F479407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 757 | 310 | 752 | 78 |
Family's Representative Sequence
| Representative Sequence | 3300042438|Ga0439459_0077582|Ga0439459_0077582_131_400 |
| Length | 89 |
| Sequence | MTDTPALDCNELVELVTAYLENALPAVERARFEAHLTECPDCVEYVAQFQRTIAAIGLAAPELERTPPVSDLLRVFRDWKRGAAAPTMN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 2 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 3 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 4 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 5 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 88 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 207 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 208 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 216 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 217 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 226 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 229 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 230 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 233 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 238 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 247 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 280 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 288 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 298 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 300 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 302 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 304 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.51 |
| Nodule | 0 |
| Rhizoplane | 10.17 |
| Rhizosphere | 69.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003633 | 3300001977 | Bacteria | 2429 |
| 2 | JGI24739J22299_10152601 | 3300001989 | Bacteria | 683 |
| 3 | JGI24737J22298_10032763 | 3300001990 | Bacteria | 1617 |
| 4 | JGI24743J22301_10032924 | 3300001991 | Bacteria | 1025 |
| 5 | JGI24735J21928_10045320 | 3300002067 | Bacteria | 1277 |
| 6 | JGI24735J21928_10129938 | 3300002067 | Bacteria | 726 |
| 7 | JGI24735J21928_10172605 | 3300002067 | Bacteria | 625 |
| 8 | JGI24735J21928_10184276 | 3300002067 | Bacteria | 604 |
| 9 | JGI24750J21931_1023575 | 3300002070 | Bacteria | 874 |
| 10 | JGI24745J21846_1002064 | 3300002073 | Bacteria | 2015 |
| 11 | JGI24738J21930_10036836 | 3300002075 | Bacteria | 995 |
| 12 | JGI24744J21845_10004063 | 3300002077 | Bacteria | 3019 |
| 13 | JGI24034J26672_10004458 | 3300002239 | Bacteria | 1987 |
| 14 | JGI24034J26672_10010903 | 3300002239 | Bacteria | 1356 |
| 15 | JGI24034J26672_10114638 | 3300002239 | Bacteria | 517 |
| 16 | JGI24742J22300_10025243 | 3300002244 | Bacteria | 1026 |
| 17 | JGI24742J22300_10068884 | 3300002244 | Bacteria | 658 |
| 18 | Ga0055540_1001650 | 3300003792 | Bacteria | 12948 |
| 19 | Ga0065704_10414286 | 3300005289 | Bacteria | 714 |
| 20 | Ga0070676_10114087 | 3300005328 | Bacteria | 1687 |
| 21 | Ga0070690_100178641 | 3300005330 | Bacteria | 1466 |
| 22 | Ga0070690_100487282 | 3300005330 | Bacteria | 920 |
| 23 | Ga0070670_100048485 | 3300005331 | Bacteria | 3655 |
| 24 | Ga0070677_10293030 | 3300005333 | Bacteria | 824 |
| 25 | Ga0068869_100053371 | 3300005334 | Bacteria | 2938 |
| 26 | Ga0068869_100181551 | 3300005334 | Bacteria | 1650 |
| 27 | Ga0070666_10360984 | 3300005335 | Bacteria | 1041 |
| 28 | Ga0070666_10697788 | 3300005335 | Bacteria | 744 |
| 29 | Ga0070682_100003990 | 3300005337 | Bacteria | 8196 |
| 30 | Ga0070682_100362958 | 3300005337 | Bacteria | 1084 |
| 31 | Ga0070682_101528546 | 3300005337 | Bacteria | 575 |
| 32 | Ga0068868_100177748 | 3300005338 | Bacteria | 1764 |
| 33 | Ga0068868_100298665 | 3300005338 | Bacteria | 1367 |
| 34 | Ga0068868_100862323 | 3300005338 | Bacteria | 821 |
| 35 | Ga0070660_100088227 | 3300005339 | Bacteria | 2442 |
| 36 | Ga0070689_100109321 | 3300005340 | Bacteria | 2197 |
| 37 | Ga0070689_100292911 | 3300005340 | Bacteria | 1353 |
| 38 | Ga0070691_10160743 | 3300005341 | Bacteria | 1158 |
| 39 | Ga0070691_10163501 | 3300005341 | Bacteria | 1149 |
| 40 | Ga0070687_100860647 | 3300005343 | Bacteria | 647 |
| 41 | Ga0070661_101140799 | 3300005344 | Unclassified | 650 |
| 42 | Ga0070692_10554904 | 3300005345 | Unclassified | 753 |
| 43 | Ga0070668_100002358 | 3300005347 | Bacteria | 13884 |
| 44 | Ga0070668_100011959 | 3300005347 | Bacteria | 6465 |
| 45 | Ga0070668_100061829 | 3300005347 | Bacteria | 2902 |
| 46 | Ga0070668_100560864 | 3300005347 | Bacteria | 995 |
| 47 | Ga0070668_101001721 | 3300005347 | Bacteria | 751 |
| 48 | Ga0070668_101996864 | 3300005347 | Bacteria | 535 |
| 49 | Ga0070669_100000585 | 3300005353 | Bacteria | 27148 |
| 50 | Ga0070669_100088627 | 3300005353 | Bacteria | 2316 |
| 51 | Ga0070671_100004637 | 3300005355 | Bacteria | 10904 |
| 52 | Ga0070671_100124174 | 3300005355 | Bacteria | 2173 |
| 53 | Ga0070671_100176939 | 3300005355 | Bacteria | 1806 |
| 54 | Ga0070671_100341920 | 3300005355 | Bacteria | 1277 |
| 55 | Ga0070671_100637582 | 3300005355 | Bacteria | 922 |
| 56 | Ga0070674_100045623 | 3300005356 | Bacteria | 2994 |
| 57 | Ga0070674_100224370 | 3300005356 | Bacteria | 1463 |
| 58 | Ga0070674_101424652 | 3300005356 | Bacteria | 621 |
| 59 | Ga0070673_100017849 | 3300005364 | Bacteria | 5057 |
| 60 | Ga0070688_100507032 | 3300005365 | Unclassified | 911 |
| 61 | Ga0070659_100087977 | 3300005366 | Bacteria | 2487 |
| 62 | Ga0070659_100325107 | 3300005366 | Unclassified | 1286 |
| 63 | Ga0070667_100000033 | 3300005367 | Bacteria | 175463 |
| 64 | Ga0070667_100022244 | 3300005367 | Bacteria | 5260 |
| 65 | Ga0070667_100024671 | 3300005367 | Bacteria | 4996 |
| 66 | Ga0070667_100195203 | 3300005367 | Bacteria | 1794 |
| 67 | Ga0070667_100223944 | 3300005367 | Bacteria | 1675 |
| 68 | Ga0070709_10013527 | 3300005434 | Bacteria | 4591 |
| 69 | Ga0070710_10005227 | 3300005437 | Bacteria | 6154 |
| 70 | Ga0070710_10180346 | 3300005437 | Bacteria | 1322 |
| 71 | Ga0070701_10100724 | 3300005438 | Bacteria | 1600 |
| 72 | Ga0070701_10369253 | 3300005438 | Bacteria | 901 |
| 73 | Ga0070711_100125537 | 3300005439 | Bacteria | 1904 |
| 74 | Ga0070711_100508055 | 3300005439 | Bacteria | 995 |
| 75 | Ga0070705_100031435 | 3300005440 | Bacteria | 2939 |
| 76 | Ga0070705_100140614 | 3300005440 | Bacteria | 1588 |
| 77 | Ga0070700_101527401 | 3300005441 | Unclassified | 568 |
| 78 | Ga0070694_100111372 | 3300005444 | Bacteria | 1951 |
| 79 | Ga0070694_100374454 | 3300005444 | Bacteria | 1109 |
| 80 | Ga0070708_100022132 | 3300005445 | Bacteria | 5387 |
| 81 | Ga0070708_100792267 | 3300005445 | Bacteria | 891 |
| 82 | Ga0070708_101367605 | 3300005445 | Bacteria | 661 |
| 83 | Ga0070663_100057743 | 3300005455 | Bacteria | 2785 |
| 84 | Ga0070663_100854576 | 3300005455 | Bacteria | 783 |
| 85 | Ga0070663_101121020 | 3300005455 | Bacteria | 689 |
| 86 | Ga0070663_101421134 | 3300005455 | Unclassified | 615 |
| 87 | Ga0070678_100034461 | 3300005456 | Bacteria | 3526 |
| 88 | Ga0070678_100043294 | 3300005456 | Bacteria | 3205 |
| 89 | Ga0070678_100190628 | 3300005456 | Bacteria | 1685 |
| 90 | Ga0070678_100567173 | 3300005456 | Bacteria | 1010 |
| 91 | Ga0070662_100172232 | 3300005457 | Bacteria | 1700 |
| 92 | Ga0070681_11568200 | 3300005458 | Bacteria | 584 |
| 93 | Ga0070706_100015125 | 3300005467 | Bacteria | 7125 |
| 94 | Ga0070706_100073183 | 3300005467 | Bacteria | 3171 |
| 95 | Ga0070707_100007233 | 3300005468 | Bacteria | 10303 |
| 96 | Ga0070707_100120284 | 3300005468 | Bacteria | 2549 |
| 97 | Ga0070698_100048472 | 3300005471 | Bacteria | 4341 |
| 98 | Ga0070698_100172088 | 3300005471 | Bacteria | 2106 |
| 99 | Ga0070699_100007861 | 3300005518 | Bacteria | 9264 |
| 100 | Ga0070699_100069585 | 3300005518 | Bacteria | 3058 |
| 101 | Ga0070684_100527954 | 3300005535 | Unclassified | 1094 |
| 102 | Ga0070697_100079472 | 3300005536 | Bacteria | 2700 |
| 103 | Ga0068853_100056314 | 3300005539 | Bacteria | 3389 |
| 104 | Ga0068853_100135994 | 3300005539 | Bacteria | 2203 |
| 105 | Ga0068853_100980330 | 3300005539 | Unclassified | 813 |
| 106 | Ga0068853_101144945 | 3300005539 | Bacteria | 751 |
| 107 | Ga0068853_101746773 | 3300005539 | Bacteria | 603 |
| 108 | Ga0070672_100875423 | 3300005543 | Bacteria | 793 |
| 109 | Ga0070686_100671204 | 3300005544 | Bacteria | 824 |
| 110 | Ga0070686_101549076 | 3300005544 | Bacteria | 560 |
| 111 | Ga0070695_100149934 | 3300005545 | Bacteria | 1626 |
| 112 | Ga0070695_100158148 | 3300005545 | Bacteria | 1588 |
| 113 | Ga0070696_100082713 | 3300005546 | Bacteria | 2276 |
| 114 | Ga0070696_100167006 | 3300005546 | Bacteria | 1625 |
| 115 | Ga0070693_100083170 | 3300005547 | Bacteria | 1913 |
| 116 | Ga0070693_100101787 | 3300005547 | Bacteria | 1751 |
| 117 | Ga0070665_100003448 | 3300005548 | Bacteria | 16866 |
| 118 | Ga0070665_100012289 | 3300005548 | Bacteria | 8631 |
| 119 | Ga0070665_100013763 | 3300005548 | Bacteria | 8139 |
| 120 | Ga0070665_100739826 | 3300005548 | Bacteria | 996 |
| 121 | Ga0070665_101537949 | 3300005548 | Bacteria | 674 |
| 122 | Ga0070704_100142284 | 3300005549 | Bacteria | 1875 |
| 123 | Ga0070704_100296291 | 3300005549 | Bacteria | 1346 |
| 124 | Ga0068855_100170863 | 3300005563 | Bacteria | 2462 |
| 125 | Ga0068855_100397180 | 3300005563 | Bacteria | 1511 |
| 126 | Ga0068854_100061794 | 3300005578 | Bacteria | 2714 |
| 127 | Ga0068854_100127770 | 3300005578 | Bacteria | 1938 |
| 128 | Ga0068854_100214659 | 3300005578 | Bacteria | 1519 |
| 129 | Ga0068856_100119856 | 3300005614 | Bacteria | 2633 |
| 130 | Ga0070702_100034485 | 3300005615 | Bacteria | 2790 |
| 131 | Ga0070702_100214242 | 3300005615 | Bacteria | 1284 |
| 132 | Ga0070702_100465749 | 3300005615 | Bacteria | 920 |
| 133 | Ga0070702_101284614 | 3300005615 | Bacteria | 594 |
| 134 | Ga0068852_100288167 | 3300005616 | Bacteria | 1585 |
| 135 | Ga0068852_101140323 | 3300005616 | Bacteria | 800 |
| 136 | Ga0068852_101175799 | 3300005616 | Bacteria | 788 |
| 137 | Ga0068859_100004951 | 3300005617 | Bacteria | 13527 |
| 138 | Ga0068859_100391310 | 3300005617 | Bacteria | 1486 |
| 139 | Ga0068859_100669230 | 3300005617 | Bacteria | 1129 |
| 140 | Ga0068859_101166934 | 3300005617 | Bacteria | 848 |
| 141 | Ga0068859_101655862 | 3300005617 | Bacteria | 707 |
| 142 | Ga0068864_100323023 | 3300005618 | Bacteria | 1450 |
| 143 | Ga0068864_102243308 | 3300005618 | Bacteria | 552 |
| 144 | Ga0068864_102375773 | 3300005618 | Bacteria | 536 |
| 145 | Ga0068866_10040171 | 3300005718 | Bacteria | 2314 |
| 146 | Ga0068866_11403301 | 3300005718 | Bacteria | 510 |
| 147 | Ga0068861_100126170 | 3300005719 | Bacteria | 2071 |
| 148 | Ga0068861_100142389 | 3300005719 | Bacteria | 1958 |
| 149 | Ga0068861_100148206 | 3300005719 | Bacteria | 1923 |
| 150 | Ga0068861_100457938 | 3300005719 | Bacteria | 1144 |
| 151 | Ga0068861_100988208 | 3300005719 | Bacteria | 803 |
| 152 | Ga0068861_102232519 | 3300005719 | Bacteria | 549 |
| 153 | Ga0068851_10688267 | 3300005834 | Unclassified | 628 |
| 154 | Ga0068870_10225571 | 3300005840 | Bacteria | 1149 |
| 155 | Ga0068863_100000193 | 3300005841 | Bacteria | 64832 |
| 156 | Ga0068863_100016574 | 3300005841 | Bacteria | 7070 |
| 157 | Ga0068863_100599913 | 3300005841 | Bacteria | 1090 |
| 158 | Ga0068858_100052259 | 3300005842 | Bacteria | 3780 |
| 159 | Ga0068858_100128436 | 3300005842 | Bacteria | 2375 |
| 160 | Ga0068858_100176765 | 3300005842 | Bacteria | 2014 |
| 161 | Ga0068858_100557208 | 3300005842 | Bacteria | 1110 |
| 162 | Ga0068858_101984617 | 3300005842 | Bacteria | 575 |
| 163 | Ga0068860_100000010 | 3300005843 | Bacteria | 359114 |
| 164 | Ga0068860_100107051 | 3300005843 | Bacteria | 2671 |
| 165 | Ga0068860_100385733 | 3300005843 | Bacteria | 1384 |
| 166 | Ga0068860_101120431 | 3300005843 | Bacteria | 806 |
| 167 | Ga0068860_101233988 | 3300005843 | Bacteria | 768 |
| 168 | Ga0068860_102115588 | 3300005843 | Bacteria | 584 |
| 169 | Ga0068862_100000008 | 3300005844 | Bacteria | 305510 |
| 170 | Ga0068862_100037226 | 3300005844 | Bacteria | 4123 |
| 171 | Ga0068862_100690104 | 3300005844 | Bacteria | 988 |
| 172 | Ga0068862_100778855 | 3300005844 | Bacteria | 932 |
| 173 | Ga0068862_101029497 | 3300005844 | Bacteria | 815 |
| 174 | Ga0081455_10003543 | 3300005937 | Bacteria | 17905 |
| 175 | Ga0081455_10023525 | 3300005937 | Bacteria | 5731 |
| 176 | Ga0081455_10062815 | 3300005937 | Bacteria | 3120 |
| 177 | Ga0081455_10484431 | 3300005937 | Bacteria | 835 |
| 178 | Ga0081538_10238976 | 3300005981 | Bacteria | 702 |
| 179 | Ga0081540_1124881 | 3300005983 | Bacteria | 1061 |
| 180 | Ga0070717_10009317 | 3300006028 | Bacteria | 7378 |
| 181 | Ga0070717_11403824 | 3300006028 | Bacteria | 634 |
| 182 | Ga0075365_10011898 | 3300006038 | Bacteria | 5139 |
| 183 | Ga0075365_10054882 | 3300006038 | Bacteria | 2643 |
| 184 | Ga0075365_10074261 | 3300006038 | Bacteria | 2293 |
| 185 | Ga0075365_10118319 | 3300006038 | Bacteria | 1826 |
