565922 8019570038 237
755 iso_pu_bacteria 8056673599 8056678767 237
756 iso_pu_bacteria 8056681323 8056687840 237
757 iso_pu_bacteria 8056689827 8056690503 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

98

280

0.97

PF01479

S4

S4 domain

43

90

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_Ae cryo-em structure of t. kodakarensis 70s ribosome 0.9519 2 40
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9378 2 41
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9374 2 41
3jbn-assembly1.cif.gz_E cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to p-trna 0.9371 2 40
7zag-assembly1.cif.gz_D cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna,mrna, aif1a and the c-terminal domain of aif5b. 0.9353 2 40
ID Description Score Start End Superfamily
2janC03 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9517 1 41 3.10.290.10
af_Q9LSV5_49_110_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9255 2 48 3.10.290.10
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9236 61 235 3.40.50.150
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9233 52 236 3.40.50.150
af_Q8I5D3_12_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9226 1 48 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A453HFZ1-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9522 58 151 GO:0008168
GO:0032259
AF-A0A7C3U522-F1-model_v4 TlyA family RNA methyltransferase 0.9517 71 236 GO:0008168
GO:0032259
AF-A0A6J7LEE1-F1-model_v4 Unannotated protein 0.9487 70 236 GO:0008168
GO:0032259
AF-A0A0W8G7W9-F1-model_v4 Rna binding methyltransferase ftsj like 0.9454 65 235 GO:0008168
GO:0032259
AF-A0A7Z9ZZR2-F1-model_v4 TlyA family RNA methyltransferase 0.9405 64 234 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
91.22 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map