| 186 | Ga0075365_11064074 | 3300006038 | Bacteria | 570 |
| 187 | Ga0075368_10110118 | 3300006042 | Bacteria | 1135 |
| 188 | Ga0075368_10132777 | 3300006042 | Bacteria | 1035 |
| 189 | Ga0075368_10344571 | 3300006042 | Bacteria | 648 |
| 190 | Ga0075363_100000299 | 3300006048 | Bacteria | 14518 |
| 191 | Ga0075363_100006581 | 3300006048 | Bacteria | 5291 |
| 192 | Ga0075363_100014648 | 3300006048 | Bacteria | 3839 |
| 193 | Ga0075363_100068718 | 3300006048 | Bacteria | 1921 |
| 194 | Ga0075363_100078566 | 3300006048 | Bacteria | 1801 |
| 195 | Ga0075363_100083362 | 3300006048 | Bacteria | 1752 |
| 196 | Ga0075363_100235383 | 3300006048 | Bacteria | 1052 |
| 197 | Ga0075363_100288161 | 3300006048 | Bacteria | 951 |
| 198 | Ga0075363_100363649 | 3300006048 | Bacteria | 846 |
| 199 | Ga0075363_100368669 | 3300006048 | Bacteria | 840 |
| 200 | Ga0075363_100400865 | 3300006048 | Bacteria | 806 |
| 201 | Ga0075363_100663958 | 3300006048 | Bacteria | 628 |
| 202 | Ga0075364_10000608 | 3300006051 | Bacteria | 18510 |
| 203 | Ga0075364_10026274 | 3300006051 | Bacteria | 3713 |
| 204 | Ga0075364_10044848 | 3300006051 | Bacteria | 2877 |
| 205 | Ga0075364_10053276 | 3300006051 | Bacteria | 2645 |
| 206 | Ga0075364_10124844 | 3300006051 | Bacteria | 1725 |
| 207 | Ga0075364_10207886 | 3300006051 | Bacteria | 1327 |
| 208 | Ga0075364_10351207 | 3300006051 | Bacteria | 1005 |
| 209 | Ga0075364_10437256 | 3300006051 | Bacteria | 894 |
| 210 | Ga0075364_10527113 | 3300006051 | Bacteria | 808 |
| 211 | Ga0075364_10537672 | 3300006051 | Bacteria | 799 |
| 212 | Ga0075364_10877813 | 3300006051 | Unclassified | 611 |
| 213 | Ga0075364_11150758 | 3300006051 | Unclassified | 526 |
| 214 | Ga0075364_11260911 | 3300006051 | Bacteria | 501 |
| 215 | Ga0070715_10006084 | 3300006163 | Bacteria | 4077 |
| 216 | Ga0070715_10789040 | 3300006163 | Bacteria | 575 |
| 217 | Ga0070716_100004652 | 3300006173 | Bacteria | 6576 |
| 218 | Ga0070712_100010399 | 3300006175 | Bacteria | 5870 |
| 219 | Ga0070712_100257080 | 3300006175 | Bacteria | 1398 |
| 220 | Ga0075362_10030275 | 3300006177 | Bacteria | 2337 |
| 221 | Ga0075362_10073804 | 3300006177 | Bacteria | 1562 |
| 222 | Ga0075362_10174138 | 3300006177 | Bacteria | 1041 |
| 223 | Ga0075362_10291445 | 3300006177 | Bacteria | 808 |
| 224 | Ga0075367_10058413 | 3300006178 | Bacteria | 2295 |
| 225 | Ga0075367_10178029 | 3300006178 | Bacteria | 1325 |
| 226 | Ga0075367_10735649 | 3300006178 | Bacteria | 628 |
| 227 | Ga0075367_10945551 | 3300006178 | Unclassified | 550 |
| 228 | Ga0075369_10001584 | 3300006186 | Bacteria | 7819 |
| 229 | Ga0075369_10005927 | 3300006186 | Bacteria | 4597 |
| 230 | Ga0075369_10007728 | 3300006186 | Bacteria | 4109 |
| 231 | Ga0075369_10010179 | 3300006186 | Bacteria | 3675 |
| 232 | Ga0075369_10011210 | 3300006186 | Bacteria | 3522 |
| 233 | Ga0075369_10013814 | 3300006186 | Bacteria | 3214 |
| 234 | Ga0075369_10026164 | 3300006186 | Bacteria | 2431 |
| 235 | Ga0075369_10092227 | 3300006186 | Bacteria | 1353 |
| 236 | Ga0075369_10341736 | 3300006186 | Bacteria | 702 |
| 237 | Ga0075369_10436482 | 3300006186 | Bacteria | 619 |
| 238 | Ga0075369_10490366 | 3300006186 | Bacteria | 583 |
| 239 | Ga0075369_10541941 | 3300006186 | Bacteria | 555 |
| 240 | Ga0097621_100527738 | 3300006237 | Bacteria | 1072 |
| 241 | Ga0097621_100856186 | 3300006237 | Bacteria | 845 |
| 242 | Ga0097621_101250835 | 3300006237 | Bacteria | 700 |
| 243 | Ga0075370_10022387 | 3300006353 | Bacteria | 3470 |
| 244 | Ga0075370_10045478 | 3300006353 | Bacteria | 2483 |
| 245 | Ga0075370_10056732 | 3300006353 | Bacteria | 2226 |
| 246 | Ga0075370_10066312 | 3300006353 | Bacteria | 2059 |
| 247 | Ga0075370_10492331 | 3300006353 | Bacteria | 739 |
| 248 | Ga0075370_10534360 | 3300006353 | Bacteria | 709 |
| 249 | Ga0068871_100192464 | 3300006358 | Bacteria | 1757 |
| 250 | Ga0068871_101396061 | 3300006358 | Bacteria | 660 |
| 251 | Ga0075428_100004424 | 3300006844 | Bacteria | 15515 |
| 252 | Ga0075430_100053158 | 3300006846 | Bacteria | 3411 |
| 253 | Ga0075430_100528453 | 3300006846 | Bacteria | 973 |
| 254 | Ga0075431_100248587 | 3300006847 | Bacteria | 1807 |
| 255 | Ga0068865_100116864 | 3300006881 | Bacteria | 1976 |
| 256 | Ga0068865_100118364 | 3300006881 | Bacteria | 1965 |
| 257 | Ga0068865_100393735 | 3300006881 | Unclassified | 1133 |
| 258 | Ga0068865_101587785 | 3300006881 | Bacteria | 588 |
| 259 | Ga0097620_100004951 | 3300006931 | Bacteria | 13527 |
| 260 | Ga0097620_100391346 | 3300006931 | Bacteria | 1486 |
| 261 | Ga0097620_100669229 | 3300006931 | Bacteria | 1129 |
| 262 | Ga0097620_101166789 | 3300006931 | Bacteria | 848 |
| 263 | Ga0097620_101656152 | 3300006931 | Bacteria | 707 |
| 264 | Ga0075435_101367395 | 3300007076 | Bacteria | 620 |
| 265 | Ga0075435_101855191 | 3300007076 | Bacteria | 529 |
| 266 | Ga0105250_10019823 | 3300009092 | Bacteria | 2721 |
| 267 | Ga0105250_10044712 | 3300009092 | Bacteria | 1776 |
| 268 | Ga0105245_10084905 | 3300009098 | Bacteria | 2901 |
| 269 | Ga0105245_10095749 | 3300009098 | Bacteria | 2739 |
| 270 | Ga0105245_11221514 | 3300009098 | Bacteria | 800 |
| 271 | Ga0105245_12888953 | 3300009098 | Bacteria | 532 |
| 272 | Ga0105247_10000082 | 3300009101 | Bacteria | 106460 |
| 273 | Ga0105247_10041169 | 3300009101 | Bacteria | 2826 |
| 274 | Ga0105247_10093297 | 3300009101 | Bacteria | 1913 |
| 275 | Ga0105247_10313929 | 3300009101 | Bacteria | 1091 |
| 276 | Ga0105247_10559342 | 3300009101 | Unclassified | 842 |
| 277 | Ga0114129_10826262 | 3300009147 | Bacteria | 1180 |
| 278 | Ga0114129_12841318 | 3300009147 | Bacteria | 574 |
| 279 | Ga0105243_10079971 | 3300009148 | Bacteria | 2665 |
| 280 | Ga0105243_10200174 | 3300009148 | Bacteria | 1751 |
| 281 | Ga0105241_10259202 | 3300009174 | Bacteria | 1477 |
| 282 | Ga0105241_10453177 | 3300009174 | Bacteria | 1135 |
| 283 | Ga0105241_10463618 | 3300009174 | Unclassified | 1123 |
| 284 | Ga0105242_11355716 | 3300009176 | Bacteria | 737 |
| 285 | Ga0105248_10000084 | 3300009177 | Bacteria | 110380 |
| 286 | Ga0105248_10066413 | 3300009177 | Bacteria | 4050 |
| 287 | Ga0105248_10285302 | 3300009177 | Bacteria | 1859 |
| 288 | Ga0105248_11432024 | 3300009177 | Bacteria | 782 |
| 289 | Ga0105237_10000298 | 3300009545 | Bacteria | 68533 |
| 290 | Ga0105237_10006962 | 3300009545 | Bacteria | 12462 |
| 291 | Ga0105237_10510301 | 3300009545 | Bacteria | 1209 |
| 292 | Ga0105238_11542450 | 3300009551 | Unclassified | 694 |
| 293 | Ga0105249_10000285 | 3300009553 | Bacteria | 52372 |
| 294 | Ga0105249_10036484 | 3300009553 | Bacteria | 4459 |
| 295 | Ga0105249_10306145 | 3300009553 | Bacteria | 1596 |
| 296 | Ga0105249_10364715 | 3300009553 | Bacteria | 1467 |
| 297 | Ga0105249_11693652 | 3300009553 | Bacteria | 705 |
| 298 | Ga0105249_11923220 | 3300009553 | Bacteria | 664 |
| 299 | Ga0105249_12233177 | 3300009553 | Bacteria | 620 |
| 300 | Ga0105249_13106271 | 3300009553 | Bacteria | 533 |
| 301 | Ga0099796_10002388 | 3300010159 | Bacteria | 4107 |
| 302 | Ga0105239_10014559 | 3300010375 | Bacteria | 8726 |
| 303 | Ga0105239_10046124 | 3300010375 | Bacteria | 4776 |
| 304 | Ga0105239_10167329 | 3300010375 | Unclassified | 2458 |
| 305 | Ga0105239_10583908 | 3300010375 | Bacteria | 1274 |
| 306 | Ga0105239_10716213 | 3300010375 | Bacteria | 1145 |
| 307 | Ga0105239_11693071 | 3300010375 | Bacteria | 732 |
| 308 | Ga0105239_11859294 | 3300010375 | Bacteria | 698 |
| 309 | Ga0105239_11956336 | 3300010375 | Bacteria | 680 |
| 310 | Ga0105246_10141333 | 3300011119 | Bacteria | 1810 |
| 311 | Ga0105246_10643320 | 3300011119 | Bacteria | 922 |
| 312 | Ga0105246_10851220 | 3300011119 | Bacteria | 813 |
| 313 | Ga0157370_11448349 | 3300013104 | Bacteria | 618 |
| 314 | Ga0157369_11221771 | 3300013105 | Bacteria | 767 |
| 315 | Ga0157374_10024493 | 3300013296 | Bacteria | 5412 |
| 316 | Ga0157374_10406780 | 3300013296 | Bacteria | 1358 |
| 317 | Ga0157378_10117035 | 3300013297 | Bacteria | 2452 |
| 318 | Ga0157378_10155787 | 3300013297 | Bacteria | 2132 |
| 319 | Ga0157378_10574035 | 3300013297 | Bacteria | 1136 |
| 320 | Ga0163162_10121870 | 3300013306 | Bacteria | 2712 |
| 321 | Ga0163162_10148122 | 3300013306 | Bacteria | 2464 |
| 322 | Ga0163162_10235777 | 3300013306 | Bacteria | 1960 |
| 323 | Ga0163162_10527983 | 3300013306 | Bacteria | 1309 |
| 324 | Ga0163162_10565322 | 3300013306 | Unclassified | 1265 |
| 325 | Ga0163162_10578213 | 3300013306 | Bacteria | 1250 |
| 326 | Ga0163162_10806367 | 3300013306 | Bacteria | 1056 |
| 327 | Ga0163162_11767812 | 3300013306 | Bacteria | 706 |
| 328 | Ga0163162_11824357 | 3300013306 | Bacteria | 695 |
| 329 | Ga0157372_10401058 | 3300013307 | Bacteria | 1598 |
| 330 | Ga0157375_10306065 | 3300013308 | Bacteria | 1753 |
| 331 | Ga0157375_10362306 | 3300013308 | Bacteria | 1616 |
| 332 | Ga0157375_11743126 | 3300013308 | Bacteria | 738 |
| 333 | Ga0157375_12373302 | 3300013308 | Bacteria | 633 |
| 334 | Ga0157375_12403266 | 3300013308 | Bacteria | 629 |
| 335 | Ga0157375_12680351 | 3300013308 | Bacteria | 596 |
| 336 | Ga0163163_10010591 | 3300014325 | Bacteria | 8305 |
| 337 | Ga0163163_10014507 | 3300014325 | Bacteria | 7246 |
| 338 | Ga0163163_10140332 | 3300014325 | Bacteria | 2459 |
| 339 | Ga0163163_10329443 | 3300014325 | Bacteria | 1581 |
| 340 | Ga0163163_10552520 | 3300014325 | Bacteria | 1214 |
| 341 | Ga0163163_11626437 | 3300014325 | Bacteria | 707 |
| 342 | Ga0163163_11643584 | 3300014325 | Unclassified | 703 |
| 343 | Ga0157380_10107081 | 3300014326 | Bacteria | 2341 |
| 344 | Ga0157377_11071747 | 3300014745 | Bacteria | 615 |
| 345 | Ga0157379_10096326 | 3300014968 | Bacteria | 2656 |
| 346 | Ga0157379_10258577 | 3300014968 | Bacteria | 1582 |
| 347 | Ga0157379_11448792 | 3300014968 | Bacteria | 667 |
| 348 | Ga0157379_11516810 | 3300014968 | Bacteria | 652 |
| 349 | Ga0157376_10138643 | 3300014969 | Bacteria | 2179 |
| 350 | Ga0157376_11420197 | 3300014969 | Bacteria | 726 |
| 351 | Ga0163161_10148354 | 3300017792 | Bacteria | 1781 |
| 352 | Ga0163161_10181693 | 3300017792 | Bacteria | 1613 |
| 353 | Ga0163161_10425199 | 3300017792 | Bacteria | 1069 |
| 354 | Ga0163161_10554663 | 3300017792 | Bacteria | 942 |
| 355 | Ga0163161_11602544 | 3300017792 | Unclassified | 574 |
| 356 | Ga0209673_1035110 | 3300025273 | Bacteria | 1504 |
| 357 | Ga0209051_1002514 | 3300025303 | Bacteria | 13013 |
| 358 | Ga0209051_1048851 | 3300025303 | Bacteria | 1431 |
| 359 | Ga0207656_10460559 | 3300025321 | Unclassified | 643 |
| 360 | Ga0207696_1047827 | 3300025711 | Bacteria | 1231 |
| 361 | Ga0207696_1108187 | 3300025711 | Bacteria | 754 |
| 362 | Ga0207692_10069904 | 3300025898 | Bacteria | 1846 |
| 363 | Ga0207642_10013951 | 3300025899 | Bacteria | 2948 |
| 364 | Ga0207642_10069964 | 3300025899 | Bacteria | 1666 |
| 365 | Ga0207710_10000194 | 3300025900 | Bacteria | 57908 |
| 366 | Ga0207710_10087829 | 3300025900 | Bacteria | 1451 |
| 367 | Ga0207688_10001753 | 3300025901 | Bacteria | 11515 |
| 368 | Ga0207688_10059175 | 3300025901 | Bacteria | 2157 |
| 369 | Ga0207688_10198166 | 3300025901 | Bacteria | 1203 |
| 370 | Ga0207688_10598276 | 3300025901 | Bacteria | 695 |
| 371 | Ga0207680_10341347 | 3300025903 | Bacteria | 1051 |
| 372 | Ga0207647_10340661 | 3300025904 | Bacteria | 850 |
| 373 | Ga0207685_10052796 | 3300025905 | Bacteria | 1576 |
| 374 | Ga0207685_10601742 | 3300025905 | Bacteria | 590 |
| 375 | Ga0207645_10034985 | 3300025907 | Bacteria | 3226 |
| 376 | Ga0207643_10248916 | 3300025908 | Bacteria | 1094 |
| 377 | Ga0207684_10056393 | 3300025910 | Bacteria | 3333 |
| 378 | Ga0207684_10086662 | 3300025910 | Bacteria | 2667 |
| 379 | Ga0207654_10069392 | 3300025911 | Bacteria | 2088 |
| 380 | Ga0207654_10431888 | 3300025911 | Bacteria | 921 |
| 381 | Ga0207707_10738782 | 3300025912 | Bacteria | 824 |
| 382 | Ga0207671_10031318 | 3300025914 | Bacteria | 3963 |
| 383 | Ga0207671_10382691 | 3300025914 | Bacteria | 1118 |
| 384 | Ga0207693_10004579 | 3300025915 | Bacteria | 11670 |
| 385 | Ga0207693_10160422 | 3300025915 | Bacteria | 1769 |
| 386 | Ga0207663_10081504 | 3300025916 | Bacteria | 2119 |
| 387 | Ga0207663_10274137 | 3300025916 | Bacteria | 1251 |
| 388 | Ga0207662_10246054 | 3300025918 | Bacteria | 1172 |
| 389 | Ga0207657_10050227 | 3300025919 | Bacteria | 3630 |
| 390 | Ga0207657_11253222 | 3300025919 | Bacteria | 562 |
| 391 | Ga0207649_10952347 | 3300025920 | Unclassified | 674 |
| 392 | Ga0207646_10028552 | 3300025922 | Bacteria | 5076 |
| 393 | Ga0207646_10126872 | 3300025922 | Bacteria | 2295 |
| 394 | Ga0207681_10030439 | 3300025923 | Bacteria | 3519 |
| 395 | Ga0207681_10120463 | 3300025923 | Bacteria | 1924 |
| 396 | Ga0207694_10322496 | 3300025924 | Bacteria | 1275 |
| 397 | Ga0207694_11447941 | 3300025924 | Unclassified | 580 |
| 398 | Ga0207650_10445116 | 3300025925 | Bacteria | 1077 |
| 399 | Ga0207659_10403810 | 3300025926 | Bacteria | 1143 |
| 400 | Ga0207687_10017616 | 3300025927 | Bacteria | 4705 |
| 401 | Ga0207687_10108807 | 3300025927 | Bacteria | 2053 |
| 402 | Ga0207644_10176865 | 3300025931 | Bacteria | 1670 |
| 403 | Ga0207690_10183799 | 3300025932 | Bacteria | 1576 |
| 404 | Ga0207690_10380341 | 3300025932 | Unclassified | 1122 |
| 405 | Ga0207706_10028298 | 3300025933 | Bacteria | 5006 |
| 406 | Ga0207709_10278351 | 3300025935 | Bacteria | 1235 |
| 407 | Ga0207670_10090068 | 3300025936 | Bacteria | 2166 |
| 408 | Ga0207670_10238714 | 3300025936 | Bacteria | 1399 |
| 409 | Ga0207669_10002980 | 3300025937 | Bacteria | 7275 |
| 410 | Ga0207669_10912067 | 3300025937 | Bacteria | 734 |
| 411 | Ga0207669_11496677 | 3300025937 | Bacteria | 575 |
| 412 | Ga0207669_11645605 | 3300025937 | Unclassified | 548 |
| 413 | Ga0207704_10131609 | 3300025938 | Bacteria | 1733 |
| 414 | Ga0207704_10160315 | 3300025938 | Bacteria | 1600 |
| 415 | Ga0207665_10003777 | 3300025939 | Bacteria | 10117 |
| 416 | Ga0207665_10314502 | 3300025939 | Bacteria | 1174 |
| 417 | Ga0207691_10033341 | 3300025940 | Bacteria | 4794 |
| 418 | Ga0207711_10000690 | 3300025941 | Bacteria | 33262 |
| 419 | Ga0207711_10268028 | 3300025941 | Bacteria | 1571 |
| 420 | Ga0207689_10050263 | 3300025942 | Bacteria | 3438 |
| 421 | Ga0207689_10618224 | 3300025942 | Bacteria | 912 |
| 422 | Ga0207689_11405343 | 3300025942 | Bacteria | 585 |
| 423 | Ga0207679_10282952 | 3300025945 | Bacteria | 1423 |
| 424 | Ga0207667_10127086 | 3300025949 | Bacteria | 2626 |
| 425 | Ga0207667_10505468 | 3300025949 | Bacteria | 1226 |
| 426 | Ga0207651_10122729 | 3300025960 | Bacteria | 1973 |
| 427 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 428 | Ga0207712_10064034 | 3300025961 | Bacteria | 2620 |
| 429 | Ga0207712_10570986 | 3300025961 | Bacteria | 975 |
| 430 | Ga0207668_10002560 | 3300025972 | Bacteria | 10623 |
| 431 | Ga0207668_10096909 | 3300025972 | Bacteria | 2181 |
| 432 | Ga0207668_10597014 | 3300025972 | Bacteria | 961 |
| 433 | Ga0207668_10902847 | 3300025972 | Bacteria | 786 |
| 434 | Ga0207668_12016793 | 3300025972 | Bacteria | 520 |
| 435 | Ga0207640_10139840 | 3300025981 | Bacteria | 1763 |
| 436 | Ga0207640_10331438 | 3300025981 | Unclassified | 1216 |
| 437 | Ga0207640_10744761 | 3300025981 | Bacteria | 844 |
| 438 | Ga0207658_10000220 | 3300025986 | Bacteria | 59846 |
| 439 | Ga0207658_10004124 | 3300025986 | Bacteria | 10134 |
| 440 | Ga0207658_10119986 | 3300025986 | Bacteria | 2095 |
| 441 | Ga0207658_10247762 | 3300025986 | Bacteria | 1512 |
| 442 | Ga0207677_10142531 | 3300026023 | Bacteria | 1837 |
| 443 | Ga0207677_10797660 | 3300026023 | Bacteria | 845 |
| 444 | Ga0207677_11039312 | 3300026023 | Bacteria | 744 |
| 445 | Ga0207703_10019991 | 3300026035 | Bacteria | 5232 |
| 446 | Ga0207703_10040277 | 3300026035 | Bacteria | 3738 |
| 447 | Ga0207703_10183614 | 3300026035 | Bacteria | 1847 |
| 448 | Ga0207703_10692207 | 3300026035 | Bacteria | 969 |
| 449 | Ga0207703_10971459 | 3300026035 | Bacteria | 814 |
| 450 | Ga0207639_10073551 | 3300026041 | Bacteria | 2680 |
| 451 | Ga0207639_10271993 | 3300026041 | Bacteria | 1486 |
| 452 | Ga0207639_10881612 | 3300026041 | Unclassified | 836 |
| 453 | Ga0207639_11690972 | 3300026041 | Bacteria | 593 |
| 454 | Ga0207639_12031165 | 3300026041 | Bacteria | 536 |
| 455 | Ga0207678_10053474 | 3300026067 | Bacteria | 3480 |
| 456 | Ga0207678_10232200 | 3300026067 | Bacteria | 1579 |
| 457 | Ga0207678_10303566 | 3300026067 | Bacteria | 1372 |
| 458 | Ga0207678_10890315 | 3300026067 | Bacteria | 787 |
| 459 | Ga0207708_10042495 | 3300026075 | Bacteria | 3465 |
| 460 | Ga0207641_10001710 | 3300026088 | Bacteria | 21337 |
| 461 | Ga0207641_10012303 | 3300026088 | Bacteria | 7021 |
| 462 | Ga0207641_10043028 | 3300026088 | Bacteria | 3791 |
| 463 | Ga0207641_10960899 | 3300026088 | Unclassified | 850 |
| 464 | Ga0207648_10098384 | 3300026089 | Bacteria | 2561 |
| 465 | Ga0207676_10153177 | 3300026095 | Bacteria | 1988 |
| 466 | Ga0207676_11347891 | 3300026095 | Bacteria | 709 |
| 467 | Ga0207676_12099632 | 3300026095 | Bacteria | 563 |
| 468 | Ga0207675_100090749 | 3300026118 | Bacteria | 2873 |
| 469 | Ga0207675_100115957 | 3300026118 | Bacteria | 2531 |
| 470 | Ga0207675_100145242 | 3300026118 | Bacteria | 2255 |
| 471 | Ga0207675_100177028 | 3300026118 | Bacteria | 2041 |
| 472 | Ga0207675_100832347 | 3300026118 | Bacteria | 937 |
| 473 | Ga0207683_10098056 | 3300026121 | Bacteria | 2615 |
| 474 | Ga0207683_10159484 | 3300026121 | Bacteria | 2038 |
| 475 | Ga0207698_10194931 | 3300026142 | Bacteria | 1808 |
| 476 | Ga0207698_10272784 | 3300026142 | Bacteria | 1560 |
| 477 | Ga0209813_10330654 | 3300027866 | Bacteria | 599 |
| 478 | Ga0268266_10003448 | 3300028379 | Bacteria | 15767 |
| 479 | Ga0268266_10019883 | 3300028379 | Bacteria | 5723 |
| 480 | Ga0268266_10038628 | 3300028379 | Bacteria | 4064 |
| 481 | Ga0268266_10614673 | 3300028379 | Bacteria | 1044 |
| 482 | Ga0268266_11214857 | 3300028379 | Bacteria | 729 |
| 483 | Ga0268266_11617117 | 3300028379 | Bacteria | 623 |
| 484 | Ga0268265_10000007 | 3300028380 | Bacteria | 431817 |
| 485 | Ga0268265_10054607 | 3300028380 | Bacteria | 3032 |
| 486 | Ga0268265_10196731 | 3300028380 | Bacteria | 1745 |
| 487 | Ga0268265_10289879 | 3300028380 | Bacteria | 1469 |
| 488 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 489 | Ga0268264_10059097 | 3300028381 | Bacteria | 3212 |
| 490 | Ga0268264_11681211 | 3300028381 | Bacteria | 645 |
| 491 | Ga0307408_100528655 | 3300031548 | Bacteria | 1037 |
| 492 | Ga0307405_10783953 | 3300031731 | Bacteria | 797 |
| 493 | Ga0316577_10316910 | 3300031733 | Bacteria | 884 |
| 494 | Ga0307413_10203923 | 3300031824 | Bacteria | 1430 |
| 495 | Ga0307410_10101672 | 3300031852 | Bacteria | 2061 |
| 496 | Ga0307410_10320166 | 3300031852 | Bacteria | 1230 |
| 497 | Ga0307410_10377320 | 3300031852 | Bacteria | 1140 |
| 498 | Ga0307410_10621846 | 3300031852 | Bacteria | 903 |
| 499 | Ga0307410_11588743 | 3300031852 | Unclassified | 578 |
| 500 | Ga0326468_10036814 | 3300031889 | Bacteria | 679 |
| 501 | Ga0307406_10959286 | 3300031901 | Bacteria | 731 |
| 502 | Ga0307407_10015163 | 3300031903 | Bacteria | 3799 |
| 503 | Ga0307407_10216568 | 3300031903 | Bacteria | 1292 |
| 504 | Ga0307407_10226499 | 3300031903 | Bacteria | 1267 |
| 505 | Ga0307407_11547461 | 3300031903 | Bacteria | 525 |
| 506 | Ga0307412_10683970 | 3300031911 | Bacteria | 879 |
| 507 | Ga0307409_100176711 | 3300031995 | Bacteria | 1885 |
| 508 | Ga0307409_100300178 | 3300031995 | Bacteria | 1494 |
| 509 | Ga0307409_101419491 | 3300031995 | Bacteria | 721 |
| 510 | Ga0307409_102978064 | 3300031995 | Bacteria | 500 |
| 511 | Ga0307416_100383010 | 3300032002 | Bacteria | 1437 |
| 512 | Ga0307416_100890164 | 3300032002 | Bacteria | 990 |
| 513 | Ga0307416_101486597 | 3300032002 | Bacteria | 783 |
| 514 | Ga0307414_11980000 | 3300032004 | Bacteria | 544 |
| 515 | Ga0307415_100179571 | 3300032126 | Bacteria | 1659 |
| 516 | Ga0307415_100638483 | 3300032126 | Bacteria | 953 |
| 517 | Ga0307507_10114224 | 3300033179 | Bacteria | 2190 |
| 518 | Ga0373952_0041191 | 3300035092 | Bacteria | 1068 |
| 519 | Ga0373939_0214628 | 3300035114 | Bacteria | 734 |
| 520 | Ga0373961_0103094 | 3300035241 | Bacteria | 926 |
| 521 | Ga0373931_0068314 | 3300035691 | Bacteria | 1934 |
| 522 | Ga0373947_0297871 | 3300035725 | Bacteria | 1075 |
| 523 | Ga0316584_0186137 | 3300036712 | Bacteria | 1536 |
| 524 | Ga0395900_0966063 | 3300037418 | Bacteria | 773 |
| 525 | Ga0395901_0655982 | 3300038443 | Bacteria | 1052 |
| 526 | Ga0436363_1457429 | 3300039450 | Bacteria | 1414 |
| 527 | Ga0436362_0983837 | 3300039453 | Bacteria | 507 |
| 528 | Ga0439461_0007215 | 3300041410 | Bacteria | 1961 |
| 529 | Ga0439461_0050607 | 3300041410 | Bacteria | 920 |
| 530 | Ga0439461_0080682 | 3300041410 | Bacteria | 767 |
| 531 | Ga0439461_0145607 | 3300041410 | Bacteria | 608 |
| 532 | Ga0439466_0005285 | 3300041411 | Bacteria | 4940 |
| 533 | Ga0439466_0010101 | 3300041411 | Bacteria | 3510 |
| 534 | Ga0439466_0016370 | 3300041411 | Bacteria | 2680 |
| 535 | Ga0439466_0064683 | 3300041411 | Bacteria | 1172 |
| 536 | Ga0439465_0003190 | 3300041413 | Bacteria | 5347 |
| 537 | Ga0439465_0008953 | 3300041413 | Bacteria | 3154 |
| 538 | Ga0439465_0012697 | 3300041413 | Bacteria | 2634 |
| 539 | Ga0439465_0015134 | 3300041413 | Bacteria | 2407 |
| 540 | Ga0439465_0029435 | 3300041413 | Bacteria | 1744 |
| 541 | Ga0439465_0055975 | 3300041413 | Bacteria | 1299 |
| 542 | Ga0451789_1297938 | 3300041443 | Bacteria | 515 |
| 543 | Ga0451793_0577225 | 3300041452 | Bacteria | 816 |
| 544 | Ga0451793_1717196 | 3300041452 | Bacteria | 607 |
| 545 | Ga0451797_0981697 | 3300041453 | Bacteria | 601 |
| 546 | Ga0451800_0729937 | 3300041459 | Unclassified | 545 |
| 547 | Ga0451807_1614344 | 3300041486 | Bacteria | 790 |
| 548 | Ga0451835_0309573 | 3300041492 | Bacteria | 696 |
| 549 | Ga0451853_3958433 | 3300041512 | Bacteria | 671 |
| 550 | Ga0439431_0001993 | 3300041997 | Bacteria | 4527 |
| 551 | Ga0439431_0073619 | 3300041997 | Bacteria | 913 |
| 552 | Ga0439441_138124 | 3300042001 | Bacteria | 568 |
| 553 | Ga0439442_060313 | 3300042002 | Bacteria | 804 |
| 554 | Ga0439442_128287 | 3300042002 | Bacteria | 557 |
| 555 | Ga0439445_0073051 | 3300042004 | Bacteria | 951 |
| 556 | Ga0439434_0004335 | 3300042435 | Bacteria | 4150 |
| 557 | Ga0439434_0081528 | 3300042435 | Bacteria | 1027 |
| 558 | Ga0439459_0077582 | 3300042438 | Bacteria | 779 |
| 559 | Ga0466969_0185173 | 3300044656 | Bacteria | 952 |
| 560 | Ga0466972_0010268 | 3300044658 | Bacteria | 4703 |
| 561 | Ga0466965_0006386 | 3300044683 | Bacteria | 5349 |
| 562 | Ga0466966_0023563 | 3300044684 | Bacteria | 4028 |
| 563 | Ga0466961_0006454 | 3300044693 | Bacteria | 7447 |
| 564 | Ga0466964_0076373 | 3300044706 | Bacteria | 1428 |
| 565 | Ga0466971_0030262 | 3300044719 | Bacteria | 2423 |
| 566 | Ga0466968_0009863 | 3300044735 | Bacteria | 3686 |
| 567 | Ga0466970_0007492 | 3300044765 | Bacteria | 5474 |
| 568 | Ga0466957_0049294 | 3300044842 | Bacteria | 2560 |
| 569 | Ga0466960_0026185 | 3300044901 | Bacteria | 2647 |
| 570 | Ga0466960_0230150 | 3300044901 | Bacteria | 1023 |
| 571 | Ga0466959_0050117 | 3300045049 | Bacteria | 3066 |
| 572 | Ga0466958_0006130 | 3300045836 | Bacteria | 6520 |
| 573 | Ga0466967_1544000 | 3300045976 | Bacteria | 661 |
| 574 | Ga0495584_0199897 | 3300046491 | Unclassified | 1016 |
| 575 | Ga0495583_0095284 | 3300046506 | Bacteria | 1277 |
| 576 | Ga0495644_0280457 | 3300046523 | Bacteria | 650 |
| 577 | Ga0495644_0292295 | 3300046523 | Bacteria | 637 |
| 578 | Ga0495648_0005784 | 3300046524 | Bacteria | 10198 |
| 579 | Ga0495648_0006425 | 3300046524 | Bacteria | 9597 |
| 580 | Ga0495642_0168809 | 3300046528 | Bacteria | 950 |
| 581 | Ga0495640_0634866 | 3300046533 | Unclassified | 643 |
| 582 | Ga0495640_0904555 | 3300046533 | Bacteria | 523 |
| 583 | Ga0495656_0234427 | 3300046615 | Bacteria | 922 |
| 584 | Ga0495668_0017692 | 3300046616 | Bacteria | 4129 |
| 585 | Ga0495668_0366791 | 3300046616 | Bacteria | 791 |
| 586 | Ga0495635_0368996 | 3300046663 | Bacteria | 956 |
| 587 | Ga0495670_0672048 | 3300046691 | Bacteria | 565 |
| 588 | Ga0495649_0158833 | 3300046694 | Bacteria | 1186 |
| 589 | Ga0495672_0000925 | 3300047320 | Bacteria | 30689 |
| 590 | Ga0495672_0024321 | 3300047320 | Bacteria | 3904 |
| 591 | Ga0495672_0097859 | 3300047320 | Bacteria | 1597 |
| 592 | Ga0495672_0339837 | 3300047320 | Bacteria | 700 |
| 593 | Ga0495673_0000415 | 3300047469 | Bacteria | 49621 |
| 594 | Ga0495673_0001846 | 3300047469 | Bacteria | 15895 |
| 595 | Ga0496100_0001021 | 3300048903 | Bacteria | 13521 |
| 596 | Ga0496100_0192154 | 3300048903 | Bacteria | 1483 |
| 597 | Ga0496100_0207568 | 3300048903 | Bacteria | 1431 |
| 598 | Ga0496100_1255226 | 3300048903 | Bacteria | 585 |
| 599 | Ga0496100_1412612 | 3300048903 | Bacteria | 549 |
| 600 | Ga0496101_0000011 | 3300048904 | Bacteria | 272153 |
| 601 | Ga0496101_0071482 | 3300048904 | Bacteria | 2544 |
| 602 | Ga0496101_0291028 | 3300048904 | Bacteria | 1278 |
| 603 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 604 | Ga0496102_0000249 | 3300048905 | Bacteria | 70385 |
| 605 | Ga0496102_0036339 | 3300048905 | Bacteria | 4437 |
| 606 | Ga0496102_0153117 | 3300048905 | Bacteria | 2167 |
| 607 | Ga0496102_0179542 | 3300048905 | Bacteria | 1994 |
| 608 | Ga0496102_0209834 | 3300048905 | Bacteria | 1836 |
| 609 | Ga0496102_0646540 | 3300048905 | Bacteria | 981 |
| 610 | Ga0496102_0907989 | 3300048905 | Bacteria | 802 |
| 611 | Ga0496102_0946435 | 3300048905 | Bacteria | 782 |
| 612 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 613 | Ga0496103_0001363 | 3300048906 | Bacteria | 16471 |
| 614 | Ga0496103_0056628 | 3300048906 | Bacteria | 2434 |
| 615 | Ga0496103_0355875 | 3300048906 | Bacteria | 941 |
| 616 | Ga0496103_0457527 | 3300048906 | Bacteria | 818 |
| 617 | Ga0496103_0519298 | 3300048906 | Bacteria | 761 |
| 618 | Ga0496103_0641771 | 3300048906 | Bacteria | 675 |
| 619 | Ga0496103_0902954 | 3300048906 | Bacteria | 553 |
| 620 | Ga0496104_0170499 | 3300048907 | Bacteria | 2087 |
| 621 | Ga0496104_1133772 | 3300048907 | Bacteria | 685 |
| 622 | Ga0496104_1495793 | 3300048907 | Bacteria | 578 |
| 623 | Ga0496105_0052394 | 3300048908 | Bacteria | 3371 |
| 624 | Ga0496105_0095795 | 3300048908 | Bacteria | 2451 |
| 625 | Ga0496106_0166453 | 3300048909 | Bacteria | 1745 |
| 626 | Ga0496106_0167231 | 3300048909 | Bacteria | 1741 |
| 627 | Ga0496106_0203933 | 3300048909 | Bacteria | 1574 |
| 628 | Ga0496107_0062985 | 3300048910 | Bacteria | 2687 |
| 629 | Ga0496107_0090819 | 3300048910 | Bacteria | 2231 |
| 630 | Ga0496107_0535528 | 3300048910 | Unclassified | 868 |
| 631 | Ga0496107_0930496 | 3300048910 | Bacteria | 633 |
| 632 | Ga0496107_1265927 | 3300048910 | Bacteria | 528 |
| 633 | Ga0496108_0000197 | 3300048911 | Bacteria | 55651 |
| 634 | Ga0496108_0007333 | 3300048911 | Bacteria | 8938 |
| 635 | Ga0496108_0045722 | 3300048911 | Bacteria | 3657 |
| 636 | Ga0496108_0066726 | 3300048911 | Bacteria | 3035 |
| 637 | Ga0496108_0247975 | 3300048911 | Bacteria | 1549 |
| 638 | Ga0496109_0010390 | 3300048912 | Bacteria | 7949 |
| 639 | Ga0496109_0058782 | 3300048912 | Bacteria | 3512 |
| 640 | Ga0496109_0090488 | 3300048912 | Bacteria | 2830 |
| 641 | Ga0496109_0101156 | 3300048912 | Bacteria | 2675 |
| 642 | Ga0496109_0219624 | 3300048912 | Bacteria | 1787 |
| 643 | Ga0496109_0434335 | 3300048912 | Bacteria | 1240 |
| 644 | Ga0496109_1723233 | 3300048912 | Bacteria | 560 |
| 645 | Ga0496110_0059967 | 3300048913 | Bacteria | 3355 |
| 646 | Ga0496110_0074128 | 3300048913 | Bacteria | 3022 |
| 647 | Ga0496110_0205623 | 3300048913 | Bacteria | 1789 |
| 648 | Ga0496110_0245260 | 3300048913 | Unclassified | 1630 |
| 649 | Ga0496111_0137824 | 3300048914 | Bacteria | 1808 |
| 650 | Ga0496111_0176634 | 3300048914 | Bacteria | 1587 |
| 651 | Ga0496111_0468911 | 3300048914 | Bacteria | 928 |
| 652 | Ga0496111_1338731 | 3300048914 | Bacteria | 503 |
| 653 | Ga0496112_0010567 | 3300048915 | Bacteria | 8384 |
| 654 | Ga0496112_0015977 | 3300048915 | Bacteria | 7017 |
| 655 | Ga0496112_0057875 | 3300048915 | Bacteria | 3817 |
| 656 | Ga0496112_0162551 | 3300048915 | Bacteria | 2199 |
| 657 | Ga0496113_0024769 | 3300048916 | Bacteria | 4271 |
| 658 | Ga0496113_0035734 | 3300048916 | Bacteria | 3636 |
| 659 | Ga0496113_0120716 | 3300048916 | Bacteria | 2049 |
| 660 | Ga0496113_0906694 | 3300048916 | Bacteria | 697 |
| 661 | Ga0496114_0135050 | 3300048917 | Bacteria | 2133 |
| 662 | Ga0496114_0258801 | 3300048917 | Bacteria | 1532 |
| 663 | Ga0496114_0320743 | 3300048917 | Bacteria | 1369 |
| 664 | Ga0496114_1218025 | 3300048917 | Bacteria | 639 |
| 665 | Ga0496115_0538140 | 3300048918 | Bacteria | 935 |
| 666 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 667 | Ga0496116_0009418 | 3300048919 | Bacteria | 8325 |
| 668 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 669 | Ga0496117_0001361 | 3300048920 | Bacteria | 35650 |
| 670 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 671 | Ga0496118_0000927 | 3300048921 | Bacteria | 45822 |
| 672 | Ga0496119_0000755 | 3300048922 | Bacteria | 43406 |
| 673 | Ga0496119_0007047 | 3300048922 | Bacteria | 10229 |
| 674 | Ga0496119_0192761 | 3300048922 | Bacteria | 1061 |
| 675 | Ga0496120_0000449 | 3300048923 | Bacteria | 65290 |
| 676 | Ga0496120_0075396 | 3300048923 | Bacteria | 1841 |
| 677 | Ga0496121_0000039 | 3300048924 | Bacteria | 351444 |
| 678 | Ga0496121_0002149 | 3300048924 | Bacteria | 30900 |
| 679 | Ga0496124_0054793 | 3300048927 | Bacteria | 3373 |
| 680 | Ga0496124_0968036 | 3300048927 | Bacteria | 510 |
| 681 | Ga0496125_0040332 | 3300048928 | Bacteria | 4007 |
| 682 | Ga0496126_0009543 | 3300048929 | Bacteria | 10295 |
| 683 | Ga0496126_0052637 | 3300048929 | Bacteria | 3698 |
| 684 | Ga0496126_0625818 | 3300048929 | Bacteria | 845 |
| 685 | Ga0501034_0286511 | 3300049571 | Bacteria | 1586 |
| 686 | nmdc:mga03683_236302_c1 | 3300050489 | Bacteria | 846 |
| 687 | nmdc:mga03683_313190_c1 | 3300050489 | Bacteria | 738 |
| 688 | nmdc:mga03683_83802_c1 | 3300050489 | Bacteria | 1381 |
| 689 | nmdc:mga03n38_154777_c1 | 3300050490 | Bacteria | 1156 |
| 690 | nmdc:mga03n38_177985_c1 | 3300050490 | Bacteria | 1088 |
| 691 | nmdc:mga03n38_18508_c1 | 3300050490 | Bacteria | 2751 |
| 692 | nmdc:mga03n38_21851_c1 | 3300050490 | Unclassified | 2581 |
| 693 | nmdc:mga03n38_243415_c1 | 3300050490 | Bacteria | 947 |
| 694 | nmdc:mga03n38_253747_c1 | 3300050490 | Bacteria | 930 |
| 695 | nmdc:mga03n38_426640_c1 | 3300050490 | Bacteria | 734 |
| 696 | nmdc:mga03n38_530643_c1 | 3300050490 | Bacteria | 664 |
| 697 | nmdc:mga03n38_53247_c1 | 3300050490 | Bacteria | 1814 |
| 698 | nmdc:mga03n38_694151_c1 | 3300050490 | Bacteria | 586 |
| 699 | nmdc:mga03n38_86221_c1 | 3300050490 | Bacteria | 1486 |
| 700 | nmdc:mga03n38_883599_c1 | 3300050490 | Bacteria | 524 |
| 701 | nmdc:mga00v17_116301_c1 | 3300050491 | Bacteria | 1700 |
| 702 | nmdc:mga00v17_153246_c1 | 3300050491 | Bacteria | 1481 |
| 703 | nmdc:mga00v17_219045_c1 | 3300050491 | Bacteria | 1232 |
| 704 | nmdc:mga00v17_220525_c1 | 3300050491 | Bacteria | 1228 |
| 705 | nmdc:mga00v17_28673_c2 | 3300050491 | Bacteria | 584 |
| 706 | nmdc:mga00v17_2935_c1 | 3300050491 | Bacteria | 8746 |
| 707 | nmdc:mga00v17_396272_c1 | 3300050491 | Bacteria | 897 |
| 708 | nmdc:mga00v17_451593_c1 | 3300050491 | Unclassified | 834 |
| 709 | nmdc:mga00v17_554942_c1 | 3300050491 | Bacteria | 743 |
| 710 | nmdc:mga00v17_7006_c1 | 3300050491 | Bacteria | 6001 |
| 711 | nmdc:mga00v17_75146_c1 | 3300050491 | Bacteria | 2100 |
| 712 | nmdc:mga0yw44_18493_c1 | 3300050492 | Bacteria | 3819 |
| 713 | nmdc:mga0yw44_296286_c1 | 3300050492 | Bacteria | 1083 |
| 714 | nmdc:mga0yw44_5046_c2 | 3300050492 | Bacteria | 5696 |
| 715 | nmdc:mga0yw44_55405_c1 | 3300050492 | Bacteria | 2412 |
| 716 | nmdc:mga06z11_20547_c1 | 3300050494 | Bacteria | 3053 |
| 717 | nmdc:mga06z11_56892_c1 | 3300050494 | Bacteria | 2024 |
| 718 | nmdc:mga04h51_105346_c1 | 3300050495 | Bacteria | 1033 |
| 719 | nmdc:mga04h51_115475_c1 | 3300050495 | Bacteria | 994 |
| 720 | nmdc:mga07m45_19884_c1 | 3300050496 | Bacteria | 3642 |
| 721 | nmdc:mga07m45_343383_c1 | 3300050496 | Bacteria | 867 |
| 722 | nmdc:mga07m45_365975_c1 | 3300050496 | Bacteria | 838 |
| 723 | nmdc:mga07m45_41866_c1 | 3300050496 | Bacteria | 2566 |
| 724 | nmdc:mga07m45_622518_c1 | 3300050496 | Bacteria | 623 |
| 725 | nmdc:mga05p37_49451_c1 | 3300050507 | Bacteria | 5171 |
| 726 | nmdc:mga0qj67_15786_c1 | 3300050509 | Bacteria | 5720 |
| 727 | nmdc:mga06r32_22714_c1 | 3300050510 | Bacteria | 5801 |
| 728 | nmdc:mga0rr50_1629683_c1 | 3300050513 | Bacteria | 544 |
| 729 | nmdc:mga0sz30_12709_c1 | 3300050516 | Bacteria | 3280 |
| 730 | nmdc:mga0sz30_15354_c1 | 3300050516 | Bacteria | 3025 |
| 731 | nmdc:mga0sz30_18015_c1 | 3300050516 | Bacteria | 2822 |
| 732 | nmdc:mga0sz30_22431_c1 | 3300050516 | Bacteria | 2562 |
| 733 | nmdc:mga0sz30_24933_c1 | 3300050516 | Bacteria | 2444 |
| 734 | nmdc:mga0sz30_253975_c1 | 3300050516 | Bacteria | 783 |
| 735 | nmdc:mga0sz30_392457_c1 | 3300050516 | Bacteria | 621 |
| 736 | nmdc:mga0sz30_57596_c1 | 3300050516 | Bacteria | 1656 |
| 737 | nmdc:mga0sz30_64448_c1 | 3300050516 | Bacteria | 1570 |
| 738 | nmdc:mga0sz30_82333_c1 | 3300050516 | Bacteria | 1393 |
| 739 | Ga0500610_0003254 | 3300053079 | Bacteria | 6193 |
| 740 | Ga0500635_0042756 | 3300053080 | Bacteria | 1521 |
| 741 | Ga0495655_0171204 | 3300053083 | Unclassified | 695 |
| 742 | Ga0500643_033189 | 3300053087 | Bacteria | 1562 |
| 743 | Ga0500650_0189011 | 3300053098 | Bacteria | 941 |
| 744 | Ga0500562_014843 | 3300053108 | Bacteria | 1996 |
| 745 | Ga0500595_070257 | 3300053119 | Bacteria | 1040 |
| 746 | Ga0500608_123746 | 3300053122 | Bacteria | 1169 |
| 747 | Ga0500652_000825 | 3300053131 | Bacteria | 10314 |
| 748 | Ga0500559_0062490 | 3300053136 | Bacteria | 1663 |
| 749 | Ga0500616_0007498 | 3300053153 | Bacteria | 6919 |
| 750 | Ga0500616_0163851 | 3300053153 | Bacteria | 1017 |
| 751 | Ga0500645_003171 | 3300053730 | Bacteria | 6833 |
| 752 | Ga0466962_0004026 | 3300061719 | Bacteria | 7039 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006048 | Ga0075363_100083362 | Ga0075363_1000833623 | 67 |
| 2 | 3300050491 | nmdc:mga00v17_28673_c2 | nmdc:mga00v17_28673_c2_237_476 | 67 |
| 3 | 3300050516 | nmdc:mga0sz30_82333_c1 | nmdc:mga0sz30_82333_c1_100_339 | 67 |
| 4 | iso_pu_bacteria | 2738541274 | 2738705265 | 70 |
| 5 | iso_pu_bacteria | 2738543028 | 2739334829 | 70 |
| 6 | iso_pu_bacteria | 2902792274 | 2902795968 | 70 |
| 7 | 3300037418 | Ga0395900_0966063 | Ga0395900_0966063_501_743 | 71 |
| 8 | 3300038443 | Ga0395901_0655982 | Ga0395901_0655982_584_826 | 71 |
| 9 | 3300002067 | JGI24735J21928_10129938 | JGI24735J21928_101299382 | 74 |
| 10 | 3300002067 | JGI24735J21928_10184276 | JGI24735J21928_101842762 | 74 |
| 11 | 3300003792 | Ga0055540_1001650 | Ga0055540_100165013 | 74 |
| 12 | 3300005347 | Ga0070668_100002358 | Ga0070668_1000023586 | 74 |
| 13 | 3300005455 | Ga0070663_100057743 | Ga0070663_1000577433 | 74 |
| 14 | 3300005455 | Ga0070663_100854576 | Ga0070663_1008545762 | 74 |
| 15 | 3300005455 | Ga0070663_101421134 | Ga0070663_1014211342 | 74 |
| 16 | 3300005456 | Ga0070678_100190628 | Ga0070678_1001906282 | 74 |
| 17 | 3300005539 | Ga0068853_100980330 | Ga0068853_1009803302 | 74 |
| 18 | 3300005539 | Ga0068853_101746773 | Ga0068853_1017467731 | 74 |
| 19 | 3300005563 | Ga0068855_100170863 | Ga0068855_1001708632 | 74 |
| 20 | 3300005937 | Ga0081455_10003543 | Ga0081455_1000354310 | 74 |
| 21 | 3300006038 | Ga0075365_10011898 | Ga0075365_100118985 | 74 |
| 22 | 3300006038 | Ga0075365_10054882 | Ga0075365_100548822 | 74 |
| 23 | 3300006042 | Ga0075368_10110118 | Ga0075368_101101181 | 74 |
| 24 | 3300006048 | Ga0075363_100000299 | Ga0075363_10000029917 | 74 |
| 25 | 3300006051 | Ga0075364_10053276 | Ga0075364_100532764 | 74 |
| 26 | 3300006051 | Ga0075364_10207886 | Ga0075364_102078862 | 74 |
| 27 | 3300006051 | Ga0075364_10537672 | Ga0075364_105376722 | 74 |
| 28 | 3300006178 | Ga0075367_10178029 | Ga0075367_101780292 | 74 |
| 29 | 3300006186 | Ga0075369_10011210 | Ga0075369_100112105 | 74 |
| 30 | 3300006186 | Ga0075369_10026164 | Ga0075369_100261642 | 74 |
| 31 | 3300006353 | Ga0075370_10022387 | Ga0075370_100223872 | 74 |
| 32 | 3300006353 | Ga0075370_10056732 | Ga0075370_100567322 | 74 |
| 33 | 3300006358 | Ga0068871_101396061 | Ga0068871_1013960612 | 74 |
| 34 | 3300007076 | Ga0075435_101367395 | Ga0075435_1013673952 | 74 |
| 35 | 3300009092 | Ga0105250_10044712 | Ga0105250_100447123 | 74 |
| 36 | 3300009098 | Ga0105245_10095749 | Ga0105245_100957492 | 74 |
| 37 | 3300009098 | Ga0105245_11221514 | Ga0105245_112215142 | 74 |
| 38 | 3300009098 | Ga0105245_12888953 | Ga0105245_128889531 | 74 |
| 39 | 3300009101 | Ga0105247_10093297 | Ga0105247_100932973 | 74 |
| 40 | 3300009101 | Ga0105247_10313929 | Ga0105247_103139292 | 74 |
| 41 | 3300009148 | Ga0105243_10079971 | Ga0105243_100799713 | 74 |
| 42 | 3300009174 | Ga0105241_10453177 | Ga0105241_104531772 | 74 |
| 43 | 3300009174 | Ga0105241_10463618 | Ga0105241_104636181 | 74 |
| 44 | 3300009176 | Ga0105242_11355716 | Ga0105242_113557162 | 74 |
| 45 | 3300009177 | Ga0105248_10285302 | Ga0105248_102853023 | 74 |
| 46 | 3300009545 | Ga0105237_10000298 | Ga0105237_1000029824 | 74 |
| 47 | 3300009545 | Ga0105237_10510301 | Ga0105237_105103012 | 74 |
| 48 | 3300009551 | Ga0105238_11542450 | Ga0105238_115424501 | 74 |
| 49 | 3300009553 | Ga0105249_10364715 | Ga0105249_103647151 | 74 |
| 50 | 3300009553 | Ga0105249_11923220 | Ga0105249_119232202 | 74 |
| 51 | 3300009553 | Ga0105249_12233177 | Ga0105249_122331772 | 74 |
| 52 | 3300010159 | Ga0099796_10002388 | Ga0099796_100023885 | 74 |
| 53 | 3300010375 | Ga0105239_10014559 | Ga0105239_100145595 | 74 |
| 54 | 3300010375 | Ga0105239_10167329 | Ga0105239_101673292 | 74 |
| 55 | 3300010375 | Ga0105239_10716213 | Ga0105239_107162132 | 74 |
| 56 | 3300010375 | Ga0105239_11693071 | Ga0105239_116930711 | 74 |
| 57 | 3300011119 | Ga0105246_10141333 | Ga0105246_101413333 | 74 |
| 58 | 3300011119 | Ga0105246_10643320 | Ga0105246_106433202 | 74 |
| 59 | 3300013105 | Ga0157369_11221771 | Ga0157369_112217712 | 74 |
| 60 | 3300013296 | Ga0157374_10024493 | Ga0157374_100244934 | 74 |
| 61 | 3300013297 | Ga0157378_10117035 | Ga0157378_101170352 | 74 |
| 62 | 3300013297 | Ga0157378_10574035 | Ga0157378_105740353 | 74 |
| 63 | 3300013306 | Ga0163162_10121870 | Ga0163162_101218703 | 74 |
| 64 | 3300013306 | Ga0163162_10148122 | Ga0163162_101481222 | 74 |
| 65 | 3300013306 | Ga0163162_10527983 | Ga0163162_105279831 | 74 |
| 66 | 3300013306 | Ga0163162_10578213 | Ga0163162_105782132 | 74 |
| 67 | 3300013306 | Ga0163162_11767812 | Ga0163162_117678121 | 74 |
| 68 | 3300013307 | Ga0157372_10401058 | Ga0157372_104010583 | 74 |
| 69 | 3300013308 | Ga0157375_11743126 | Ga0157375_117431262 | 74 |
| 70 | 3300013308 | Ga0157375_12373302 | Ga0157375_123733022 | 74 |
| 71 | 3300013308 | Ga0157375_12403266 | Ga0157375_124032662 | 74 |
| 72 | 3300013308 | Ga0157375_12680351 | Ga0157375_126803512 | 74 |
| 73 | 3300014325 | Ga0163163_10140332 | Ga0163163_101403323 | 74 |
| 74 | 3300014325 | Ga0163163_10329443 | Ga0163163_103294433 | 74 |
| 75 | 3300014745 | Ga0157377_11071747 | Ga0157377_110717472 | 74 |
| 76 | 3300014968 | Ga0157379_11516810 | Ga0157379_115168102 | 74 |
| 77 | 3300014969 | Ga0157376_10138643 | Ga0157376_101386434 | 74 |
| 78 | 3300025273 | Ga0209673_1035110 | Ga0209673_10351102 | 74 |
| 79 | 3300025303 | Ga0209051_1048851 | Ga0209051_10488512 | 74 |
| 80 | 3300025901 | Ga0207688_10198166 | Ga0207688_101981662 | 74 |
| 81 | 3300025914 | Ga0207671_10031318 | Ga0207671_100313186 | 74 |
| 82 | 3300025914 | Ga0207671_10382691 | Ga0207671_103826912 | 74 |
| 83 | 3300025924 | Ga0207694_10322496 | Ga0207694_103224962 | 74 |
| 84 | 3300025942 | Ga0207689_11405343 | Ga0207689_114053432 | 74 |
| 85 | 3300025949 | Ga0207667_10127086 | Ga0207667_101270863 | 74 |
| 86 | 3300026041 | Ga0207639_11690972 | Ga0207639_116909721 | 74 |
| 87 | 3300026067 | Ga0207678_10890315 | Ga0207678_108903152 | 74 |
| 88 | 3300031548 | Ga0307408_100528655 | Ga0307408_1005286552 | 74 |
| 89 | 3300031852 | Ga0307410_10621846 | Ga0307410_106218462 | 74 |
| 90 | 3300031903 | Ga0307407_10226499 | Ga0307407_102264992 | 74 |
| 91 | 3300031995 | Ga0307409_100300178 | Ga0307409_1003001782 | 74 |
| 92 | 3300032004 | Ga0307414_11980000 | Ga0307414_119800001 | 74 |
| 93 | 3300032126 | Ga0307415_100638483 | Ga0307415_1006384832 | 74 |
| 94 | 3300035092 | Ga0373952_0041191 | Ga0373952_0041191_793_1017 | 74 |
| 95 | 3300035241 | Ga0373961_0103094 | Ga0373961_0103094_621_845 | 74 |
| 96 | 3300035691 | Ga0373931_0068314 | Ga0373931_0068314_733_957 | 74 |
| 97 | 3300041410 | Ga0439461_0007215 | Ga0439461_0007215_1543_1767 | 74 |
| 98 | 3300041411 | Ga0439466_0005285 | Ga0439466_0005285_3081_3305 | 74 |
| 99 | 3300041413 | Ga0439465_0003190 | Ga0439465_0003190_2538_2762 | 74 |
| 100 | 3300041413 | Ga0439465_0055975 | Ga0439465_0055975_552_776 | 74 |
| 101 | 3300041443 | Ga0451789_1297938 | Ga0451789_1297938_240_464 | 74 |
| 102 | 3300041452 | Ga0451793_0577225 | Ga0451793_0577225_276_500 | 74 |
| 103 | 3300041452 | Ga0451793_1717196 | Ga0451793_1717196_186_410 | 74 |
| 104 | 3300041453 | Ga0451797_0981697 | Ga0451797_0981697_86_310 | 74 |
| 105 | 3300041459 | Ga0451800_0729937 | Ga0451800_0729937_27_251 | 74 |
| 106 | 3300041486 | Ga0451807_1614344 | Ga0451807_1614344_63_287 | 74 |
| 107 | 3300041492 | Ga0451835_0309573 | Ga0451835_0309573_128_352 | 74 |
| 108 | 3300042002 | Ga0439442_128287 | Ga0439442_128287_60_284 | 74 |
| 109 | 3300044656 | Ga0466969_0185173 | Ga0466969_0185173_450_674 | 74 |
| 110 | 3300044658 | Ga0466972_0010268 | Ga0466972_0010268_2232_2456 | 74 |
| 111 | 3300044683 | Ga0466965_0006386 | Ga0466965_0006386_867_1091 | 74 |
| 112 | 3300044684 | Ga0466966_0023563 | Ga0466966_0023563_3323_3547 | 74 |
| 113 | 3300044693 | Ga0466961_0006454 | Ga0466961_0006454_5619_5843 | 74 |
| 114 | 3300044706 | Ga0466964_0076373 | Ga0466964_0076373_739_963 | 74 |
| 115 | 3300044719 | Ga0466971_0030262 | Ga0466971_0030262_1737_1961 | 74 |
| 116 | 3300044735 | Ga0466968_0009863 | Ga0466968_0009863_1962_2186 | 74 |
| 117 | 3300044765 | Ga0466970_0007492 | Ga0466970_0007492_111_335 | 74 |
| 118 | 3300044842 | Ga0466957_0049294 | Ga0466957_0049294_1832_2056 | 74 |
| 119 | 3300045049 | Ga0466959_0050117 | Ga0466959_0050117_450_674 | 74 |
| 120 | 3300045836 | Ga0466958_0006130 | Ga0466958_0006130_2057_2281 | 74 |
| 121 | 3300045976 | Ga0466967_1544000 | Ga0466967_1544000_328_552 | 74 |
| 122 | 3300046506 | Ga0495583_0095284 | Ga0495583_0095284_57_281 | 74 |
| 123 | 3300046524 | Ga0495648_0006425 | Ga0495648_0006425_9168_9392 | 74 |
| 124 | 3300046528 | Ga0495642_0168809 | Ga0495642_0168809_684_908 | 74 |
| 125 | 3300046533 | Ga0495640_0904555 | Ga0495640_0904555_30_254 | 74 |
| 126 | 3300046616 | Ga0495668_0017692 | Ga0495668_0017692_1918_2142 | 74 |
| 127 | 3300046616 | Ga0495668_0366791 | Ga0495668_0366791_249_473 | 74 |
| 128 | 3300046663 | Ga0495635_0368996 | Ga0495635_0368996_523_747 | 74 |
| 129 | 3300047320 | Ga0495672_0000925 | Ga0495672_0000925_1474_1698 | 74 |
| 130 | 3300047469 | Ga0495673_0000415 | Ga0495673_0000415_13458_13682 | 74 |
| 131 | 3300048903 | Ga0496100_0001021 | Ga0496100_0001021_7875_8099 | 74 |
| 132 | 3300048903 | Ga0496100_0192154 | Ga0496100_0192154_253_477 | 74 |
| 133 | 3300048903 | Ga0496100_1412612 | Ga0496100_1412612_55_279 | 74 |
| 134 | 3300048904 | Ga0496101_0000011 | Ga0496101_0000011_259377_259601 | 74 |
| 135 | 3300048904 | Ga0496101_0071482 | Ga0496101_0071482_1318_1542 | 74 |
| 136 | 3300048904 | Ga0496101_0291028 | Ga0496101_0291028_14_238 | 74 |
| 137 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_43759_43983 | 74 |
| 138 | 3300048905 | Ga0496102_0000249 | Ga0496102_0000249_22846_23070 | 74 |
| 139 | 3300048905 | Ga0496102_0179542 | Ga0496102_0179542_679_903 | 74 |
| 140 | 3300048905 | Ga0496102_0646540 | Ga0496102_0646540_415_639 | 74 |
| 141 | 3300048905 | Ga0496102_0907989 | Ga0496102_0907989_543_767 | 74 |
| 142 | 3300048905 | Ga0496102_0946435 | Ga0496102_0946435_197_421 | 74 |
| 143 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_271480_271704 | 74 |
| 144 | 3300048906 | Ga0496103_0001363 | Ga0496103_0001363_9561_9785 | 74 |
| 145 | 3300048906 | Ga0496103_0056628 | Ga0496103_0056628_283_507 | 74 |
| 146 | 3300048906 | Ga0496103_0457527 | Ga0496103_0457527_214_438 | 74 |
| 147 | 3300048906 | Ga0496103_0902954 | Ga0496103_0902954_115_339 | 74 |
| 148 | 3300048908 | Ga0496105_0095795 | Ga0496105_0095795_261_485 | 74 |
| 149 | 3300048909 | Ga0496106_0166453 | Ga0496106_0166453_1506_1730 | 74 |
| 150 | 3300048909 | Ga0496106_0167231 | Ga0496106_0167231_277_501 | 74 |
| 151 | 3300048910 | Ga0496107_0062985 | Ga0496107_0062985_1152_1376 | 74 |
| 152 | 3300048910 | Ga0496107_0535528 | Ga0496107_0535528_389_613 | 74 |
| 153 | 3300048910 | Ga0496107_1265927 | Ga0496107_1265927_256_480 | 74 |
| 154 | 3300048911 | Ga0496108_0000197 | Ga0496108_0000197_43351_43575 | 74 |
| 155 | 3300048911 | Ga0496108_0007333 | Ga0496108_0007333_5770_5994 | 74 |
| 156 | 3300048912 | Ga0496109_0010390 | Ga0496109_0010390_333_557 | 74 |
| 157 | 3300048912 | Ga0496109_0219624 | Ga0496109_0219624_1079_1303 | 74 |
| 158 | 3300048913 | Ga0496110_0074128 | Ga0496110_0074128_170_394 | 74 |
| 159 | 3300048914 | Ga0496111_1338731 | Ga0496111_1338731_217_441 | 74 |
| 160 | 3300048915 | Ga0496112_0010567 | Ga0496112_0010567_2495_2719 | 74 |
| 161 | 3300048915 | Ga0496112_0162551 | Ga0496112_0162551_1822_2046 | 74 |
| 162 | 3300048916 | Ga0496113_0024769 | Ga0496113_0024769_2989_3213 | 74 |
| 163 | 3300048916 | Ga0496113_0035734 | Ga0496113_0035734_1440_1664 | 74 |
| 164 | 3300048917 | Ga0496114_0135050 | Ga0496114_0135050_596_820 | 74 |
| 165 | 3300048917 | Ga0496114_0258801 | Ga0496114_0258801_965_1189 | 74 |
| 166 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_39980_40204 | 74 |
| 167 | 3300048919 | Ga0496116_0009418 | Ga0496116_0009418_6147_6371 | 74 |
| 168 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_271488_271712 | 74 |
| 169 | 3300048920 | Ga0496117_0001361 | Ga0496117_0001361_25618_25842 | 74 |
| 170 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_271488_271712 | 74 |
| 171 | 3300048921 | Ga0496118_0000927 | Ga0496118_0000927_6437_6661 | 74 |
| 172 | 3300048922 | Ga0496119_0000755 | Ga0496119_0000755_39261_39485 | 74 |
| 173 | 3300048922 | Ga0496119_0007047 | Ga0496119_0007047_8577_8801 | 74 |
| 174 | 3300048923 | Ga0496120_0000449 | Ga0496120_0000449_25806_26030 | 74 |
| 175 | 3300048923 | Ga0496120_0075396 | Ga0496120_0075396_1188_1412 | 74 |
| 176 | 3300048924 | Ga0496121_0000039 | Ga0496121_0000039_297378_297602 | 74 |
| 177 | 3300048924 | Ga0496121_0002149 | Ga0496121_0002149_20957_21181 | 74 |
| 178 | 3300048927 | Ga0496124_0054793 | Ga0496124_0054793_2874_3098 | 74 |
| 179 | 3300048927 | Ga0496124_0968036 | Ga0496124_0968036_30_254 | 74 |
| 180 | 3300048928 | Ga0496125_0040332 | Ga0496125_0040332_3184_3408 | 74 |
| 181 | 3300048929 | Ga0496126_0009543 | Ga0496126_0009543_4907_5131 | 74 |
| 182 | 3300048929 | Ga0496126_0052637 | Ga0496126_0052637_494_718 | 74 |
| 183 | 3300050489 | nmdc:mga03683_313190_c1 | nmdc:mga03683_313190_c1_161_385 | 74 |
| 184 | 3300050489 | nmdc:mga03683_83802_c1 | nmdc:mga03683_83802_c1_532_756 | 74 |
| 185 | 3300050490 | nmdc:mga03n38_18508_c1 | nmdc:mga03n38_18508_c1_2273_2497 | 74 |
| 186 | 3300050490 | nmdc:mga03n38_21851_c1 | nmdc:mga03n38_21851_c1_1585_1809 | 74 |
| 187 | 3300050490 | nmdc:mga03n38_243415_c1 | nmdc:mga03n38_243415_c1_383_607 | 74 |
| 188 | 3300050490 | nmdc:mga03n38_86221_c1 | nmdc:mga03n38_86221_c1_410_634 | 74 |
| 189 | 3300050491 | nmdc:mga00v17_220525_c1 | nmdc:mga00v17_220525_c1_390_614 | 74 |
| 190 | 3300050491 | nmdc:mga00v17_2935_c1 | nmdc:mga00v17_2935_c1_653_877 | 74 |
| 191 | 3300050491 | nmdc:mga00v17_451593_c1 | nmdc:mga00v17_451593_c1_403_627 | 74 |
| 192 | 3300050491 | nmdc:mga00v17_7006_c1 | nmdc:mga00v17_7006_c1_4392_4616 | 74 |
| 193 | 3300050492 | nmdc:mga0yw44_296286_c1 | nmdc:mga0yw44_296286_c1_255_479 | 74 |
| 194 | 3300050492 | nmdc:mga0yw44_5046_c2 | nmdc:mga0yw44_5046_c2_2225_2449 | 74 |
| 195 | 3300050492 | nmdc:mga0yw44_55405_c1 | nmdc:mga0yw44_55405_c1_657_881 | 74 |
| 196 | 3300050494 | nmdc:mga06z11_56892_c1 | nmdc:mga06z11_56892_c1_168_392 | 74 |
| 197 | 3300050495 | nmdc:mga04h51_105346_c1 | nmdc:mga04h51_105346_c1_745_969 | 74 |
| 198 | 3300050496 | nmdc:mga07m45_343383_c1 | nmdc:mga07m45_343383_c1_468_692 | 74 |
| 199 | 3300050496 | nmdc:mga07m45_365975_c1 | nmdc:mga07m45_365975_c1_333_557 | 74 |
| 200 | 3300050513 | nmdc:mga0rr50_1629683_c1 | nmdc:mga0rr50_1629683_c1_58_282 | 74 |
| 201 | 3300050516 | nmdc:mga0sz30_12709_c1 | nmdc:mga0sz30_12709_c1_728_952 | 74 |
| 202 | 3300050516 | nmdc:mga0sz30_18015_c1 | nmdc:mga0sz30_18015_c1_1589_1813 | 74 |
| 203 | 3300050516 | nmdc:mga0sz30_24933_c1 | nmdc:mga0sz30_24933_c1_1656_1880 | 74 |
| 204 | 3300050516 | nmdc:mga0sz30_57596_c1 | nmdc:mga0sz30_57596_c1_143_367 | 74 |
| 205 | 3300050516 | nmdc:mga0sz30_64448_c1 | nmdc:mga0sz30_64448_c1_1149_1373 | 74 |
| 206 | 3300053079 | Ga0500610_0003254 | Ga0500610_0003254_3249_3473 | 74 |
| 207 | 3300053080 | Ga0500635_0042756 | Ga0500635_0042756_472_696 | 74 |
| 208 | 3300053083 | Ga0495655_0171204 | Ga0495655_0171204_360_584 | 74 |
| 209 | 3300053087 | Ga0500643_033189 | Ga0500643_033189_786_1010 | 74 |
| 210 | 3300053098 | Ga0500650_0189011 | Ga0500650_0189011_486_710 | 74 |
| 211 | 3300053119 | Ga0500595_070257 | Ga0500595_070257_423_647 | 74 |
| 212 | 3300053122 | Ga0500608_123746 | Ga0500608_123746_584_808 | 74 |
| 213 | 3300053131 | Ga0500652_000825 | Ga0500652_000825_7478_7702 | 74 |
| 214 | 3300053136 | Ga0500559_0062490 | Ga0500559_0062490_1127_1351 | 74 |
| 215 | 3300053153 | Ga0500616_0007498 | Ga0500616_0007498_4497_4721 | 74 |
| 216 | 3300053730 | Ga0500645_003171 | Ga0500645_003171_2523_2747 | 74 |
| 217 | 3300061719 | Ga0466962_0004026 | Ga0466962_0004026_1482_1706 | 74 |
| 218 | 3300005981 | Ga0081538_10238976 | Ga0081538_102389762 | 75 |
| 219 | 3300031733 | Ga0316577_10316910 | Ga0316577_103169101 | 75 |
| 220 | 3300031995 | Ga0307409_101419491 | Ga0307409_1014194912 | 75 |
| 221 | 3300033179 | Ga0307507_10114224 | Ga0307507_101142242 | 75 |
| 222 | 3300036712 | Ga0316584_0186137 | Ga0316584_0186137_547_783 | 75 |
| 223 | iso_pu_bacteria | 2643221715 | 2644634181 | 75 |
| 224 | iso_pu_bacteria | 2902810491 | 2902810547 | 75 |
| 225 | 3300002070 | JGI24750J21931_1023575 | JGI24750J21931_10235752 | 77 |
| 226 | 3300002239 | JGI24034J26672_10004458 | JGI24034J26672_100044583 | 77 |
| 227 | 3300005347 | Ga0070668_100061829 | Ga0070668_1000618293 | 77 |
| 228 | 3300005347 | Ga0070668_101996864 | Ga0070668_1019968642 | 77 |
| 229 | 3300005355 | Ga0070671_100124174 | Ga0070671_1001241743 | 77 |
| 230 | 3300005367 | Ga0070667_100024671 | Ga0070667_1000246714 | 77 |
| 231 | 3300005467 | Ga0070706_100015125 | Ga0070706_1000151257 | 77 |
| 232 | 3300005468 | Ga0070707_100120284 | Ga0070707_1001202844 | 77 |
| 233 | 3300005471 | Ga0070698_100172088 | Ga0070698_1001720884 | 77 |
| 234 | 3300005518 | Ga0070699_100007861 | Ga0070699_1000078614 | 77 |
| 235 | 3300005536 | Ga0070697_100079472 | Ga0070697_1000794724 | 77 |
| 236 | 3300005544 | Ga0070686_100671204 | Ga0070686_1006712041 | 77 |
| 237 | 3300005617 | Ga0068859_101655862 | Ga0068859_1016558621 | 77 |
| 238 | 3300005719 | Ga0068861_100126170 | Ga0068861_1001261704 | 77 |
| 239 | 3300005841 | Ga0068863_100599913 | Ga0068863_1005999131 | 77 |
| 240 | 3300005843 | Ga0068860_100385733 | Ga0068860_1003857332 | 77 |
| 241 | 3300005844 | Ga0068862_101029497 | Ga0068862_1010294972 | 77 |
| 242 | 3300005937 | Ga0081455_10023525 | Ga0081455_100235253 | 77 |
| 243 | 3300006028 | Ga0070717_10009317 | Ga0070717_100093177 | 77 |
| 244 | 3300006186 | Ga0075369_10341736 | Ga0075369_103417361 | 77 |
| 245 | 3300006931 | Ga0097620_101656152 | Ga0097620_1016561521 | 77 |
| 246 | 3300009092 | Ga0105250_10019823 | Ga0105250_100198235 | 77 |
| 247 | 3300009553 | Ga0105249_10036484 | Ga0105249_100364848 | 77 |
| 248 | 3300025711 | Ga0207696_1108187 | Ga0207696_11081872 | 77 |
| 249 | 3300025901 | Ga0207688_10598276 | Ga0207688_105982762 | 77 |
| 250 | 3300025910 | Ga0207684_10086662 | Ga0207684_100866622 | 77 |
| 251 | 3300025922 | Ga0207646_10126872 | Ga0207646_101268721 | 77 |
| 252 | 3300025931 | Ga0207644_10176865 | Ga0207644_101768652 | 77 |
| 253 | 3300025961 | Ga0207712_10570986 | Ga0207712_105709862 | 77 |
| 254 | 3300026088 | Ga0207641_10043028 | Ga0207641_100430285 | 77 |
| 255 | 3300026118 | Ga0207675_100145242 | Ga0207675_1001452422 | 77 |
| 256 | 3300028380 | Ga0268265_10289879 | Ga0268265_102898793 | 77 |
| 257 | 3300031824 | Ga0307413_10203923 | Ga0307413_102039233 | 77 |
| 258 | 3300031852 | Ga0307410_10101672 | Ga0307410_101016722 | 77 |
| 259 | 3300031852 | Ga0307410_10320166 | Ga0307410_103201663 | 77 |
| 260 | 3300031889 | Ga0326468_10036814 | Ga0326468_100368143 | 77 |
| 261 | 3300031903 | Ga0307407_10015163 | Ga0307407_100151632 | 77 |
| 262 | 3300031903 | Ga0307407_11547461 | Ga0307407_115474611 | 77 |
| 263 | 3300031911 | Ga0307412_10683970 | Ga0307412_106839702 | 77 |
| 264 | 3300031995 | Ga0307409_100176711 | Ga0307409_1001767111 | 77 |
| 265 | 3300032002 | Ga0307416_100383010 | Ga0307416_1003830103 | 77 |
| 266 | 3300032126 | Ga0307415_100179571 | Ga0307415_1001795712 | 77 |
| 267 | 3300041410 | Ga0439461_0050607 | Ga0439461_0050607_149_388 | 77 |
| 268 | 3300041411 | Ga0439466_0064683 | Ga0439466_0064683_528_767 | 77 |
| 269 | 3300041413 | Ga0439465_0015134 | Ga0439465_0015134_1904_2143 | 77 |
| 270 | 3300041997 | Ga0439431_0073619 | Ga0439431_0073619_415_654 | 77 |
| 271 | 3300042004 | Ga0439445_0073051 | Ga0439445_0073051_55_294 | 77 |
| 272 | 3300048906 | Ga0496103_0641771 | Ga0496103_0641771_364_603 | 77 |
| 273 | 3300048911 | Ga0496108_0045722 | Ga0496108_0045722_1735_1974 | 77 |
| 274 | 3300048912 | Ga0496109_0090488 | Ga0496109_0090488_94_333 | 77 |
| 275 | 3300048914 | Ga0496111_0468911 | Ga0496111_0468911_137_376 | 77 |
| 276 | 3300048915 | Ga0496112_0015977 | Ga0496112_0015977_461_700 | 77 |
| 277 | 3300048916 | Ga0496113_0120716 | Ga0496113_0120716_724_963 | 77 |
| 278 | 3300002067 | JGI24735J21928_10172605 | JGI24735J21928_101726052 | 78 |
| 279 | 3300002239 | JGI24034J26672_10114638 | JGI24034J26672_101146381 | 78 |
| 280 | 3300002244 | JGI24742J22300_10068884 | JGI24742J22300_100688841 | 78 |
| 281 | 3300005289 | Ga0065704_10414286 | Ga0065704_104142861 | 78 |
| 282 | 3300005330 | Ga0070690_100487282 | Ga0070690_1004872822 | 78 |
| 283 | 3300005331 | Ga0070670_100048485 | Ga0070670_1000484854 | 78 |
| 284 | 3300005334 | Ga0068869_100181551 | Ga0068869_1001815513 | 78 |
| 285 | 3300005335 | Ga0070666_10697788 | Ga0070666_106977882 | 78 |
| 286 | 3300005337 | Ga0070682_100003990 | Ga0070682_1000039909 | 78 |
| 287 | 3300005337 | Ga0070682_101528546 | Ga0070682_1015285461 | 78 |
| 288 | 3300005338 | Ga0068868_100298665 | Ga0068868_1002986653 | 78 |
| 289 | 3300005340 | Ga0070689_100292911 | Ga0070689_1002929113 | 78 |
| 290 | 3300005341 | Ga0070691_10163501 | Ga0070691_101635012 | 78 |
| 291 | 3300005344 | Ga0070661_101140799 | Ga0070661_1011407992 | 78 |
| 292 | 3300005345 | Ga0070692_10554904 | Ga0070692_105549042 | 78 |
| 293 | 3300005347 | Ga0070668_100011959 | Ga0070668_1000119593 | 78 |
| 294 | 3300005353 | Ga0070669_100000585 | Ga0070669_10000058516 | 78 |
| 295 | 3300005355 | Ga0070671_100004637 | Ga0070671_10000463713 | 78 |
| 296 | 3300005355 | Ga0070671_100341920 | Ga0070671_1003419203 | 78 |
| 297 | 3300005355 | Ga0070671_100637582 | Ga0070671_1006375822 | 78 |
| 298 | 3300005356 | Ga0070674_100045623 | Ga0070674_1000456235 | 78 |
| 299 | 3300005356 | Ga0070674_101424652 | Ga0070674_1014246521 | 78 |
| 300 | 3300005365 | Ga0070688_100507032 | Ga0070688_1005070322 | 78 |
| 301 | 3300005366 | Ga0070659_100325107 | Ga0070659_1003251072 | 78 |
| 302 | 3300005367 | Ga0070667_100000033 | Ga0070667_10000003344 | 78 |
| 303 | 3300005367 | Ga0070667_100195203 | Ga0070667_1001952033 | 78 |
| 304 | 3300005367 | Ga0070667_100223944 | Ga0070667_1002239443 | 78 |
| 305 | 3300005437 | Ga0070710_10180346 | Ga0070710_101803463 | 78 |
| 306 | 3300005438 | Ga0070701_10369253 | Ga0070701_103692532 | 78 |
| 307 | 3300005439 | Ga0070711_100508055 | Ga0070711_1005080551 | 78 |
| 308 | 3300005440 | Ga0070705_100140614 | Ga0070705_1001406142 | 78 |
| 309 | 3300005441 | Ga0070700_101527401 | Ga0070700_1015274012 | 78 |
| 310 | 3300005444 | Ga0070694_100374454 | Ga0070694_1003744542 | 78 |
| 311 | 3300005445 | Ga0070708_100022132 | Ga0070708_1000221326 | 78 |
| 312 | 3300005456 | Ga0070678_100043294 | Ga0070678_1000432942 | 78 |
| 313 | 3300005467 | Ga0070706_100073183 | Ga0070706_1000731834 | 78 |
| 314 | 3300005468 | Ga0070707_100007233 | Ga0070707_1000072336 | 78 |
| 315 | 3300005471 | Ga0070698_100048472 | Ga0070698_1000484727 | 78 |
| 316 | 3300005518 | Ga0070699_100069585 | Ga0070699_1000695854 | 78 |
| 317 | 3300005535 | Ga0070684_100527954 | Ga0070684_1005279542 | 78 |
| 318 | 3300005539 | Ga0068853_100056314 | Ga0068853_1000563146 | 78 |
| 319 | 3300005544 | Ga0070686_101549076 | Ga0070686_1015490761 | 78 |
| 320 | 3300005545 | Ga0070695_100158148 | Ga0070695_1001581483 | 78 |
| 321 | 3300005546 | Ga0070696_100167006 | Ga0070696_1001670062 | 78 |
| 322 | 3300005547 | Ga0070693_100083170 | Ga0070693_1000831703 | 78 |
| 323 | 3300005548 | Ga0070665_100003448 | Ga0070665_10000344812 | 78 |
| 324 | 3300005548 | Ga0070665_100012289 | Ga0070665_1000122896 | 78 |
| 325 | 3300005548 | Ga0070665_100739826 | Ga0070665_1007398262 | 78 |
| 326 | 3300005548 | Ga0070665_101537949 | Ga0070665_1015379491 | 78 |
| 327 | 3300005549 | Ga0070704_100296291 | Ga0070704_1002962913 | 78 |
| 328 | 3300005578 | Ga0068854_100061794 | Ga0068854_1000617943 | 78 |
| 329 | 3300005578 | Ga0068854_100127770 | Ga0068854_1001277703 | 78 |
| 330 | 3300005614 | Ga0068856_100119856 | Ga0068856_1001198562 | 78 |
| 331 | 3300005615 | Ga0070702_100214242 | Ga0070702_1002142423 | 78 |
| 332 | 3300005615 | Ga0070702_100465749 | Ga0070702_1004657492 | 78 |
| 333 | 3300005616 | Ga0068852_100288167 | Ga0068852_1002881672 | 78 |
| 334 | 3300005616 | Ga0068852_101140323 | Ga0068852_1011403232 | 78 |
| 335 | 3300005617 | Ga0068859_100004951 | Ga0068859_10000495114 | 78 |
| 336 | 3300005617 | Ga0068859_100391310 | Ga0068859_1003913102 | 78 |
| 337 | 3300005617 | Ga0068859_100669230 | Ga0068859_1006692303 | 78 |
| 338 | 3300005618 | Ga0068864_102243308 | Ga0068864_1022433082 | 78 |
| 339 | 3300005618 | Ga0068864_102375773 | Ga0068864_1023757731 | 78 |
| 340 | 3300005718 | Ga0068866_10040171 | Ga0068866_100401713 | 78 |
| 341 | 3300005719 | Ga0068861_100142389 | Ga0068861_1001423893 | 78 |
| 342 | 3300005719 | Ga0068861_100988208 | Ga0068861_1009882082 | 78 |
| 343 | 3300005834 | Ga0068851_10688267 | Ga0068851_106882671 | 78 |
| 344 | 3300005840 | Ga0068870_10225571 | Ga0068870_102255712 | 78 |
| 345 | 3300005841 | Ga0068863_100000193 | Ga0068863_1000001937 | 78 |
| 346 | 3300005841 | Ga0068863_100016574 | Ga0068863_1000165747 | 78 |
| 347 | 3300005842 | Ga0068858_100052259 | Ga0068858_1000522591 | 78 |
| 348 | 3300005842 | Ga0068858_100176765 | Ga0068858_1001767653 | 78 |
| 349 | 3300005842 | Ga0068858_101984617 | Ga0068858_1019846171 | 78 |
| 350 | 3300005843 | Ga0068860_100000010 | Ga0068860_10000001046 | 78 |
| 351 | 3300005843 | Ga0068860_100107051 | Ga0068860_1001070513 | 78 |
| 352 | 3300005843 | Ga0068860_102115588 | Ga0068860_1021155881 | 78 |
| 353 | 3300005844 | Ga0068862_100000008 | Ga0068862_100000008281 | 78 |
| 354 | 3300005844 | Ga0068862_100690104 | Ga0068862_1006901042 | 78 |
| 355 | 3300005844 | Ga0068862_100778855 | Ga0068862_1007788552 | 78 |
| 356 | 3300005937 | Ga0081455_10484431 | Ga0081455_104844312 | 78 |
| 357 | 3300005983 | Ga0081540_1124881 | Ga0081540_11248813 | 78 |
| 358 | 3300006028 | Ga0070717_11403824 | Ga0070717_114038242 | 78 |
| 359 | 3300006038 | Ga0075365_10074261 | Ga0075365_100742614 | 78 |
| 360 | 3300006038 | Ga0075365_11064074 | Ga0075365_110640742 | 78 |
| 361 | 3300006042 | Ga0075368_10132777 | Ga0075368_101327771 | 78 |
| 362 | 3300006042 | Ga0075368_10344571 | Ga0075368_103445712 | 78 |
| 363 | 3300006048 | Ga0075363_100006581 | Ga0075363_1000065812 | 78 |
| 364 | 3300006048 | Ga0075363_100014648 | Ga0075363_1000146483 | 78 |
| 365 | 3300006048 | Ga0075363_100068718 | Ga0075363_1000687184 | 78 |
| 366 | 3300006048 | Ga0075363_100078566 | Ga0075363_1000785663 | 78 |
| 367 | 3300006048 | Ga0075363_100288161 | Ga0075363_1002881612 | 78 |
| 368 | 3300006048 | Ga0075363_100363649 | Ga0075363_1003636492 | 78 |
| 369 | 3300006048 | Ga0075363_100368669 | Ga0075363_1003686692 | 78 |
| 370 | 3300006048 | Ga0075363_100400865 | Ga0075363_1004008652 | 78 |
| 371 | 3300006048 | Ga0075363_100663958 | Ga0075363_1006639581 | 78 |
| 372 | 3300006051 | Ga0075364_10026274 | Ga0075364_100262742 | 78 |
| 373 | 3300006051 | Ga0075364_10044848 | Ga0075364_100448482 | 78 |
| 374 | 3300006051 | Ga0075364_10124844 | Ga0075364_101248442 | 78 |
| 375 | 3300006051 | Ga0075364_10351207 | Ga0075364_103512072 | 78 |
| 376 | 3300006051 | Ga0075364_10437256 | Ga0075364_104372562 | 78 |
| 377 | 3300006051 | Ga0075364_10527113 | Ga0075364_105271132 | 78 |
| 378 | 3300006051 | Ga0075364_10877813 | Ga0075364_108778132 | 78 |
| 379 | 3300006051 | Ga0075364_11150758 | Ga0075364_111507581 | 78 |
| 380 | 3300006051 | Ga0075364_11260911 | Ga0075364_112609112 | 78 |
| 381 | 3300006177 | Ga0075362_10073804 | Ga0075362_100738044 | 78 |
| 382 | 3300006177 | Ga0075362_10174138 | Ga0075362_101741381 | 78 |
| 383 | 3300006177 | Ga0075362_10291445 | Ga0075362_102914451 | 78 |
| 384 | 3300006178 | Ga0075367_10058413 | Ga0075367_100584132 | 78 |
| 385 | 3300006178 | Ga0075367_10735649 | Ga0075367_107356492 | 78 |
| 386 | 3300006178 | Ga0075367_10945551 | Ga0075367_109455511 | 78 |
| 387 | 3300006186 | Ga0075369_10001584 | Ga0075369_100015847 | 78 |
| 388 | 3300006186 | Ga0075369_10010179 | Ga0075369_100101793 | 78 |
| 389 | 3300006186 | Ga0075369_10092227 | Ga0075369_100922273 | 78 |
| 390 | 3300006186 | Ga0075369_10436482 | Ga0075369_104364822 | 78 |
| 391 | 3300006186 | Ga0075369_10490366 | Ga0075369_104903662 | 78 |
| 392 | 3300006186 | Ga0075369_10541941 | Ga0075369_105419411 | 78 |
| 393 | 3300006237 | Ga0097621_101250835 | Ga0097621_1012508351 | 78 |
| 394 | 3300006353 | Ga0075370_10045478 | Ga0075370_100454782 | 78 |
| 395 | 3300006353 | Ga0075370_10066312 | Ga0075370_100663122 | 78 |
| 396 | 3300006353 | Ga0075370_10492331 | Ga0075370_104923311 | 78 |
| 397 | 3300006353 | Ga0075370_10534360 | Ga0075370_105343602 | 78 |
| 398 | 3300006844 | Ga0075428_100004424 | Ga0075428_1000044245 | 78 |
| 399 | 3300006846 | Ga0075430_100053158 | Ga0075430_1000531584 | 78 |
| 400 | 3300006847 | Ga0075431_100248587 | Ga0075431_1002485872 | 78 |
| 401 | 3300006881 | Ga0068865_100116864 | Ga0068865_1001168643 | 78 |
| 402 | 3300006881 | Ga0068865_100393735 | Ga0068865_1003937351 | 78 |
| 403 | 3300006931 | Ga0097620_100004951 | Ga0097620_10000495114 | 78 |
| 404 | 3300006931 | Ga0097620_100391346 | Ga0097620_1003913462 | 78 |
| 405 | 3300006931 | Ga0097620_100669229 | Ga0097620_1006692293 | 78 |
| 406 | 3300007076 | Ga0075435_101855191 | Ga0075435_1018551912 | 78 |
| 407 | 3300009098 | Ga0105245_10084905 | Ga0105245_100849054 | 78 |
| 408 | 3300009101 | Ga0105247_10000082 | Ga0105247_1000008270 | 78 |
| 409 | 3300009101 | Ga0105247_10041169 | Ga0105247_100411694 | 78 |
| 410 | 3300009101 | Ga0105247_10559342 | Ga0105247_105593422 | 78 |
| 411 | 3300009147 | Ga0114129_10826262 | Ga0114129_108262622 | 78 |
| 412 | 3300009147 | Ga0114129_12841318 | Ga0114129_128413182 | 78 |
| 413 | 3300009148 | Ga0105243_10200174 | Ga0105243_102001742 | 78 |
| 414 | 3300009174 | Ga0105241_10259202 | Ga0105241_102592022 | 78 |
| 415 | 3300009177 | Ga0105248_10000084 | Ga0105248_1000008465 | 78 |
| 416 | 3300009177 | Ga0105248_10066413 | Ga0105248_100664136 | 78 |
| 417 | 3300009177 | Ga0105248_11432024 | Ga0105248_114320242 | 78 |
| 418 | 3300009553 | Ga0105249_10000285 | Ga0105249_1000028544 | 78 |
| 419 | 3300009553 | Ga0105249_10306145 | Ga0105249_103061454 | 78 |
| 420 | 3300009553 | Ga0105249_11693652 | Ga0105249_116936522 | 78 |
| 421 | 3300009553 | Ga0105249_13106271 | Ga0105249_131062712 | 78 |
| 422 | 3300010375 | Ga0105239_10583908 | Ga0105239_105839082 | 78 |
| 423 | 3300010375 | Ga0105239_11859294 | Ga0105239_118592942 | 78 |
| 424 | 3300010375 | Ga0105239_11956336 | Ga0105239_119563362 | 78 |
| 425 | 3300011119 | Ga0105246_10851220 | Ga0105246_108512202 | 78 |
| 426 | 3300013104 | Ga0157370_11448349 | Ga0157370_114483491 | 78 |
| 427 | 3300013296 | Ga0157374_10406780 | Ga0157374_104067803 | 78 |
| 428 | 3300013297 | Ga0157378_10155787 | Ga0157378_101557873 | 78 |
| 429 | 3300013306 | Ga0163162_10235777 | Ga0163162_102357773 | 78 |
| 430 | 3300013306 | Ga0163162_10565322 | Ga0163162_105653222 | 78 |
| 431 | 3300013306 | Ga0163162_10806367 | Ga0163162_108063672 | 78 |
| 432 | 3300013306 | Ga0163162_11824357 | Ga0163162_118243572 | 78 |
| 433 | 3300013308 | Ga0157375_10306065 | Ga0157375_103060652 | 78 |
| 434 | 3300013308 | Ga0157375_10362306 | Ga0157375_103623063 | 78 |
| 435 | 3300014325 | Ga0163163_10010591 | Ga0163163_100105914 | 78 |
| 436 | 3300014325 | Ga0163163_10014507 | Ga0163163_100145074 | 78 |
| 437 | 3300014325 | Ga0163163_10552520 | Ga0163163_105525203 | 78 |
| 438 | 3300014325 | Ga0163163_11626437 | Ga0163163_116264372 | 78 |
| 439 | 3300014325 | Ga0163163_11643584 | Ga0163163_116435842 | 78 |
| 440 | 3300014326 | Ga0157380_10107081 | Ga0157380_101070812 | 78 |
| 441 | 3300014968 | Ga0157379_10096326 | Ga0157379_100963264 | 78 |
| 442 | 3300014968 | Ga0157379_10258577 | Ga0157379_102585772 | 78 |
| 443 | 3300014968 | Ga0157379_11448792 | Ga0157379_114487922 | 78 |
| 444 | 3300014969 | Ga0157376_11420197 | Ga0157376_114201972 | 78 |
| 445 | 3300017792 | Ga0163161_10148354 | Ga0163161_101483542 | 78 |
| 446 | 3300017792 | Ga0163161_11602544 | Ga0163161_116025442 | 78 |
| 447 | 3300025303 | Ga0209051_1002514 | Ga0209051_100251410 | 78 |
| 448 | 3300025321 | Ga0207656_10460559 | Ga0207656_104605591 | 78 |
| 449 | 3300025899 | Ga0207642_10013951 | Ga0207642_100139513 | 78 |
| 450 | 3300025900 | Ga0207710_10000194 | Ga0207710_1000019439 | 78 |
| 451 | 3300025900 | Ga0207710_10087829 | Ga0207710_100878292 | 78 |
| 452 | 3300025901 | Ga0207688_10059175 | Ga0207688_100591753 | 78 |
| 453 | 3300025910 | Ga0207684_10056393 | Ga0207684_100563933 | 78 |
| 454 | 3300025911 | Ga0207654_10069392 | Ga0207654_100693922 | 78 |
| 455 | 3300025916 | Ga0207663_10274137 | Ga0207663_102741374 | 78 |
| 456 | 3300025919 | Ga0207657_11253222 | Ga0207657_112532222 | 78 |
| 457 | 3300025920 | Ga0207649_10952347 | Ga0207649_109523472 | 78 |
| 458 | 3300025922 | Ga0207646_10028552 | Ga0207646_100285521 | 78 |
| 459 | 3300025923 | Ga0207681_10030439 | Ga0207681_100304395 | 78 |
| 460 | 3300025924 | Ga0207694_11447941 | Ga0207694_114479412 | 78 |
| 461 | 3300025925 | Ga0207650_10445116 | Ga0207650_104451163 | 78 |
| 462 | 3300025927 | Ga0207687_10017616 | Ga0207687_1001761610 | 78 |
| 463 | 3300025932 | Ga0207690_10380341 | Ga0207690_103803412 | 78 |
| 464 | 3300025936 | Ga0207670_10238714 | Ga0207670_102387144 | 78 |
| 465 | 3300025937 | Ga0207669_10002980 | Ga0207669_1000298010 | 78 |
| 466 | 3300025937 | Ga0207669_11645605 | Ga0207669_116456052 | 78 |
| 467 | 3300025938 | Ga0207704_10160315 | Ga0207704_101603152 | 78 |
| 468 | 3300025941 | Ga0207711_10000690 | Ga0207711_1000069014 | 78 |
| 469 | 3300025941 | Ga0207711_10268028 | Ga0207711_102680282 | 78 |
| 470 | 3300025942 | Ga0207689_10618224 | Ga0207689_106182242 | 78 |
| 471 | 3300025945 | Ga0207679_10282952 | Ga0207679_102829521 | 78 |
| 472 | 3300025961 | Ga0207712_10000011 | Ga0207712_10000011361 | 78 |
| 473 | 3300025972 | Ga0207668_10002560 | Ga0207668_100025607 | 78 |
| 474 | 3300025972 | Ga0207668_10096909 | Ga0207668_100969094 | 78 |
| 475 | 3300025972 | Ga0207668_12016793 | Ga0207668_120167932 | 78 |
| 476 | 3300025981 | Ga0207640_10139840 | Ga0207640_101398403 | 78 |
| 477 | 3300025981 | Ga0207640_10331438 | Ga0207640_103314383 | 78 |
| 478 | 3300025986 | Ga0207658_10000220 | Ga0207658_1000022032 | 78 |
| 479 | 3300025986 | Ga0207658_10004124 | Ga0207658_1000412413 | 78 |
| 480 | 3300025986 | Ga0207658_10247762 | Ga0207658_102477622 | 78 |
| 481 | 3300026023 | Ga0207677_10142531 | Ga0207677_101425313 | 78 |
| 482 | 3300026035 | Ga0207703_10019991 | Ga0207703_100199913 | 78 |
| 483 | 3300026035 | Ga0207703_10183614 | Ga0207703_101836141 | 78 |
| 484 | 3300026035 | Ga0207703_10692207 | Ga0207703_106922072 | 78 |
| 485 | 3300026041 | Ga0207639_10073551 | Ga0207639_100735515 | 78 |
| 486 | 3300026041 | Ga0207639_10881612 | Ga0207639_108816122 | 78 |
| 487 | 3300026067 | Ga0207678_10053474 | Ga0207678_100534744 | 78 |
| 488 | 3300026067 | Ga0207678_10303566 | Ga0207678_103035663 | 78 |
| 489 | 3300026088 | Ga0207641_10001710 | Ga0207641_100017109 | 78 |
| 490 | 3300026088 | Ga0207641_10012303 | Ga0207641_100123036 | 78 |
| 491 | 3300026088 | Ga0207641_10960899 | Ga0207641_109608992 | 78 |
| 492 | 3300026095 | Ga0207676_11347891 | Ga0207676_113478911 | 78 |
| 493 | 3300026095 | Ga0207676_12099632 | Ga0207676_120996322 | 78 |
| 494 | 3300026118 | Ga0207675_100177028 | Ga0207675_1001770284 | 78 |
| 495 | 3300026121 | Ga0207683_10159484 | Ga0207683_101594844 | 78 |
| 496 | 3300026142 | Ga0207698_10272784 | Ga0207698_102727842 | 78 |
| 497 | 3300027866 | Ga0209813_10330654 | Ga0209813_103306541 | 78 |
| 498 | 3300028379 | Ga0268266_10003448 | Ga0268266_100034487 | 78 |
| 499 | 3300028379 | Ga0268266_10038628 | Ga0268266_100386285 | 78 |
| 500 | 3300028379 | Ga0268266_10614673 | Ga0268266_106146732 | 78 |
| 501 | 3300028379 | Ga0268266_11214857 | Ga0268266_112148572 | 78 |
| 502 | 3300028379 | Ga0268266_11617117 | Ga0268266_116171171 | 78 |
| 503 | 3300028380 | Ga0268265_10000007 | Ga0268265_10000007274 | 78 |
| 504 | 3300028380 | Ga0268265_10196731 | Ga0268265_101967313 | 78 |
| 505 | 3300028381 | Ga0268264_10000007 | Ga0268264_10000007405 | 78 |
| 506 | 3300028381 | Ga0268264_10059097 | Ga0268264_100590974 | 78 |
| 507 | 3300031731 | Ga0307405_10783953 | Ga0307405_107839532 | 78 |
| 508 | 3300031901 | Ga0307406_10959286 | Ga0307406_109592862 | 78 |
| 509 | 3300035114 | Ga0373939_0214628 | Ga0373939_0214628_413_673 | 78 |
| 510 | 3300035725 | Ga0373947_0297871 | Ga0373947_0297871_53_313 | 78 |
| 511 | 3300039450 | Ga0436363_1457429 | Ga0436363_1457429_753_992 | 78 |
| 512 | 3300039453 | Ga0436362_0983837 | Ga0436362_0983837_147_386 | 78 |
| 513 | 3300041410 | Ga0439461_0080682 | Ga0439461_0080682_94_336 | 78 |
| 514 | 3300041410 | Ga0439461_0145607 | Ga0439461_0145607_308_550 | 78 |
| 515 | 3300041411 | Ga0439466_0010101 | Ga0439466_0010101_382_624 | 78 |
| 516 | 3300041411 | Ga0439466_0016370 | Ga0439466_0016370_230_472 | 78 |
| 517 | 3300041413 | Ga0439465_0008953 | Ga0439465_0008953_2153_2395 | 78 |
| 518 | 3300041413 | Ga0439465_0012697 | Ga0439465_0012697_2196_2438 | 78 |
| 519 | 3300041413 | Ga0439465_0029435 | Ga0439465_0029435_687_929 | 78 |
| 520 | 3300041512 | Ga0451853_3958433 | Ga0451853_3958433_12_248 | 78 |
| 521 | 3300041997 | Ga0439431_0001993 | Ga0439431_0001993_2814_3056 | 78 |
| 522 | 3300042001 | Ga0439441_138124 | Ga0439441_138124_183_425 | 78 |
| 523 | 3300042002 | Ga0439442_060313 | Ga0439442_060313_22_264 | 78 |
| 524 | 3300042435 | Ga0439434_0004335 | Ga0439434_0004335_3181_3423 | 78 |
| 525 | 3300042435 | Ga0439434_0081528 | Ga0439434_0081528_275_517 | 78 |
| 526 | 3300042438 | Ga0439459_0077582 | Ga0439459_0077582_131_400 | 78 |
| 527 | 3300044901 | Ga0466960_0026185 | Ga0466960_0026185_1110_1352 | 78 |
| 528 | 3300044901 | Ga0466960_0230150 | Ga0466960_0230150_689_931 | 78 |
| 529 | 3300046491 | Ga0495584_0199897 | Ga0495584_0199897_199_465 | 78 |
| 530 | 3300046523 | Ga0495644_0280457 | Ga0495644_0280457_289_555 | 78 |
| 531 | 3300046524 | Ga0495648_0005784 | Ga0495648_0005784_1021_1260 | 78 |
| 532 | 3300046533 | Ga0495640_0634866 | Ga0495640_0634866_80_319 | 78 |
| 533 | 3300046615 | Ga0495656_0234427 | Ga0495656_0234427_591_860 | 78 |
| 534 | 3300046694 | Ga0495649_0158833 | Ga0495649_0158833_616_855 | 78 |
| 535 | 3300047320 | Ga0495672_0024321 | Ga0495672_0024321_1639_1878 | 78 |
| 536 | 3300047320 | Ga0495672_0097859 | Ga0495672_0097859_155_397 | 78 |
| 537 | 3300047320 | Ga0495672_0339837 | Ga0495672_0339837_137_376 | 78 |
| 538 | 3300047469 | Ga0495673_0001846 | Ga0495673_0001846_4686_4925 | 78 |
| 539 | 3300048903 | Ga0496100_0207568 | Ga0496100_0207568_861_1100 | 78 |
| 540 | 3300048903 | Ga0496100_1255226 | Ga0496100_1255226_247_507 | 78 |
| 541 | 3300048905 | Ga0496102_0036339 | Ga0496102_0036339_2815_3057 | 78 |
| 542 | 3300048905 | Ga0496102_0153117 | Ga0496102_0153117_926_1168 | 78 |
| 543 | 3300048905 | Ga0496102_0209834 | Ga0496102_0209834_615_854 | 78 |
| 544 | 3300048906 | Ga0496103_0355875 | Ga0496103_0355875_400_642 | 78 |
| 545 | 3300048906 | Ga0496103_0519298 | Ga0496103_0519298_367_609 | 78 |
| 546 | 3300048907 | Ga0496104_0170499 | Ga0496104_0170499_1231_1491 | 78 |
| 547 | 3300048907 | Ga0496104_1133772 | Ga0496104_1133772_120_362 | 78 |
| 548 | 3300048907 | Ga0496104_1495793 | Ga0496104_1495793_302_562 | 78 |
| 549 | 3300048908 | Ga0496105_0052394 | Ga0496105_0052394_2436_2678 | 78 |
| 550 | 3300048909 | Ga0496106_0203933 | Ga0496106_0203933_633_872 | 78 |
| 551 | 3300048910 | Ga0496107_0090819 | Ga0496107_0090819_1505_1744 | 78 |
| 552 | 3300048910 | Ga0496107_0930496 | Ga0496107_0930496_81_341 | 78 |
| 553 | 3300048911 | Ga0496108_0066726 | Ga0496108_0066726_1636_1875 | 78 |
| 554 | 3300048911 | Ga0496108_0247975 | Ga0496108_0247975_255_497 | 78 |
| 555 | 3300048912 | Ga0496109_0058782 | Ga0496109_0058782_976_1236 | 78 |
| 556 | 3300048912 | Ga0496109_0101156 | Ga0496109_0101156_2053_2295 | 78 |
| 557 | 3300048912 | Ga0496109_0434335 | Ga0496109_0434335_598_837 | 78 |
| 558 | 3300048912 | Ga0496109_1723233 | Ga0496109_1723233_57_299 | 78 |
| 559 | 3300048913 | Ga0496110_0059967 | Ga0496110_0059967_742_984 | 78 |
| 560 | 3300048913 | Ga0496110_0205623 | Ga0496110_0205623_1404_1664 | 78 |
| 561 | 3300048913 | Ga0496110_0245260 | Ga0496110_0245260_606_866 | 78 |
| 562 | 3300048914 | Ga0496111_0137824 | Ga0496111_0137824_895_1137 | 78 |
| 563 | 3300048914 | Ga0496111_0176634 | Ga0496111_0176634_440_700 | 78 |
| 564 | 3300048915 | Ga0496112_0057875 | Ga0496112_0057875_479_739 | 78 |
| 565 | 3300048916 | Ga0496113_0906694 | Ga0496113_0906694_145_405 | 78 |
| 566 | 3300048917 | Ga0496114_0320743 | Ga0496114_0320743_737_976 | 78 |
| 567 | 3300048917 | Ga0496114_1218025 | Ga0496114_1218025_116_358 | 78 |
| 568 | 3300048918 | Ga0496115_0538140 | Ga0496115_0538140_304_543 | 78 |
| 569 | 3300048922 | Ga0496119_0192761 | Ga0496119_0192761_798_1040 | 78 |
| 570 | 3300048929 | Ga0496126_0625818 | Ga0496126_0625818_360_602 | 78 |
| 571 | 3300049571 | Ga0501034_0286511 | Ga0501034_0286511_450_689 | 78 |
| 572 | 3300050489 | nmdc:mga03683_236302_c1 | nmdc:mga03683_236302_c1_546_788 | 78 |
| 573 | 3300050490 | nmdc:mga03n38_154777_c1 | nmdc:mga03n38_154777_c1_729_971 | 78 |
| 574 | 3300050490 | nmdc:mga03n38_177985_c1 | nmdc:mga03n38_177985_c1_60_302 | 78 |
| 575 | 3300050490 | nmdc:mga03n38_253747_c1 | nmdc:mga03n38_253747_c1_568_810 | 78 |
| 576 | 3300050490 | nmdc:mga03n38_426640_c1 | nmdc:mga03n38_426640_c1_418_660 | 78 |
| 577 | 3300050490 | nmdc:mga03n38_530643_c1 | nmdc:mga03n38_530643_c1_204_446 | 78 |
| 578 | 3300050490 | nmdc:mga03n38_53247_c1 | nmdc:mga03n38_53247_c1_251_490 | 78 |
| 579 | 3300050490 | nmdc:mga03n38_694151_c1 | nmdc:mga03n38_694151_c1_115_357 | 78 |
| 580 | 3300050490 | nmdc:mga03n38_883599_c1 | nmdc:mga03n38_883599_c1_39_281 | 78 |
| 581 | 3300050491 | nmdc:mga00v17_116301_c1 | nmdc:mga00v17_116301_c1_115_357 | 78 |
| 582 | 3300050491 | nmdc:mga00v17_153246_c1 | nmdc:mga00v17_153246_c1_586_825 | 78 |
| 583 | 3300050491 | nmdc:mga00v17_219045_c1 | nmdc:mga00v17_219045_c1_363_605 | 78 |
| 584 | 3300050491 | nmdc:mga00v17_396272_c1 | nmdc:mga00v17_396272_c1_66_308 | 78 |
| 585 | 3300050491 | nmdc:mga00v17_554942_c1 | nmdc:mga00v17_554942_c1_116_355 | 78 |
| 586 | 3300050491 | nmdc:mga00v17_75146_c1 | nmdc:mga00v17_75146_c1_845_1087 | 78 |
| 587 | 3300050492 | nmdc:mga0yw44_18493_c1 | nmdc:mga0yw44_18493_c1_3470_3712 | 78 |
| 588 | 3300050494 | nmdc:mga06z11_20547_c1 | nmdc:mga06z11_20547_c1_1418_1660 | 78 |
| 589 | 3300050495 | nmdc:mga04h51_115475_c1 | nmdc:mga04h51_115475_c1_686_928 | 78 |
| 590 | 3300050496 | nmdc:mga07m45_19884_c1 | nmdc:mga07m45_19884_c1_1251_1493 | 78 |
| 591 | 3300050496 | nmdc:mga07m45_41866_c1 | nmdc:mga07m45_41866_c1_145_387 | 78 |
| 592 | 3300050496 | nmdc:mga07m45_622518_c1 | nmdc:mga07m45_622518_c1_173_415 | 78 |
| 593 | 3300050507 | nmdc:mga05p37_49451_c1 | nmdc:mga05p37_49451_c1_102_344 | 78 |
| 594 | 3300050509 | nmdc:mga0qj67_15786_c1 | nmdc:mga0qj67_15786_c1_295_537 | 78 |
| 595 | 3300050510 | nmdc:mga06r32_22714_c1 | nmdc:mga06r32_22714_c1_2982_3224 | 78 |
| 596 | 3300050516 | nmdc:mga0sz30_15354_c1 | nmdc:mga0sz30_15354_c1_510_752 | 78 |
| 597 | 3300050516 | nmdc:mga0sz30_22431_c1 | nmdc:mga0sz30_22431_c1_2235_2477 | 78 |
| 598 | 3300050516 | nmdc:mga0sz30_253975_c1 | nmdc:mga0sz30_253975_c1_456_698 | 78 |
| 599 | 3300050516 | nmdc:mga0sz30_392457_c1 | nmdc:mga0sz30_392457_c1_118_360 | 78 |
| 600 | 3300053108 | Ga0500562_014843 | Ga0500562_014843_1714_1953 | 78 |
| 601 | 3300053153 | Ga0500616_0163851 | Ga0500616_0163851_25_264 | 78 |
| 602 | 3300001977 | JGI24746J21847_1003633 | JGI24746J21847_10036334 | 79 |
| 603 | 3300001989 | JGI24739J22299_10152601 | JGI24739J22299_101526012 | 79 |
| 604 | 3300001990 | JGI24737J22298_10032763 | JGI24737J22298_100327632 | 79 |
| 605 | 3300001991 | JGI24743J22301_10032924 | JGI24743J22301_100329241 | 79 |
| 606 | 3300002067 | JGI24735J21928_10045320 | JGI24735J21928_100453203 | 79 |
| 607 | 3300002073 | JGI24745J21846_1002064 | JGI24745J21846_10020642 | 79 |
| 608 | 3300002075 | JGI24738J21930_10036836 | JGI24738J21930_100368362 | 79 |
| 609 | 3300002077 | JGI24744J21845_10004063 | JGI24744J21845_100040632 | 79 |
| 610 | 3300002239 | JGI24034J26672_10010903 | JGI24034J26672_100109032 | 79 |
| 611 | 3300002244 | JGI24742J22300_10025243 | JGI24742J22300_100252432 | 79 |
| 612 | 3300005328 | Ga0070676_10114087 | Ga0070676_101140873 | 79 |
| 613 | 3300005330 | Ga0070690_100178641 | Ga0070690_1001786413 | 79 |
| 614 | 3300005333 | Ga0070677_10293030 | Ga0070677_102930302 | 79 |
| 615 | 3300005334 | Ga0068869_100053371 | Ga0068869_1000533715 | 79 |
| 616 | 3300005335 | Ga0070666_10360984 | Ga0070666_103609842 | 79 |
| 617 | 3300005337 | Ga0070682_100362958 | Ga0070682_1003629583 | 79 |
| 618 | 3300005338 | Ga0068868_100177748 | Ga0068868_1001777483 | 79 |
| 619 | 3300005338 | Ga0068868_100862323 | Ga0068868_1008623232 | 79 |
| 620 | 3300005339 | Ga0070660_100088227 | Ga0070660_1000882272 | 79 |
| 621 | 3300005340 | Ga0070689_100109321 | Ga0070689_1001093213 | 79 |
| 622 | 3300005341 | Ga0070691_10160743 | Ga0070691_101607431 | 79 |
| 623 | 3300005343 | Ga0070687_100860647 | Ga0070687_1008606471 | 79 |
| 624 | 3300005347 | Ga0070668_100560864 | Ga0070668_1005608642 | 79 |
| 625 | 3300005347 | Ga0070668_101001721 | Ga0070668_1010017212 | 79 |
| 626 | 3300005353 | Ga0070669_100088627 | Ga0070669_1000886273 | 79 |
| 627 | 3300005355 | Ga0070671_100176939 | Ga0070671_1001769392 | 79 |
| 628 | 3300005356 | Ga0070674_100224370 | Ga0070674_1002243702 | 79 |
| 629 | 3300005364 | Ga0070673_100017849 | Ga0070673_1000178496 | 79 |
| 630 | 3300005366 | Ga0070659_100087977 | Ga0070659_1000879774 | 79 |
| 631 | 3300005367 | Ga0070667_100022244 | Ga0070667_1000222444 | 79 |
| 632 | 3300005434 | Ga0070709_10013527 | Ga0070709_100135276 | 79 |
| 633 | 3300005437 | Ga0070710_10005227 | Ga0070710_100052276 | 79 |
| 634 | 3300005438 | Ga0070701_10100724 | Ga0070701_101007243 | 79 |
| 635 | 3300005439 | Ga0070711_100125537 | Ga0070711_1001255374 | 79 |
| 636 | 3300005440 | Ga0070705_100031435 | Ga0070705_1000314351 | 79 |
| 637 | 3300005444 | Ga0070694_100111372 | Ga0070694_1001113723 | 79 |
| 638 | 3300005445 | Ga0070708_100792267 | Ga0070708_1007922672 | 79 |
| 639 | 3300005445 | Ga0070708_101367605 | Ga0070708_1013676052 | 79 |
| 640 | 3300005455 | Ga0070663_101121020 | Ga0070663_1011210202 | 79 |
| 641 | 3300005456 | Ga0070678_100034461 | Ga0070678_1000344616 | 79 |
| 642 | 3300005456 | Ga0070678_100567173 | Ga0070678_1005671732 | 79 |
| 643 | 3300005457 | Ga0070662_100172232 | Ga0070662_1001722323 | 79 |
| 644 | 3300005458 | Ga0070681_11568200 | Ga0070681_115682002 | 79 |
| 645 | 3300005539 | Ga0068853_100135994 | Ga0068853_1001359943 | 79 |
| 646 | 3300005539 | Ga0068853_101144945 | Ga0068853_1011449452 | 79 |
| 647 | 3300005543 | Ga0070672_100875423 | Ga0070672_1008754232 | 79 |
| 648 | 3300005545 | Ga0070695_100149934 | Ga0070695_1001499341 | 79 |
| 649 | 3300005546 | Ga0070696_100082713 | Ga0070696_1000827134 | 79 |
| 650 | 3300005547 | Ga0070693_100101787 | Ga0070693_1001017873 | 79 |
| 651 | 3300005548 | Ga0070665_100013763 | Ga0070665_1000137636 | 79 |
| 652 | 3300005549 | Ga0070704_100142284 | Ga0070704_1001422843 | 79 |
| 653 | 3300005563 | Ga0068855_100397180 | Ga0068855_1003971801 | 79 |
| 654 | 3300005578 | Ga0068854_100214659 | Ga0068854_1002146592 | 79 |
| 655 | 3300005615 | Ga0070702_100034485 | Ga0070702_1000344852 | 79 |
| 656 | 3300005615 | Ga0070702_101284614 | Ga0070702_1012846141 | 79 |
| 657 | 3300005616 | Ga0068852_101175799 | Ga0068852_1011757992 | 79 |
| 658 | 3300005617 | Ga0068859_101166934 | Ga0068859_1011669341 | 79 |
| 659 | 3300005618 | Ga0068864_100323023 | Ga0068864_1003230233 | 79 |
| 660 | 3300005718 | Ga0068866_11403301 | Ga0068866_114033012 | 79 |
| 661 | 3300005719 | Ga0068861_100148206 | Ga0068861_1001482063 | 79 |
| 662 | 3300005719 | Ga0068861_100457938 | Ga0068861_1004579382 | 79 |
| 663 | 3300005719 | Ga0068861_102232519 | Ga0068861_1022325191 | 79 |
| 664 | 3300005842 | Ga0068858_100128436 | Ga0068858_1001284363 | 79 |
| 665 | 3300005842 | Ga0068858_100557208 | Ga0068858_1005572081 | 79 |
| 666 | 3300005843 | Ga0068860_101120431 | Ga0068860_1011204312 | 79 |
| 667 | 3300005843 | Ga0068860_101233988 | Ga0068860_1012339882 | 79 |
| 668 | 3300005844 | Ga0068862_100037226 | Ga0068862_1000372263 | 79 |
| 669 | 3300005937 | Ga0081455_10062815 | Ga0081455_100628154 | 79 |
| 670 | 3300006038 | Ga0075365_10118319 | Ga0075365_101183193 | 79 |
| 671 | 3300006048 | Ga0075363_100235383 | Ga0075363_1002353832 | 79 |
| 672 | 3300006051 | Ga0075364_10000608 | Ga0075364_100006086 | 79 |
| 673 | 3300006163 | Ga0070715_10006084 | Ga0070715_100060845 | 79 |
| 674 | 3300006163 | Ga0070715_10789040 | Ga0070715_107890402 | 79 |
| 675 | 3300006173 | Ga0070716_100004652 | Ga0070716_1000046527 | 79 |
| 676 | 3300006175 | Ga0070712_100010399 | Ga0070712_1000103994 | 79 |
| 677 | 3300006175 | Ga0070712_100257080 | Ga0070712_1002570802 | 79 |
| 678 | 3300006177 | Ga0075362_10030275 | Ga0075362_100302754 | 79 |
| 679 | 3300006186 | Ga0075369_10005927 | Ga0075369_100059276 | 79 |
| 680 | 3300006186 | Ga0075369_10007728 | Ga0075369_100077286 | 79 |
| 681 | 3300006186 | Ga0075369_10013814 | Ga0075369_100138144 | 79 |
| 682 | 3300006237 | Ga0097621_100527738 | Ga0097621_1005277382 | 79 |
| 683 | 3300006237 | Ga0097621_100856186 | Ga0097621_1008561862 | 79 |
| 684 | 3300006358 | Ga0068871_100192464 | Ga0068871_1001924643 | 79 |
| 685 | 3300006846 | Ga0075430_100528453 | Ga0075430_1005284532 | 79 |
| 686 | 3300006881 | Ga0068865_100118364 | Ga0068865_1001183642 | 79 |
| 687 | 3300006881 | Ga0068865_101587785 | Ga0068865_1015877852 | 79 |
| 688 | 3300006931 | Ga0097620_101166789 | Ga0097620_1011667891 | 79 |
| 689 | 3300009545 | Ga0105237_10006962 | Ga0105237_1000696210 | 79 |
| 690 | 3300010375 | Ga0105239_10046124 | Ga0105239_100461242 | 79 |
| 691 | 3300017792 | Ga0163161_10181693 | Ga0163161_101816932 | 79 |
| 692 | 3300017792 | Ga0163161_10425199 | Ga0163161_104251992 | 79 |
| 693 | 3300017792 | Ga0163161_10554663 | Ga0163161_105546632 | 79 |
| 694 | 3300025711 | Ga0207696_1047827 | Ga0207696_10478272 | 79 |
| 695 | 3300025898 | Ga0207692_10069904 | Ga0207692_100699044 | 79 |
| 696 | 3300025899 | Ga0207642_10069964 | Ga0207642_100699642 | 79 |
| 697 | 3300025901 | Ga0207688_10001753 | Ga0207688_100017536 | 79 |
| 698 | 3300025903 | Ga0207680_10341347 | Ga0207680_103413471 | 79 |
| 699 | 3300025904 | Ga0207647_10340661 | Ga0207647_103406612 | 79 |
| 700 | 3300025905 | Ga0207685_10052796 | Ga0207685_100527962 | 79 |
| 701 | 3300025905 | Ga0207685_10601742 | Ga0207685_106017421 | 79 |
| 702 | 3300025907 | Ga0207645_10034985 | Ga0207645_100349855 | 79 |
| 703 | 3300025908 | Ga0207643_10248916 | Ga0207643_102489162 | 79 |
| 704 | 3300025911 | Ga0207654_10431888 | Ga0207654_104318882 | 79 |
| 705 | 3300025912 | Ga0207707_10738782 | Ga0207707_107387821 | 79 |
| 706 | 3300025915 | Ga0207693_10004579 | Ga0207693_100045798 | 79 |
| 707 | 3300025915 | Ga0207693_10160422 | Ga0207693_101604221 | 79 |
| 708 | 3300025916 | Ga0207663_10081504 | Ga0207663_100815043 | 79 |
| 709 | 3300025918 | Ga0207662_10246054 | Ga0207662_102460543 | 79 |
| 710 | 3300025919 | Ga0207657_10050227 | Ga0207657_100502273 | 79 |
| 711 | 3300025923 | Ga0207681_10120463 | Ga0207681_101204632 | 79 |
| 712 | 3300025926 | Ga0207659_10403810 | Ga0207659_104038102 | 79 |
| 713 | 3300025927 | Ga0207687_10108807 | Ga0207687_101088073 | 79 |
| 714 | 3300025932 | Ga0207690_10183799 | Ga0207690_101837993 | 79 |
| 715 | 3300025933 | Ga0207706_10028298 | Ga0207706_100282986 | 79 |
| 716 | 3300025935 | Ga0207709_10278351 | Ga0207709_102783512 | 79 |
| 717 | 3300025936 | Ga0207670_10090068 | Ga0207670_100900683 | 79 |
| 718 | 3300025937 | Ga0207669_10912067 | Ga0207669_109120672 | 79 |
| 719 | 3300025937 | Ga0207669_11496677 | Ga0207669_114966772 | 79 |
| 720 | 3300025938 | Ga0207704_10131609 | Ga0207704_101316092 | 79 |
| 721 | 3300025939 | Ga0207665_10003777 | Ga0207665_100037778 | 79 |
| 722 | 3300025939 | Ga0207665_10314502 | Ga0207665_103145022 | 79 |
| 723 | 3300025940 | Ga0207691_10033341 | Ga0207691_100333415 | 79 |
| 724 | 3300025942 | Ga0207689_10050263 | Ga0207689_100502635 | 79 |
| 725 | 3300025949 | Ga0207667_10505468 | Ga0207667_105054682 | 79 |
| 726 | 3300025960 | Ga0207651_10122729 | Ga0207651_101227293 | 79 |
| 727 | 3300025961 | Ga0207712_10064034 | Ga0207712_100640341 | 79 |
| 728 | 3300025972 | Ga0207668_10597014 | Ga0207668_105970142 | 79 |
| 729 | 3300025972 | Ga0207668_10902847 | Ga0207668_109028472 | 79 |
| 730 | 3300025981 | Ga0207640_10744761 | Ga0207640_107447612 | 79 |
| 731 | 3300025986 | Ga0207658_10119986 | Ga0207658_101199863 | 79 |
| 732 | 3300026023 | Ga0207677_10797660 | Ga0207677_107976602 | 79 |
| 733 | 3300026023 | Ga0207677_11039312 | Ga0207677_110393121 | 79 |
| 734 | 3300026035 | Ga0207703_10040277 | Ga0207703_100402773 | 79 |
| 735 | 3300026035 | Ga0207703_10971459 | Ga0207703_109714591 | 79 |
| 736 | 3300026041 | Ga0207639_10271993 | Ga0207639_102719932 | 79 |
| 737 | 3300026041 | Ga0207639_12031165 | Ga0207639_120311652 | 79 |
| 738 | 3300026067 | Ga0207678_10232200 | Ga0207678_102322003 | 79 |
| 739 | 3300026075 | Ga0207708_10042495 | Ga0207708_100424954 | 79 |
| 740 | 3300026089 | Ga0207648_10098384 | Ga0207648_100983843 | 79 |
| 741 | 3300026095 | Ga0207676_10153177 | Ga0207676_101531773 | 79 |
| 742 | 3300026118 | Ga0207675_100090749 | Ga0207675_1000907494 | 79 |
| 743 | 3300026118 | Ga0207675_100115957 | Ga0207675_1001159573 | 79 |
| 744 | 3300026118 | Ga0207675_100832347 | Ga0207675_1008323472 | 79 |
| 745 | 3300026121 | Ga0207683_10098056 | Ga0207683_100980562 | 79 |
| 746 | 3300026142 | Ga0207698_10194931 | Ga0207698_101949312 | 79 |
| 747 | 3300028379 | Ga0268266_10019883 | Ga0268266_100198833 | 79 |
| 748 | 3300028380 | Ga0268265_10054607 | Ga0268265_100546074 | 79 |
| 749 | 3300028381 | Ga0268264_11681211 | Ga0268264_116812112 | 79 |
| 750 | 3300031852 | Ga0307410_10377320 | Ga0307410_103773203 | 79 |
| 751 | 3300031852 | Ga0307410_11588743 | Ga0307410_115887431 | 79 |
| 752 | 3300031903 | Ga0307407_10216568 | Ga0307407_102165682 | 79 |
| 753 | 3300031995 | Ga0307409_102978064 | Ga0307409_1029780642 | 79 |
| 754 | 3300032002 | Ga0307416_100890164 | Ga0307416_1008901642 | 79 |
| 755 | 3300032002 | Ga0307416_101486597 | Ga0307416_1014865972 | 79 |
| 756 | 3300046523 | Ga0495644_0292295 | Ga0495644_0292295_101_340 | 79 |
| 757 | 3300046691 | Ga0495670_0672048 | Ga0495670_0672048_56_295 | 79 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2q1z-assembly1.cif.gz_B | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.7667 | 13 | 59 |
| 3hug-assembly6.cif.gz_P | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6646 | 13 | 63 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6626 | 12 | 62 |
| 3hug-assembly3.cif.gz_L | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.66 | 13 | 63 |
| 5wur-assembly1.cif.gz_C | crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form | 0.6319 | 7 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2q1zD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7577 | 13 | 59 | 1.10.10.1320 |
| 2z2sD01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6858 | 1 | 59 | 1.10.10.1320 |
| 5olnA01 | Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C | 0.6849 | 6 | 36 | 1.20.970.10 |
| 3hugH00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6663 | 13 | 63 | 1.10.10.1320 |
| 3hugP00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6646 | 13 | 63 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A399X1K3-F1-model_v4 | Uncharacterized protein | 0.8128 | 6 | 75 |
|
| AF-A0A4R6YKZ8-F1-model_v4 | Anti-sigma-K factor RskA | 0.7983 | 7 | 66 |
|
| AF-A0A7Y8IAT4-F1-model_v4 | Zf-HC2 domain-containing protein | 0.7958 | 6 | 57 |
GO:0016020
|
| AF-A0A136NDH7-F1-model_v4 | RNA polymerase subunit sigma-70 | 0.7851 | 1 | 57 |
GO:0006352
GO:0016020 GO:0016987 |
| AF-A3SHJ4-F1-model_v4 | Anti-sigma factor | 0.781 | 3 | 59 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar