F479407

General Info

Members Datasets Scaffolds Average Seq Length
757 310 752 78

Family's Representative Sequence

Representative Sequence 3300042438|Ga0439459_0077582|Ga0439459_0077582_131_400
Length 89
Sequence MTDTPALDCNELVELVTAYLENALPAVERARFEAHLTECPDCVEYVAQFQRTIAAIGLAAPELERTPPVSDLLRVFRDWKRGAAAPTMN

Samples

Sample ID Description Type Environment
1 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
222 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
223 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
226 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
233 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
249 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
280 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
303 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.51
Nodule 0
Rhizoplane 10.17
Rhizosphere 69.62
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003633 3300001977 Bacteria 2429
2 JGI24739J22299_10152601 3300001989 Bacteria 683
3 JGI24737J22298_10032763 3300001990 Bacteria 1617
4 JGI24743J22301_10032924 3300001991 Bacteria 1025
5 JGI24735J21928_10045320 3300002067 Bacteria 1277
6 JGI24735J21928_10129938 3300002067 Bacteria 726
7 JGI24735J21928_10172605 3300002067 Bacteria 625
8 JGI24735J21928_10184276 3300002067 Bacteria 604
9 JGI24750J21931_1023575 3300002070 Bacteria 874
10 JGI24745J21846_1002064 3300002073 Bacteria 2015
11 JGI24738J21930_10036836 3300002075 Bacteria 995
12 JGI24744J21845_10004063 3300002077 Bacteria 3019
13 JGI24034J26672_10004458 3300002239 Bacteria 1987
14 JGI24034J26672_10010903 3300002239 Bacteria 1356
15 JGI24034J26672_10114638 3300002239 Bacteria 517
16 JGI24742J22300_10025243 3300002244 Bacteria 1026
17 JGI24742J22300_10068884 3300002244 Bacteria 658
18 Ga0055540_1001650 3300003792 Bacteria 12948
19 Ga0065704_10414286 3300005289 Bacteria 714
20 Ga0070676_10114087 3300005328 Bacteria 1687
21 Ga0070690_100178641 3300005330 Bacteria 1466
22 Ga0070690_100487282 3300005330 Bacteria 920
23 Ga0070670_100048485 3300005331 Bacteria 3655
24 Ga0070677_10293030 3300005333 Bacteria 824
25 Ga0068869_100053371 3300005334 Bacteria 2938
26 Ga0068869_100181551 3300005334 Bacteria 1650
27 Ga0070666_10360984 3300005335 Bacteria 1041
28 Ga0070666_10697788 3300005335 Bacteria 744
29 Ga0070682_100003990 3300005337 Bacteria 8196
30 Ga0070682_100362958 3300005337 Bacteria 1084
31 Ga0070682_101528546 3300005337 Bacteria 575
32 Ga0068868_100177748 3300005338 Bacteria 1764
33 Ga0068868_100298665 3300005338 Bacteria 1367
34 Ga0068868_100862323 3300005338 Bacteria 821
35 Ga0070660_100088227 3300005339 Bacteria 2442
36 Ga0070689_100109321 3300005340 Bacteria 2197
37 Ga0070689_100292911 3300005340 Bacteria 1353
38 Ga0070691_10160743 3300005341 Bacteria 1158
39 Ga0070691_10163501 3300005341 Bacteria 1149
40 Ga0070687_100860647 3300005343 Bacteria 647
41 Ga0070661_101140799 3300005344 Unclassified 650
42 Ga0070692_10554904 3300005345 Unclassified 753
43 Ga0070668_100002358 3300005347 Bacteria 13884
44 Ga0070668_100011959 3300005347 Bacteria 6465
45 Ga0070668_100061829 3300005347 Bacteria 2902
46 Ga0070668_100560864 3300005347 Bacteria 995
47 Ga0070668_101001721 3300005347 Bacteria 751
48 Ga0070668_101996864 3300005347 Bacteria 535
49 Ga0070669_100000585 3300005353 Bacteria 27148
50 Ga0070669_100088627 3300005353 Bacteria 2316
51 Ga0070671_100004637 3300005355 Bacteria 10904
52 Ga0070671_100124174 3300005355 Bacteria 2173
53 Ga0070671_100176939 3300005355 Bacteria 1806
54 Ga0070671_100341920 3300005355 Bacteria 1277
55 Ga0070671_100637582 3300005355 Bacteria 922
56 Ga0070674_100045623 3300005356 Bacteria 2994
57 Ga0070674_100224370 3300005356 Bacteria 1463
58 Ga0070674_101424652 3300005356 Bacteria 621
59 Ga0070673_100017849 3300005364 Bacteria 5057
60 Ga0070688_100507032 3300005365 Unclassified 911
61 Ga0070659_100087977 3300005366 Bacteria 2487
62 Ga0070659_100325107 3300005366 Unclassified 1286
63 Ga0070667_100000033 3300005367 Bacteria 175463
64 Ga0070667_100022244 3300005367 Bacteria 5260
65 Ga0070667_100024671 3300005367 Bacteria 4996
66 Ga0070667_100195203 3300005367 Bacteria 1794
67 Ga0070667_100223944 3300005367 Bacteria 1675
68 Ga0070709_10013527 3300005434 Bacteria 4591
69 Ga0070710_10005227 3300005437 Bacteria 6154
70 Ga0070710_10180346 3300005437 Bacteria 1322
71 Ga0070701_10100724 3300005438 Bacteria 1600
72 Ga0070701_10369253 3300005438 Bacteria 901
73 Ga0070711_100125537 3300005439 Bacteria 1904
74 Ga0070711_100508055 3300005439 Bacteria 995
75 Ga0070705_100031435 3300005440 Bacteria 2939
76 Ga0070705_100140614 3300005440 Bacteria 1588
77 Ga0070700_101527401 3300005441 Unclassified 568
78 Ga0070694_100111372 3300005444 Bacteria 1951
79 Ga0070694_100374454 3300005444 Bacteria 1109
80 Ga0070708_100022132 3300005445 Bacteria 5387
81 Ga0070708_100792267 3300005445 Bacteria 891
82 Ga0070708_101367605 3300005445 Bacteria 661
83 Ga0070663_100057743 3300005455 Bacteria 2785
84 Ga0070663_100854576 3300005455 Bacteria 783
85 Ga0070663_101121020 3300005455 Bacteria 689
86 Ga0070663_101421134 3300005455 Unclassified 615
87 Ga0070678_100034461 3300005456 Bacteria 3526
88 Ga0070678_100043294 3300005456 Bacteria 3205
89 Ga0070678_100190628 3300005456 Bacteria 1685
90 Ga0070678_100567173 3300005456 Bacteria 1010
91 Ga0070662_100172232 3300005457 Bacteria 1700
92 Ga0070681_11568200 3300005458 Bacteria 584
93 Ga0070706_100015125 3300005467 Bacteria 7125
94 Ga0070706_100073183 3300005467 Bacteria 3171
95 Ga0070707_100007233 3300005468 Bacteria 10303
96 Ga0070707_100120284 3300005468 Bacteria 2549
97 Ga0070698_100048472 3300005471 Bacteria 4341
98 Ga0070698_100172088 3300005471 Bacteria 2106
99 Ga0070699_100007861 3300005518 Bacteria 9264
100 Ga0070699_100069585 3300005518 Bacteria 3058
101 Ga0070684_100527954 3300005535 Unclassified 1094
102 Ga0070697_100079472 3300005536 Bacteria 2700
103 Ga0068853_100056314 3300005539 Bacteria 3389
104 Ga0068853_100135994 3300005539 Bacteria 2203
105 Ga0068853_100980330 3300005539 Unclassified 813
106 Ga0068853_101144945 3300005539 Bacteria 751
107 Ga0068853_101746773 3300005539 Bacteria 603
108 Ga0070672_100875423 3300005543 Bacteria 793
109 Ga0070686_100671204 3300005544 Bacteria 824
110 Ga0070686_101549076 3300005544 Bacteria 560
111 Ga0070695_100149934 3300005545 Bacteria 1626
112 Ga0070695_100158148 3300005545 Bacteria 1588
113 Ga0070696_100082713 3300005546 Bacteria 2276
114 Ga0070696_100167006 3300005546 Bacteria 1625
115 Ga0070693_100083170 3300005547 Bacteria 1913
116 Ga0070693_100101787 3300005547 Bacteria 1751
117 Ga0070665_100003448 3300005548 Bacteria 16866
118 Ga0070665_100012289 3300005548 Bacteria 8631
119 Ga0070665_100013763 3300005548 Bacteria 8139
120 Ga0070665_100739826 3300005548 Bacteria 996
121 Ga0070665_101537949 3300005548 Bacteria 674
122 Ga0070704_100142284 3300005549 Bacteria 1875
123 Ga0070704_100296291 3300005549 Bacteria 1346
124 Ga0068855_100170863 3300005563 Bacteria 2462
125 Ga0068855_100397180 3300005563 Bacteria 1511
126 Ga0068854_100061794 3300005578 Bacteria 2714
127 Ga0068854_100127770 3300005578 Bacteria 1938
128 Ga0068854_100214659 3300005578 Bacteria 1519
129 Ga0068856_100119856 3300005614 Bacteria 2633
130 Ga0070702_100034485 3300005615 Bacteria 2790
131 Ga0070702_100214242 3300005615 Bacteria 1284
132 Ga0070702_100465749 3300005615 Bacteria 920
133 Ga0070702_101284614 3300005615 Bacteria 594
134 Ga0068852_100288167 3300005616 Bacteria 1585
135 Ga0068852_101140323 3300005616 Bacteria 800
136 Ga0068852_101175799 3300005616 Bacteria 788
137 Ga0068859_100004951 3300005617 Bacteria 13527
138 Ga0068859_100391310 3300005617 Bacteria 1486
139 Ga0068859_100669230 3300005617 Bacteria 1129
140 Ga0068859_101166934 3300005617 Bacteria 848
141 Ga0068859_101655862 3300005617 Bacteria 707
142 Ga0068864_100323023 3300005618 Bacteria 1450
143 Ga0068864_102243308 3300005618 Bacteria 552
144 Ga0068864_102375773 3300005618 Bacteria 536
145 Ga0068866_10040171 3300005718 Bacteria 2314
146 Ga0068866_11403301 3300005718 Bacteria 510
147 Ga0068861_100126170 3300005719 Bacteria 2071
148 Ga0068861_100142389 3300005719 Bacteria 1958
149 Ga0068861_100148206 3300005719 Bacteria 1923
150 Ga0068861_100457938 3300005719 Bacteria 1144
151 Ga0068861_100988208 3300005719 Bacteria 803
152 Ga0068861_102232519 3300005719 Bacteria 549
153 Ga0068851_10688267 3300005834 Unclassified 628
154 Ga0068870_10225571 3300005840 Bacteria 1149
155 Ga0068863_100000193 3300005841 Bacteria 64832
156 Ga0068863_100016574 3300005841 Bacteria 7070
157 Ga0068863_100599913 3300005841 Bacteria 1090
158 Ga0068858_100052259 3300005842 Bacteria 3780
159 Ga0068858_100128436 3300005842 Bacteria 2375
160 Ga0068858_100176765 3300005842 Bacteria 2014
161 Ga0068858_100557208 3300005842 Bacteria 1110
162 Ga0068858_101984617 3300005842 Bacteria 575
163 Ga0068860_100000010 3300005843 Bacteria 359114
164 Ga0068860_100107051 3300005843 Bacteria 2671
165 Ga0068860_100385733 3300005843 Bacteria 1384
166 Ga0068860_101120431 3300005843 Bacteria 806
167 Ga0068860_101233988 3300005843 Bacteria 768
168 Ga0068860_102115588 3300005843 Bacteria 584
169 Ga0068862_100000008 3300005844 Bacteria 305510
170 Ga0068862_100037226 3300005844 Bacteria 4123
171 Ga0068862_100690104 3300005844 Bacteria 988
172 Ga0068862_100778855 3300005844 Bacteria 932
173 Ga0068862_101029497 3300005844 Bacteria 815
174 Ga0081455_10003543 3300005937 Bacteria 17905
175 Ga0081455_10023525 3300005937 Bacteria 5731
176 Ga0081455_10062815 3300005937 Bacteria 3120
177 Ga0081455_10484431 3300005937 Bacteria 835
178 Ga0081538_10238976 3300005981 Bacteria 702
179 Ga0081540_1124881 3300005983 Bacteria 1061
180 Ga0070717_10009317 3300006028 Bacteria 7378
181 Ga0070717_11403824 3300006028 Bacteria 634
182 Ga0075365_10011898 3300006038 Bacteria 5139
183 Ga0075365_10054882 3300006038 Bacteria 2643
184 Ga0075365_10074261 3300006038 Bacteria 2293
185 Ga0075365_10118319 3300006038 Bacteria 1826
186 Ga0075365_11064074 3300006038 Bacteria 570
187 Ga0075368_10110118 3300006042 Bacteria 1135
188 Ga0075368_10132777 3300006042 Bacteria 1035
189 Ga0075368_10344571 3300006042 Bacteria 648
190 Ga0075363_100000299 3300006048 Bacteria 14518
191 Ga0075363_100006581 3300006048 Bacteria 5291
192 Ga0075363_100014648 3300006048 Bacteria 3839
193 Ga0075363_100068718 3300006048 Bacteria 1921
194 Ga0075363_100078566 3300006048 Bacteria 1801
195 Ga0075363_100083362 3300006048 Bacteria 1752
196 Ga0075363_100235383 3300006048 Bacteria 1052
197 Ga0075363_100288161 3300006048 Bacteria 951
198 Ga0075363_100363649 3300006048 Bacteria 846
199 Ga0075363_100368669 3300006048 Bacteria 840
200 Ga0075363_100400865 3300006048 Bacteria 806
201 Ga0075363_100663958 3300006048 Bacteria 628
202 Ga0075364_10000608 3300006051 Bacteria 18510
203 Ga0075364_10026274 3300006051 Bacteria 3713
204 Ga0075364_10044848 3300006051 Bacteria 2877
205 Ga0075364_10053276 3300006051 Bacteria 2645
206 Ga0075364_10124844 3300006051 Bacteria 1725
207 Ga0075364_10207886 3300006051 Bacteria 1327
208 Ga0075364_10351207 3300006051 Bacteria 1005
209 Ga0075364_10437256 3300006051 Bacteria 894
210 Ga0075364_10527113 3300006051 Bacteria 808
211 Ga0075364_10537672 3300006051 Bacteria 799
212 Ga0075364_10877813 3300006051 Unclassified 611
213 Ga0075364_11150758 3300006051 Unclassified 526
214 Ga0075364_11260911 3300006051 Bacteria 501
215 Ga0070715_10006084 3300006163 Bacteria 4077
216 Ga0070715_10789040 3300006163 Bacteria 575
217 Ga0070716_100004652 3300006173 Bacteria 6576
218 Ga0070712_100010399 3300006175 Bacteria 5870
219 Ga0070712_100257080 3300006175 Bacteria 1398
220 Ga0075362_10030275 3300006177 Bacteria 2337
221 Ga0075362_10073804 3300006177 Bacteria 1562
222 Ga0075362_10174138 3300006177 Bacteria 1041
223 Ga0075362_10291445 3300006177 Bacteria 808
224 Ga0075367_10058413 3300006178 Bacteria 2295
225 Ga0075367_10178029 3300006178 Bacteria 1325
226 Ga0075367_10735649 3300006178 Bacteria 628
227 Ga0075367_10945551 3300006178 Unclassified 550
228 Ga0075369_10001584 3300006186 Bacteria 7819
229 Ga0075369_10005927 3300006186 Bacteria 4597
230 Ga0075369_10007728 3300006186 Bacteria 4109
231 Ga0075369_10010179 3300006186 Bacteria 3675
232 Ga0075369_10011210 3300006186 Bacteria 3522
233 Ga0075369_10013814 3300006186 Bacteria 3214
234 Ga0075369_10026164 3300006186 Bacteria 2431
235 Ga0075369_10092227 3300006186 Bacteria 1353
236 Ga0075369_10341736 3300006186 Bacteria 702
237 Ga0075369_10436482 3300006186 Bacteria 619
238 Ga0075369_10490366 3300006186 Bacteria 583
239 Ga0075369_10541941 3300006186 Bacteria 555
240 Ga0097621_100527738 3300006237 Bacteria 1072
241 Ga0097621_100856186 3300006237 Bacteria 845
242 Ga0097621_101250835 3300006237 Bacteria 700
243 Ga0075370_10022387 3300006353 Bacteria 3470
244 Ga0075370_10045478 3300006353 Bacteria 2483
245 Ga0075370_10056732 3300006353 Bacteria 2226
246 Ga0075370_10066312 3300006353 Bacteria 2059
247 Ga0075370_10492331 3300006353 Bacteria 739
248 Ga0075370_10534360 3300006353 Bacteria 709
249 Ga0068871_100192464 3300006358 Bacteria 1757
250 Ga0068871_101396061 3300006358 Bacteria 660
251 Ga0075428_100004424 3300006844 Bacteria 15515
252 Ga0075430_100053158 3300006846 Bacteria 3411
253 Ga0075430_100528453 3300006846 Bacteria 973
254 Ga0075431_100248587 3300006847 Bacteria 1807
255 Ga0068865_100116864 3300006881 Bacteria 1976
256 Ga0068865_100118364 3300006881 Bacteria 1965
257 Ga0068865_100393735 3300006881 Unclassified 1133
258 Ga0068865_101587785 3300006881 Bacteria 588
259 Ga0097620_100004951 3300006931 Bacteria 13527
260 Ga0097620_100391346 3300006931 Bacteria 1486
261 Ga0097620_100669229 3300006931 Bacteria 1129
262 Ga0097620_101166789 3300006931 Bacteria 848
263 Ga0097620_101656152 3300006931 Bacteria 707
264 Ga0075435_101367395 3300007076 Bacteria 620
265 Ga0075435_101855191 3300007076 Bacteria 529
266 Ga0105250_10019823 3300009092 Bacteria 2721
267 Ga0105250_10044712 3300009092 Bacteria 1776
268 Ga0105245_10084905 3300009098 Bacteria 2901
269 Ga0105245_10095749 3300009098 Bacteria 2739
270 Ga0105245_11221514 3300009098 Bacteria 800
271 Ga0105245_12888953 3300009098 Bacteria 532
272 Ga0105247_10000082 3300009101 Bacteria 106460
273 Ga0105247_10041169 3300009101 Bacteria 2826
274 Ga0105247_10093297 3300009101 Bacteria 1913
275 Ga0105247_10313929 3300009101 Bacteria 1091
276 Ga0105247_10559342 3300009101 Unclassified 842
277 Ga0114129_10826262 3300009147 Bacteria 1180
278 Ga0114129_12841318 3300009147 Bacteria 574
279 Ga0105243_10079971 3300009148 Bacteria 2665
280 Ga0105243_10200174 3300009148 Bacteria 1751
281 Ga0105241_10259202 3300009174 Bacteria 1477
282 Ga0105241_10453177 3300009174 Bacteria 1135
283 Ga0105241_10463618 3300009174 Unclassified 1123
284 Ga0105242_11355716 3300009176 Bacteria 737
285 Ga0105248_10000084 3300009177 Bacteria 110380
286 Ga0105248_10066413 3300009177 Bacteria 4050
287 Ga0105248_10285302 3300009177 Bacteria 1859
288 Ga0105248_11432024 3300009177 Bacteria 782
289 Ga0105237_10000298 3300009545 Bacteria 68533
290 Ga0105237_10006962 3300009545 Bacteria 12462
291 Ga0105237_10510301 3300009545 Bacteria 1209
292 Ga0105238_11542450 3300009551 Unclassified 694
293 Ga0105249_10000285 3300009553 Bacteria 52372
294 Ga0105249_10036484 3300009553 Bacteria 4459
295 Ga0105249_10306145 3300009553 Bacteria 1596
296 Ga0105249_10364715 3300009553 Bacteria 1467
297 Ga0105249_11693652 3300009553 Bacteria 705
298 Ga0105249_11923220 3300009553 Bacteria 664
299 Ga0105249_12233177 3300009553 Bacteria 620
300 Ga0105249_13106271 3300009553 Bacteria 533
301 Ga0099796_10002388 3300010159 Bacteria 4107
302 Ga0105239_10014559 3300010375 Bacteria 8726
303 Ga0105239_10046124 3300010375 Bacteria 4776
304 Ga0105239_10167329 3300010375 Unclassified 2458
305 Ga0105239_10583908 3300010375 Bacteria 1274
306 Ga0105239_10716213 3300010375 Bacteria 1145
307 Ga0105239_11693071 3300010375 Bacteria 732
308 Ga0105239_11859294 3300010375 Bacteria 698
309 Ga0105239_11956336 3300010375 Bacteria 680
310 Ga0105246_10141333 3300011119 Bacteria 1810
311 Ga0105246_10643320 3300011119 Bacteria 922
312 Ga0105246_10851220 3300011119 Bacteria 813
313 Ga0157370_11448349 3300013104 Bacteria 618
314 Ga0157369_11221771 3300013105 Bacteria 767
315 Ga0157374_10024493 3300013296 Bacteria 5412
316 Ga0157374_10406780 3300013296 Bacteria 1358
317 Ga0157378_10117035 3300013297 Bacteria 2452
318 Ga0157378_10155787 3300013297 Bacteria 2132
319 Ga0157378_10574035 3300013297 Bacteria 1136
320 Ga0163162_10121870 3300013306 Bacteria 2712
321 Ga0163162_10148122 3300013306 Bacteria 2464
322 Ga0163162_10235777 3300013306 Bacteria 1960
323 Ga0163162_10527983 3300013306 Bacteria 1309
324 Ga0163162_10565322 3300013306 Unclassified 1265
325 Ga0163162_10578213 3300013306 Bacteria 1250
326 Ga0163162_10806367 3300013306 Bacteria 1056
327 Ga0163162_11767812 3300013306 Bacteria 706
328 Ga0163162_11824357 3300013306 Bacteria 695
329 Ga0157372_10401058 3300013307 Bacteria 1598
330 Ga0157375_10306065 3300013308 Bacteria 1753
331 Ga0157375_10362306 3300013308 Bacteria 1616
332 Ga0157375_11743126 3300013308 Bacteria 738
333 Ga0157375_12373302 3300013308 Bacteria 633
334 Ga0157375_12403266 3300013308 Bacteria 629
335 Ga0157375_12680351 3300013308 Bacteria 596
336 Ga0163163_10010591 3300014325 Bacteria 8305
337 Ga0163163_10014507 3300014325 Bacteria 7246
338 Ga0163163_10140332 3300014325 Bacteria 2459
339 Ga0163163_10329443 3300014325 Bacteria 1581
340 Ga0163163_10552520 3300014325 Bacteria 1214
341 Ga0163163_11626437 3300014325 Bacteria 707
342 Ga0163163_11643584 3300014325 Unclassified 703
343 Ga0157380_10107081 3300014326 Bacteria 2341
344 Ga0157377_11071747 3300014745 Bacteria 615
345 Ga0157379_10096326 3300014968 Bacteria 2656
346 Ga0157379_10258577 3300014968 Bacteria 1582
347 Ga0157379_11448792 3300014968 Bacteria 667
348 Ga0157379_11516810 3300014968 Bacteria 652
349 Ga0157376_10138643 3300014969 Bacteria 2179
350 Ga0157376_11420197 3300014969 Bacteria 726
351 Ga0163161_10148354 3300017792 Bacteria 1781
352 Ga0163161_10181693 3300017792 Bacteria 1613
353 Ga0163161_10425199 3300017792 Bacteria 1069
354 Ga0163161_10554663 3300017792 Bacteria 942
355 Ga0163161_11602544 3300017792 Unclassified 574
356 Ga0209673_1035110 3300025273 Bacteria 1504
357 Ga0209051_1002514 3300025303 Bacteria 13013
358 Ga0209051_1048851 3300025303 Bacteria 1431
359 Ga0207656_10460559 3300025321 Unclassified 643
360 Ga0207696_1047827 3300025711 Bacteria 1231
361 Ga0207696_1108187 3300025711 Bacteria 754
362 Ga0207692_10069904 3300025898 Bacteria 1846
363 Ga0207642_10013951 3300025899 Bacteria 2948
364 Ga0207642_10069964 3300025899 Bacteria 1666
365 Ga0207710_10000194 3300025900 Bacteria 57908
366 Ga0207710_10087829 3300025900 Bacteria 1451
367 Ga0207688_10001753 3300025901 Bacteria 11515
368 Ga0207688_10059175 3300025901 Bacteria 2157
369 Ga0207688_10198166 3300025901 Bacteria 1203
370 Ga0207688_10598276 3300025901 Bacteria 695
371 Ga0207680_10341347 3300025903 Bacteria 1051
372 Ga0207647_10340661 3300025904 Bacteria 850
373 Ga0207685_10052796 3300025905 Bacteria 1576
374 Ga0207685_10601742 3300025905 Bacteria 590
375 Ga0207645_10034985 3300025907 Bacteria 3226
376 Ga0207643_10248916 3300025908 Bacteria 1094
377 Ga0207684_10056393 3300025910 Bacteria 3333
378 Ga0207684_10086662 3300025910 Bacteria 2667
379 Ga0207654_10069392 3300025911 Bacteria 2088
380 Ga0207654_10431888 3300025911 Bacteria 921
381 Ga0207707_10738782 3300025912 Bacteria 824
382 Ga0207671_10031318 3300025914 Bacteria 3963
383 Ga0207671_10382691 3300025914 Bacteria 1118
384 Ga0207693_10004579 3300025915 Bacteria 11670
385 Ga0207693_10160422 3300025915 Bacteria 1769
386 Ga0207663_10081504 3300025916 Bacteria 2119
387 Ga0207663_10274137 3300025916 Bacteria 1251
388 Ga0207662_10246054 3300025918 Bacteria 1172
389 Ga0207657_10050227 3300025919 Bacteria 3630
390 Ga0207657_11253222 3300025919 Bacteria 562
391 Ga0207649_10952347 3300025920 Unclassified 674
392 Ga0207646_10028552 3300025922 Bacteria 5076
393 Ga0207646_10126872 3300025922 Bacteria 2295
394 Ga0207681_10030439 3300025923 Bacteria 3519
395 Ga0207681_10120463 3300025923 Bacteria 1924
396 Ga0207694_10322496 3300025924 Bacteria 1275
397 Ga0207694_11447941 3300025924 Unclassified 580
398 Ga0207650_10445116 3300025925 Bacteria 1077
399 Ga0207659_10403810 3300025926 Bacteria 1143
400 Ga0207687_10017616 3300025927 Bacteria 4705
401 Ga0207687_10108807 3300025927 Bacteria 2053
402 Ga0207644_10176865 3300025931 Bacteria 1670
403 Ga0207690_10183799 3300025932 Bacteria 1576
404 Ga0207690_10380341 3300025932 Unclassified 1122
405 Ga0207706_10028298 3300025933 Bacteria 5006
406 Ga0207709_10278351 3300025935 Bacteria 1235
407 Ga0207670_10090068 3300025936 Bacteria 2166
408 Ga0207670_10238714 3300025936 Bacteria 1399
409 Ga0207669_10002980 3300025937 Bacteria 7275
410 Ga0207669_10912067 3300025937 Bacteria 734
411 Ga0207669_11496677 3300025937 Bacteria 575
412 Ga0207669_11645605 3300025937 Unclassified 548
413 Ga0207704_10131609 3300025938 Bacteria 1733
414 Ga0207704_10160315 3300025938 Bacteria 1600
415 Ga0207665_10003777 3300025939 Bacteria 10117
416 Ga0207665_10314502 3300025939 Bacteria 1174
417 Ga0207691_10033341 3300025940 Bacteria 4794
418 Ga0207711_10000690 3300025941 Bacteria 33262
419 Ga0207711_10268028 3300025941 Bacteria 1571
420 Ga0207689_10050263 3300025942 Bacteria 3438
421 Ga0207689_10618224 3300025942 Bacteria 912
422 Ga0207689_11405343 3300025942 Bacteria 585
423 Ga0207679_10282952 3300025945 Bacteria 1423
424 Ga0207667_10127086 3300025949 Bacteria 2626
425 Ga0207667_10505468 3300025949 Bacteria 1226
426 Ga0207651_10122729 3300025960 Bacteria 1973
427 Ga0207712_10000011 3300025961 Bacteria 412321
428 Ga0207712_10064034 3300025961 Bacteria 2620
429 Ga0207712_10570986 3300025961 Bacteria 975
430 Ga0207668_10002560 3300025972 Bacteria 10623
431 Ga0207668_10096909 3300025972 Bacteria 2181
432 Ga0207668_10597014 3300025972 Bacteria 961
433 Ga0207668_10902847 3300025972 Bacteria 786
434 Ga0207668_12016793 3300025972 Bacteria 520
435 Ga0207640_10139840 3300025981 Bacteria 1763
436 Ga0207640_10331438 3300025981 Unclassified 1216
437 Ga0207640_10744761 3300025981 Bacteria 844
438 Ga0207658_10000220 3300025986 Bacteria 59846
439 Ga0207658_10004124 3300025986 Bacteria 10134
440 Ga0207658_10119986 3300025986 Bacteria 2095
441 Ga0207658_10247762 3300025986 Bacteria 1512
442 Ga0207677_10142531 3300026023 Bacteria 1837
443 Ga0207677_10797660 3300026023 Bacteria 845
444 Ga0207677_11039312 3300026023 Bacteria 744
445 Ga0207703_10019991 3300026035 Bacteria 5232
446 Ga0207703_10040277 3300026035 Bacteria 3738
447 Ga0207703_10183614 3300026035 Bacteria 1847
448 Ga0207703_10692207 3300026035 Bacteria 969
449 Ga0207703_10971459 3300026035 Bacteria 814
450 Ga0207639_10073551 3300026041 Bacteria 2680
451 Ga0207639_10271993 3300026041 Bacteria 1486
452 Ga0207639_10881612 3300026041 Unclassified 836
453 Ga0207639_11690972 3300026041 Bacteria 593
454 Ga0207639_12031165 3300026041 Bacteria 536
455 Ga0207678_10053474 3300026067 Bacteria 3480
456 Ga0207678_10232200 3300026067 Bacteria 1579
457 Ga0207678_10303566 3300026067 Bacteria 1372
458 Ga0207678_10890315 3300026067 Bacteria 787
459 Ga0207708_10042495 3300026075 Bacteria 3465
460 Ga0207641_10001710 3300026088 Bacteria 21337
461 Ga0207641_10012303 3300026088 Bacteria 7021
462 Ga0207641_10043028 3300026088 Bacteria 3791
463 Ga0207641_10960899 3300026088 Unclassified 850
464 Ga0207648_10098384 3300026089 Bacteria 2561
465 Ga0207676_10153177 3300026095 Bacteria 1988
466 Ga0207676_11347891 3300026095 Bacteria 709
467 Ga0207676_12099632 3300026095 Bacteria 563
468 Ga0207675_100090749 3300026118 Bacteria 2873
469 Ga0207675_100115957 3300026118 Bacteria 2531
470 Ga0207675_100145242 3300026118 Bacteria 2255
471 Ga0207675_100177028 3300026118 Bacteria 2041
472 Ga0207675_100832347 3300026118 Bacteria 937
473 Ga0207683_10098056 3300026121 Bacteria 2615
474 Ga0207683_10159484 3300026121 Bacteria 2038
475 Ga0207698_10194931 3300026142 Bacteria 1808
476 Ga0207698_10272784 3300026142 Bacteria 1560
477 Ga0209813_10330654 3300027866 Bacteria 599
478 Ga0268266_10003448 3300028379 Bacteria 15767
479 Ga0268266_10019883 3300028379 Bacteria 5723
480 Ga0268266_10038628 3300028379 Bacteria 4064
481 Ga0268266_10614673 3300028379 Bacteria 1044
482 Ga0268266_11214857 3300028379 Bacteria 729
483 Ga0268266_11617117 3300028379 Bacteria 623
484 Ga0268265_10000007 3300028380 Bacteria 431817
485 Ga0268265_10054607 3300028380 Bacteria 3032
486 Ga0268265_10196731 3300028380 Bacteria 1745
487 Ga0268265_10289879 3300028380 Bacteria 1469
488 Ga0268264_10000007 3300028381 Bacteria 815790
489 Ga0268264_10059097 3300028381 Bacteria 3212
490 Ga0268264_11681211 3300028381 Bacteria 645
491 Ga0307408_100528655 3300031548 Bacteria 1037
492 Ga0307405_10783953 3300031731 Bacteria 797
493 Ga0316577_10316910 3300031733 Bacteria 884
494 Ga0307413_10203923 3300031824 Bacteria 1430
495 Ga0307410_10101672 3300031852 Bacteria 2061
496 Ga0307410_10320166 3300031852 Bacteria 1230
497 Ga0307410_10377320 3300031852 Bacteria 1140
498 Ga0307410_10621846 3300031852 Bacteria 903
499 Ga0307410_11588743 3300031852 Unclassified 578
500 Ga0326468_10036814 3300031889 Bacteria 679
501 Ga0307406_10959286 3300031901 Bacteria 731
502 Ga0307407_10015163 3300031903 Bacteria 3799
503 Ga0307407_10216568 3300031903 Bacteria 1292
504 Ga0307407_10226499 3300031903 Bacteria 1267
505 Ga0307407_11547461 3300031903 Bacteria 525
506 Ga0307412_10683970 3300031911 Bacteria 879
507 Ga0307409_100176711 3300031995 Bacteria 1885
508 Ga0307409_100300178 3300031995 Bacteria 1494
509 Ga0307409_101419491 3300031995 Bacteria 721
510 Ga0307409_102978064 3300031995 Bacteria 500
511 Ga0307416_100383010 3300032002 Bacteria 1437
512 Ga0307416_100890164 3300032002 Bacteria 990
513 Ga0307416_101486597 3300032002 Bacteria 783
514 Ga0307414_11980000 3300032004 Bacteria 544
515 Ga0307415_100179571 3300032126 Bacteria 1659
516 Ga0307415_100638483 3300032126 Bacteria 953
517 Ga0307507_10114224 3300033179 Bacteria 2190
518 Ga0373952_0041191 3300035092 Bacteria 1068
519 Ga0373939_0214628 3300035114 Bacteria 734
520 Ga0373961_0103094 3300035241 Bacteria 926
521 Ga0373931_0068314 3300035691 Bacteria 1934
522 Ga0373947_0297871 3300035725 Bacteria 1075
523 Ga0316584_0186137 3300036712 Bacteria 1536
524 Ga0395900_0966063 3300037418 Bacteria 773
525 Ga0395901_0655982 3300038443 Bacteria 1052
526 Ga0436363_1457429 3300039450 Bacteria 1414
527 Ga0436362_0983837 3300039453 Bacteria 507
528 Ga0439461_0007215 3300041410 Bacteria 1961
529 Ga0439461_0050607 3300041410 Bacteria 920
530 Ga0439461_0080682 3300041410 Bacteria 767
531 Ga0439461_0145607 3300041410 Bacteria 608
532 Ga0439466_0005285 3300041411 Bacteria 4940
533 Ga0439466_0010101 3300041411 Bacteria 3510
534 Ga0439466_0016370 3300041411 Bacteria 2680
535 Ga0439466_0064683 3300041411 Bacteria 1172
536 Ga0439465_0003190 3300041413 Bacteria 5347
537 Ga0439465_0008953 3300041413 Bacteria 3154
538 Ga0439465_0012697 3300041413 Bacteria 2634
539 Ga0439465_0015134 3300041413 Bacteria 2407
540 Ga0439465_0029435 3300041413 Bacteria 1744
541 Ga0439465_0055975 3300041413 Bacteria 1299
542 Ga0451789_1297938 3300041443 Bacteria 515
543 Ga0451793_0577225 3300041452 Bacteria 816
544 Ga0451793_1717196 3300041452 Bacteria 607
545 Ga0451797_0981697 3300041453 Bacteria 601
546 Ga0451800_0729937 3300041459 Unclassified 545
547 Ga0451807_1614344 3300041486 Bacteria 790
548 Ga0451835_0309573 3300041492 Bacteria 696
549 Ga0451853_3958433 3300041512 Bacteria 671
550 Ga0439431_0001993 3300041997 Bacteria 4527
551 Ga0439431_0073619 3300041997 Bacteria 913
552 Ga0439441_138124 3300042001 Bacteria 568
553 Ga0439442_060313 3300042002 Bacteria 804
554 Ga0439442_128287 3300042002 Bacteria 557
555 Ga0439445_0073051 3300042004 Bacteria 951
556 Ga0439434_0004335 3300042435 Bacteria 4150
557 Ga0439434_0081528 3300042435 Bacteria 1027
558 Ga0439459_0077582 3300042438 Bacteria 779
559 Ga0466969_0185173 3300044656 Bacteria 952
560 Ga0466972_0010268 3300044658 Bacteria 4703
561 Ga0466965_0006386 3300044683 Bacteria 5349
562 Ga0466966_0023563 3300044684 Bacteria 4028
563 Ga0466961_0006454 3300044693 Bacteria 7447
564 Ga0466964_0076373 3300044706 Bacteria 1428
565 Ga0466971_0030262 3300044719 Bacteria 2423
566 Ga0466968_0009863 3300044735 Bacteria 3686
567 Ga0466970_0007492 3300044765 Bacteria 5474
568 Ga0466957_0049294 3300044842 Bacteria 2560
569 Ga0466960_0026185 3300044901 Bacteria 2647
570 Ga0466960_0230150 3300044901 Bacteria 1023
571 Ga0466959_0050117 3300045049 Bacteria 3066
572 Ga0466958_0006130 3300045836 Bacteria 6520
573 Ga0466967_1544000 3300045976 Bacteria 661
574 Ga0495584_0199897 3300046491 Unclassified 1016
575 Ga0495583_0095284 3300046506 Bacteria 1277
576 Ga0495644_0280457 3300046523 Bacteria 650
577 Ga0495644_0292295 3300046523 Bacteria 637
578 Ga0495648_0005784 3300046524 Bacteria 10198
579 Ga0495648_0006425 3300046524 Bacteria 9597
580 Ga0495642_0168809 3300046528 Bacteria 950
581 Ga0495640_0634866 3300046533 Unclassified 643
582 Ga0495640_0904555 3300046533 Bacteria 523
583 Ga0495656_0234427 3300046615 Bacteria 922
584 Ga0495668_0017692 3300046616 Bacteria 4129
585 Ga0495668_0366791 3300046616 Bacteria 791
586 Ga0495635_0368996 3300046663 Bacteria 956
587 Ga0495670_0672048 3300046691 Bacteria 565
588 Ga0495649_0158833 3300046694 Bacteria 1186
589 Ga0495672_0000925 3300047320 Bacteria 30689
590 Ga0495672_0024321 3300047320 Bacteria 3904
591 Ga0495672_0097859 3300047320 Bacteria 1597
592 Ga0495672_0339837 3300047320 Bacteria 700
593 Ga0495673_0000415 3300047469 Bacteria 49621
594 Ga0495673_0001846 3300047469 Bacteria 15895
595 Ga0496100_0001021 3300048903 Bacteria 13521
596 Ga0496100_0192154 3300048903 Bacteria 1483
597 Ga0496100_0207568 3300048903 Bacteria 1431
598 Ga0496100_1255226 3300048903 Bacteria 585
599 Ga0496100_1412612 3300048903 Bacteria 549
600 Ga0496101_0000011 3300048904 Bacteria 272153
601 Ga0496101_0071482 3300048904 Bacteria 2544
602 Ga0496101_0291028 3300048904 Bacteria 1278
603 Ga0496102_0000012 3300048905 Bacteria 315470
604 Ga0496102_0000249 3300048905 Bacteria 70385
605 Ga0496102_0036339 3300048905 Bacteria 4437
606 Ga0496102_0153117 3300048905 Bacteria 2167
607 Ga0496102_0179542 3300048905 Bacteria 1994
608 Ga0496102_0209834 3300048905 Bacteria 1836
609 Ga0496102_0646540 3300048905 Bacteria 981
610 Ga0496102_0907989 3300048905 Bacteria 802
611 Ga0496102_0946435 3300048905 Bacteria 782
612 Ga0496103_0000005 3300048906 Bacteria 505416
613 Ga0496103_0001363 3300048906 Bacteria 16471
614 Ga0496103_0056628 3300048906 Bacteria 2434
615 Ga0496103_0355875 3300048906 Bacteria 941
616 Ga0496103_0457527 3300048906 Bacteria 818
617 Ga0496103_0519298 3300048906 Bacteria 761
618 Ga0496103_0641771 3300048906 Bacteria 675
619 Ga0496103_0902954 3300048906 Bacteria 553
620 Ga0496104_0170499 3300048907 Bacteria 2087
621 Ga0496104_1133772 3300048907 Bacteria 685
622 Ga0496104_1495793 3300048907 Bacteria 578
623 Ga0496105_0052394 3300048908 Bacteria 3371
624 Ga0496105_0095795 3300048908 Bacteria 2451
625 Ga0496106_0166453 3300048909 Bacteria 1745
626 Ga0496106_0167231 3300048909 Bacteria 1741
627 Ga0496106_0203933 3300048909 Bacteria 1574
628 Ga0496107_0062985 3300048910 Bacteria 2687
629 Ga0496107_0090819 3300048910 Bacteria 2231
630 Ga0496107_0535528 3300048910 Unclassified 868
631 Ga0496107_0930496 3300048910 Bacteria 633
632 Ga0496107_1265927 3300048910 Bacteria 528
633 Ga0496108_0000197 3300048911 Bacteria 55651
634 Ga0496108_0007333 3300048911 Bacteria 8938
635 Ga0496108_0045722 3300048911 Bacteria 3657
636 Ga0496108_0066726 3300048911 Bacteria 3035
637 Ga0496108_0247975 3300048911 Bacteria 1549
638 Ga0496109_0010390 3300048912 Bacteria 7949
639 Ga0496109_0058782 3300048912 Bacteria 3512
640 Ga0496109_0090488 3300048912 Bacteria 2830
641 Ga0496109_0101156 3300048912 Bacteria 2675
642 Ga0496109_0219624 3300048912 Bacteria 1787
643 Ga0496109_0434335 3300048912 Bacteria 1240
644 Ga0496109_1723233 3300048912 Bacteria 560
645 Ga0496110_0059967 3300048913 Bacteria 3355
646 Ga0496110_0074128 3300048913 Bacteria 3022
647 Ga0496110_0205623 3300048913 Bacteria 1789
648 Ga0496110_0245260 3300048913 Unclassified 1630
649 Ga0496111_0137824 3300048914 Bacteria 1808
650 Ga0496111_0176634 3300048914 Bacteria 1587
651 Ga0496111_0468911 3300048914 Bacteria 928
652 Ga0496111_1338731 3300048914 Bacteria 503
653 Ga0496112_0010567 3300048915 Bacteria 8384
654 Ga0496112_0015977 3300048915 Bacteria 7017
655 Ga0496112_0057875 3300048915 Bacteria 3817
656 Ga0496112_0162551 3300048915 Bacteria 2199
657 Ga0496113_0024769 3300048916 Bacteria 4271
658 Ga0496113_0035734 3300048916 Bacteria 3636
659 Ga0496113_0120716 3300048916 Bacteria 2049
660 Ga0496113_0906694 3300048916 Bacteria 697
661 Ga0496114_0135050 3300048917 Bacteria 2133
662 Ga0496114_0258801 3300048917 Bacteria 1532
663 Ga0496114_0320743 3300048917 Bacteria 1369
664 Ga0496114_1218025 3300048917 Bacteria 639
665 Ga0496115_0538140 3300048918 Bacteria 935
666 Ga0496116_0000050 3300048919 Bacteria 311670
667 Ga0496116_0009418 3300048919 Bacteria 8325
668 Ga0496117_0000042 3300048920 Bacteria 315470
669 Ga0496117_0001361 3300048920 Bacteria 35650
670 Ga0496118_0000037 3300048921 Bacteria 315470
671 Ga0496118_0000927 3300048921 Bacteria 45822
672 Ga0496119_0000755 3300048922 Bacteria 43406
673 Ga0496119_0007047 3300048922 Bacteria 10229
674 Ga0496119_0192761 3300048922 Bacteria 1061
675 Ga0496120_0000449 3300048923 Bacteria 65290
676 Ga0496120_0075396 3300048923 Bacteria 1841
677 Ga0496121_0000039 3300048924 Bacteria 351444
678 Ga0496121_0002149 3300048924 Bacteria 30900
679 Ga0496124_0054793 3300048927 Bacteria 3373
680 Ga0496124_0968036 3300048927 Bacteria 510
681 Ga0496125_0040332 3300048928 Bacteria 4007
682 Ga0496126_0009543 3300048929 Bacteria 10295
683 Ga0496126_0052637 3300048929 Bacteria 3698
684 Ga0496126_0625818 3300048929 Bacteria 845
685 Ga0501034_0286511 3300049571 Bacteria 1586
686 nmdc:mga03683_236302_c1 3300050489 Bacteria 846
687 nmdc:mga03683_313190_c1 3300050489 Bacteria 738
688 nmdc:mga03683_83802_c1 3300050489 Bacteria 1381
689 nmdc:mga03n38_154777_c1 3300050490 Bacteria 1156
690 nmdc:mga03n38_177985_c1 3300050490 Bacteria 1088
691 nmdc:mga03n38_18508_c1 3300050490 Bacteria 2751
692 nmdc:mga03n38_21851_c1 3300050490 Unclassified 2581
693 nmdc:mga03n38_243415_c1 3300050490 Bacteria 947
694 nmdc:mga03n38_253747_c1 3300050490 Bacteria 930
695 nmdc:mga03n38_426640_c1 3300050490 Bacteria 734
696 nmdc:mga03n38_530643_c1 3300050490 Bacteria 664
697 nmdc:mga03n38_53247_c1 3300050490 Bacteria 1814
698 nmdc:mga03n38_694151_c1 3300050490 Bacteria 586
699 nmdc:mga03n38_86221_c1 3300050490 Bacteria 1486
700 nmdc:mga03n38_883599_c1 3300050490 Bacteria 524
701 nmdc:mga00v17_116301_c1 3300050491 Bacteria 1700
702 nmdc:mga00v17_153246_c1 3300050491 Bacteria 1481
703 nmdc:mga00v17_219045_c1 3300050491 Bacteria 1232
704 nmdc:mga00v17_220525_c1 3300050491 Bacteria 1228
705 nmdc:mga00v17_28673_c2 3300050491 Bacteria 584
706 nmdc:mga00v17_2935_c1 3300050491 Bacteria 8746
707 nmdc:mga00v17_396272_c1 3300050491 Bacteria 897
708 nmdc:mga00v17_451593_c1 3300050491 Unclassified 834
709 nmdc:mga00v17_554942_c1 3300050491 Bacteria 743
710 nmdc:mga00v17_7006_c1 3300050491 Bacteria 6001
711 nmdc:mga00v17_75146_c1 3300050491 Bacteria 2100
712 nmdc:mga0yw44_18493_c1 3300050492 Bacteria 3819
713 nmdc:mga0yw44_296286_c1 3300050492 Bacteria 1083
714 nmdc:mga0yw44_5046_c2 3300050492 Bacteria 5696
715 nmdc:mga0yw44_55405_c1 3300050492 Bacteria 2412
716 nmdc:mga06z11_20547_c1 3300050494 Bacteria 3053
717 nmdc:mga06z11_56892_c1 3300050494 Bacteria 2024
718 nmdc:mga04h51_105346_c1 3300050495 Bacteria 1033
719 nmdc:mga04h51_115475_c1 3300050495 Bacteria 994
720 nmdc:mga07m45_19884_c1 3300050496 Bacteria 3642
721 nmdc:mga07m45_343383_c1 3300050496 Bacteria 867
722 nmdc:mga07m45_365975_c1 3300050496 Bacteria 838
723 nmdc:mga07m45_41866_c1 3300050496 Bacteria 2566
724 nmdc:mga07m45_622518_c1 3300050496 Bacteria 623
725 nmdc:mga05p37_49451_c1 3300050507 Bacteria 5171
726 nmdc:mga0qj67_15786_c1 3300050509 Bacteria 5720
727 nmdc:mga06r32_22714_c1 3300050510 Bacteria 5801
728 nmdc:mga0rr50_1629683_c1 3300050513 Bacteria 544
729 nmdc:mga0sz30_12709_c1 3300050516 Bacteria 3280
730 nmdc:mga0sz30_15354_c1 3300050516 Bacteria 3025
731 nmdc:mga0sz30_18015_c1 3300050516 Bacteria 2822
732 nmdc:mga0sz30_22431_c1 3300050516 Bacteria 2562
733 nmdc:mga0sz30_24933_c1 3300050516 Bacteria 2444
734 nmdc:mga0sz30_253975_c1 3300050516 Bacteria 783
735 nmdc:mga0sz30_392457_c1 3300050516 Bacteria 621
736 nmdc:mga0sz30_57596_c1 3300050516 Bacteria 1656
737 nmdc:mga0sz30_64448_c1 3300050516 Bacteria 1570
738 nmdc:mga0sz30_82333_c1 3300050516 Bacteria 1393
739 Ga0500610_0003254 3300053079 Bacteria 6193
740 Ga0500635_0042756 3300053080 Bacteria 1521
741 Ga0495655_0171204 3300053083 Unclassified 695
742 Ga0500643_033189 3300053087 Bacteria 1562
743 Ga0500650_0189011 3300053098 Bacteria 941
744 Ga0500562_014843 3300053108 Bacteria 1996
745 Ga0500595_070257 3300053119 Bacteria 1040
746 Ga0500608_123746 3300053122 Bacteria 1169
747 Ga0500652_000825 3300053131 Bacteria 10314
748 Ga0500559_0062490 3300053136 Bacteria 1663
749 Ga0500616_0007498 3300053153 Bacteria 6919
750 Ga0500616_0163851 3300053153 Bacteria 1017
751 Ga0500645_003171 3300053730 Bacteria 6833
752 Ga0466962_0004026 3300061719 Bacteria 7039

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006048 Ga0075363_100083362 Ga0075363_1000833623 67
2 3300050491 nmdc:mga00v17_28673_c2 nmdc:mga00v17_28673_c2_237_476 67
3 3300050516 nmdc:mga0sz30_82333_c1 nmdc:mga0sz30_82333_c1_100_339 67
4 iso_pu_bacteria 2738541274 2738705265 70
5 iso_pu_bacteria 2738543028 2739334829 70
6 iso_pu_bacteria 2902792274 2902795968 70
7 3300037418 Ga0395900_0966063 Ga0395900_0966063_501_743 71
8 3300038443 Ga0395901_0655982 Ga0395901_0655982_584_826 71
9 3300002067 JGI24735J21928_10129938 JGI24735J21928_101299382 74
10 3300002067 JGI24735J21928_10184276 JGI24735J21928_101842762 74
11 3300003792 Ga0055540_1001650 Ga0055540_100165013 74
12 3300005347 Ga0070668_100002358 Ga0070668_1000023586 74
13 3300005455 Ga0070663_100057743 Ga0070663_1000577433 74
14 3300005455 Ga0070663_100854576 Ga0070663_1008545762 74
15 3300005455 Ga0070663_101421134 Ga0070663_1014211342 74
16 3300005456 Ga0070678_100190628 Ga0070678_1001906282 74
17 3300005539 Ga0068853_100980330 Ga0068853_1009803302 74
18 3300005539 Ga0068853_101746773 Ga0068853_1017467731 74
19 3300005563 Ga0068855_100170863 Ga0068855_1001708632 74
20 3300005937 Ga0081455_10003543 Ga0081455_1000354310 74
21 3300006038 Ga0075365_10011898 Ga0075365_100118985 74
22 3300006038 Ga0075365_10054882 Ga0075365_100548822 74
23 3300006042 Ga0075368_10110118 Ga0075368_101101181 74
24 3300006048 Ga0075363_100000299 Ga0075363_10000029917 74
25 3300006051 Ga0075364_10053276 Ga0075364_100532764 74
26 3300006051 Ga0075364_10207886 Ga0075364_102078862 74
27 3300006051 Ga0075364_10537672 Ga0075364_105376722 74
28 3300006178 Ga0075367_10178029 Ga0075367_101780292 74
29 3300006186 Ga0075369_10011210 Ga0075369_100112105 74
30 3300006186 Ga0075369_10026164 Ga0075369_100261642 74
31 3300006353 Ga0075370_10022387 Ga0075370_100223872 74
32 3300006353 Ga0075370_10056732 Ga0075370_100567322 74
33 3300006358 Ga0068871_101396061 Ga0068871_1013960612 74
34 3300007076 Ga0075435_101367395 Ga0075435_1013673952 74
35 3300009092 Ga0105250_10044712 Ga0105250_100447123 74
36 3300009098 Ga0105245_10095749 Ga0105245_100957492 74
37 3300009098 Ga0105245_11221514 Ga0105245_112215142 74
38 3300009098 Ga0105245_12888953 Ga0105245_128889531 74
39 3300009101 Ga0105247_10093297 Ga0105247_100932973 74
40 3300009101 Ga0105247_10313929 Ga0105247_103139292 74
41 3300009148 Ga0105243_10079971 Ga0105243_100799713 74
42 3300009174 Ga0105241_10453177 Ga0105241_104531772 74
43 3300009174 Ga0105241_10463618 Ga0105241_104636181 74
44 3300009176 Ga0105242_11355716 Ga0105242_113557162 74
45 3300009177 Ga0105248_10285302 Ga0105248_102853023 74
46 3300009545 Ga0105237_10000298 Ga0105237_1000029824 74
47 3300009545 Ga0105237_10510301 Ga0105237_105103012 74
48 3300009551 Ga0105238_11542450 Ga0105238_115424501 74
49 3300009553 Ga0105249_10364715 Ga0105249_103647151 74
50 3300009553 Ga0105249_11923220 Ga0105249_119232202 74
51 3300009553 Ga0105249_12233177 Ga0105249_122331772 74
52 3300010159 Ga0099796_10002388 Ga0099796_100023885 74
53 3300010375 Ga0105239_10014559 Ga0105239_100145595 74
54 3300010375 Ga0105239_10167329 Ga0105239_101673292 74
55 3300010375 Ga0105239_10716213 Ga0105239_107162132 74
56 3300010375 Ga0105239_11693071 Ga0105239_116930711 74
57 3300011119 Ga0105246_10141333 Ga0105246_101413333 74
58 3300011119 Ga0105246_10643320 Ga0105246_106433202 74
59 3300013105 Ga0157369_11221771 Ga0157369_112217712 74
60 3300013296 Ga0157374_10024493 Ga0157374_100244934 74
61 3300013297 Ga0157378_10117035 Ga0157378_101170352 74
62 3300013297 Ga0157378_10574035 Ga0157378_105740353 74
63 3300013306 Ga0163162_10121870 Ga0163162_101218703 74
64 3300013306 Ga0163162_10148122 Ga0163162_101481222 74
65 3300013306 Ga0163162_10527983 Ga0163162_105279831 74
66 3300013306 Ga0163162_10578213 Ga0163162_105782132 74
67 3300013306 Ga0163162_11767812 Ga0163162_117678121 74
68 3300013307 Ga0157372_10401058 Ga0157372_104010583 74
69 3300013308 Ga0157375_11743126 Ga0157375_117431262 74
70 3300013308 Ga0157375_12373302 Ga0157375_123733022 74
71 3300013308 Ga0157375_12403266 Ga0157375_124032662 74
72 3300013308 Ga0157375_12680351 Ga0157375_126803512 74
73 3300014325 Ga0163163_10140332 Ga0163163_101403323 74
74 3300014325 Ga0163163_10329443 Ga0163163_103294433 74
75 3300014745 Ga0157377_11071747 Ga0157377_110717472 74
76 3300014968 Ga0157379_11516810 Ga0157379_115168102 74
77 3300014969 Ga0157376_10138643 Ga0157376_101386434 74
78 3300025273 Ga0209673_1035110 Ga0209673_10351102 74
79 3300025303 Ga0209051_1048851 Ga0209051_10488512 74
80 3300025901 Ga0207688_10198166 Ga0207688_101981662 74
81 3300025914 Ga0207671_10031318 Ga0207671_100313186 74
82 3300025914 Ga0207671_10382691 Ga0207671_103826912 74
83 3300025924 Ga0207694_10322496 Ga0207694_103224962 74
84 3300025942 Ga0207689_11405343 Ga0207689_114053432 74
85 3300025949 Ga0207667_10127086 Ga0207667_101270863 74
86 3300026041 Ga0207639_11690972 Ga0207639_116909721 74
87 3300026067 Ga0207678_10890315 Ga0207678_108903152 74
88 3300031548 Ga0307408_100528655 Ga0307408_1005286552 74
89 3300031852 Ga0307410_10621846 Ga0307410_106218462 74
90 3300031903 Ga0307407_10226499 Ga0307407_102264992 74
91 3300031995 Ga0307409_100300178 Ga0307409_1003001782 74
92 3300032004 Ga0307414_11980000 Ga0307414_119800001 74
93 3300032126 Ga0307415_100638483 Ga0307415_1006384832 74
94 3300035092 Ga0373952_0041191 Ga0373952_0041191_793_1017 74
95 3300035241 Ga0373961_0103094 Ga0373961_0103094_621_845 74
96 3300035691 Ga0373931_0068314 Ga0373931_0068314_733_957 74
97 3300041410 Ga0439461_0007215 Ga0439461_0007215_1543_1767 74
98 3300041411 Ga0439466_0005285 Ga0439466_0005285_3081_3305 74
99 3300041413 Ga0439465_0003190 Ga0439465_0003190_2538_2762 74
100 3300041413 Ga0439465_0055975 Ga0439465_0055975_552_776 74
101 3300041443 Ga0451789_1297938 Ga0451789_1297938_240_464 74
102 3300041452 Ga0451793_0577225 Ga0451793_0577225_276_500 74
103 3300041452 Ga0451793_1717196 Ga0451793_1717196_186_410 74
104 3300041453 Ga0451797_0981697 Ga0451797_0981697_86_310 74
105 3300041459 Ga0451800_0729937 Ga0451800_0729937_27_251 74
106 3300041486 Ga0451807_1614344 Ga0451807_1614344_63_287 74
107 3300041492 Ga0451835_0309573 Ga0451835_0309573_128_352 74
108 3300042002 Ga0439442_128287 Ga0439442_128287_60_284 74
109 3300044656 Ga0466969_0185173 Ga0466969_0185173_450_674 74
110 3300044658 Ga0466972_0010268 Ga0466972_0010268_2232_2456 74
111 3300044683 Ga0466965_0006386 Ga0466965_0006386_867_1091 74
112 3300044684 Ga0466966_0023563 Ga0466966_0023563_3323_3547 74
113 3300044693 Ga0466961_0006454 Ga0466961_0006454_5619_5843 74
114 3300044706 Ga0466964_0076373 Ga0466964_0076373_739_963 74
115 3300044719 Ga0466971_0030262 Ga0466971_0030262_1737_1961 74
116 3300044735 Ga0466968_0009863 Ga0466968_0009863_1962_2186 74
117 3300044765 Ga0466970_0007492 Ga0466970_0007492_111_335 74
118 3300044842 Ga0466957_0049294 Ga0466957_0049294_1832_2056 74
119 3300045049 Ga0466959_0050117 Ga0466959_0050117_450_674 74
120 3300045836 Ga0466958_0006130 Ga0466958_0006130_2057_2281 74
121 3300045976 Ga0466967_1544000 Ga0466967_1544000_328_552 74
122 3300046506 Ga0495583_0095284 Ga0495583_0095284_57_281 74
123 3300046524 Ga0495648_0006425 Ga0495648_0006425_9168_9392 74
124 3300046528 Ga0495642_0168809 Ga0495642_0168809_684_908 74
125 3300046533 Ga0495640_0904555 Ga0495640_0904555_30_254 74
126 3300046616 Ga0495668_0017692 Ga0495668_0017692_1918_2142 74
127 3300046616 Ga0495668_0366791 Ga0495668_0366791_249_473 74
128 3300046663 Ga0495635_0368996 Ga0495635_0368996_523_747 74
129 3300047320 Ga0495672_0000925 Ga0495672_0000925_1474_1698 74
130 3300047469 Ga0495673_0000415 Ga0495673_0000415_13458_13682 74
131 3300048903 Ga0496100_0001021 Ga0496100_0001021_7875_8099 74
132 3300048903 Ga0496100_0192154 Ga0496100_0192154_253_477 74
133 3300048903 Ga0496100_1412612 Ga0496100_1412612_55_279 74
134 3300048904 Ga0496101_0000011 Ga0496101_0000011_259377_259601 74
135 3300048904 Ga0496101_0071482 Ga0496101_0071482_1318_1542 74
136 3300048904 Ga0496101_0291028 Ga0496101_0291028_14_238 74
137 3300048905 Ga0496102_0000012 Ga0496102_0000012_43759_43983 74
138 3300048905 Ga0496102_0000249 Ga0496102_0000249_22846_23070 74
139 3300048905 Ga0496102_0179542 Ga0496102_0179542_679_903 74
140 3300048905 Ga0496102_0646540 Ga0496102_0646540_415_639 74
141 3300048905 Ga0496102_0907989 Ga0496102_0907989_543_767 74
142 3300048905 Ga0496102_0946435 Ga0496102_0946435_197_421 74
143 3300048906 Ga0496103_0000005 Ga0496103_0000005_271480_271704 74
144 3300048906 Ga0496103_0001363 Ga0496103_0001363_9561_9785 74
145 3300048906 Ga0496103_0056628 Ga0496103_0056628_283_507 74
146 3300048906 Ga0496103_0457527 Ga0496103_0457527_214_438 74
147 3300048906 Ga0496103_0902954 Ga0496103_0902954_115_339 74
148 3300048908 Ga0496105_0095795 Ga0496105_0095795_261_485 74
149 3300048909 Ga0496106_0166453 Ga0496106_0166453_1506_1730 74
150 3300048909 Ga0496106_0167231 Ga0496106_0167231_277_501 74
151 3300048910 Ga0496107_0062985 Ga0496107_0062985_1152_1376 74
152 3300048910 Ga0496107_0535528 Ga0496107_0535528_389_613 74
153 3300048910 Ga0496107_1265927 Ga0496107_1265927_256_480 74
154 3300048911 Ga0496108_0000197 Ga0496108_0000197_43351_43575 74
155 3300048911 Ga0496108_0007333 Ga0496108_0007333_5770_5994 74
156 3300048912 Ga0496109_0010390 Ga0496109_0010390_333_557 74
157 3300048912 Ga0496109_0219624 Ga0496109_0219624_1079_1303 74
158 3300048913 Ga0496110_0074128 Ga0496110_0074128_170_394 74
159 3300048914 Ga0496111_1338731 Ga0496111_1338731_217_441 74
160 3300048915 Ga0496112_0010567 Ga0496112_0010567_2495_2719 74
161 3300048915 Ga0496112_0162551 Ga0496112_0162551_1822_2046 74
162 3300048916 Ga0496113_0024769 Ga0496113_0024769_2989_3213 74
163 3300048916 Ga0496113_0035734 Ga0496113_0035734_1440_1664 74
164 3300048917 Ga0496114_0135050 Ga0496114_0135050_596_820 74
165 3300048917 Ga0496114_0258801 Ga0496114_0258801_965_1189 74
166 3300048919 Ga0496116_0000050 Ga0496116_0000050_39980_40204 74
167 3300048919 Ga0496116_0009418 Ga0496116_0009418_6147_6371 74
168 3300048920 Ga0496117_0000042 Ga0496117_0000042_271488_271712 74
169 3300048920 Ga0496117_0001361 Ga0496117_0001361_25618_25842 74
170 3300048921 Ga0496118_0000037 Ga0496118_0000037_271488_271712 74
171 3300048921 Ga0496118_0000927 Ga0496118_0000927_6437_6661 74
172 3300048922 Ga0496119_0000755 Ga0496119_0000755_39261_39485 74
173 3300048922 Ga0496119_0007047 Ga0496119_0007047_8577_8801 74
174 3300048923 Ga0496120_0000449 Ga0496120_0000449_25806_26030 74
175 3300048923 Ga0496120_0075396 Ga0496120_0075396_1188_1412 74
176 3300048924 Ga0496121_0000039 Ga0496121_0000039_297378_297602 74
177 3300048924 Ga0496121_0002149 Ga0496121_0002149_20957_21181 74
178 3300048927 Ga0496124_0054793 Ga0496124_0054793_2874_3098 74
179 3300048927 Ga0496124_0968036 Ga0496124_0968036_30_254 74
180 3300048928 Ga0496125_0040332 Ga0496125_0040332_3184_3408 74
181 3300048929 Ga0496126_0009543 Ga0496126_0009543_4907_5131 74
182 3300048929 Ga0496126_0052637 Ga0496126_0052637_494_718 74
183 3300050489 nmdc:mga03683_313190_c1 nmdc:mga03683_313190_c1_161_385 74
184 3300050489 nmdc:mga03683_83802_c1 nmdc:mga03683_83802_c1_532_756 74
185 3300050490 nmdc:mga03n38_18508_c1 nmdc:mga03n38_18508_c1_2273_2497 74
186 3300050490 nmdc:mga03n38_21851_c1 nmdc:mga03n38_21851_c1_1585_1809 74
187 3300050490 nmdc:mga03n38_243415_c1 nmdc:mga03n38_243415_c1_383_607 74
188 3300050490 nmdc:mga03n38_86221_c1 nmdc:mga03n38_86221_c1_410_634 74
189 3300050491 nmdc:mga00v17_220525_c1 nmdc:mga00v17_220525_c1_390_614 74
190 3300050491 nmdc:mga00v17_2935_c1 nmdc:mga00v17_2935_c1_653_877 74
191 3300050491 nmdc:mga00v17_451593_c1 nmdc:mga00v17_451593_c1_403_627 74
192 3300050491 nmdc:mga00v17_7006_c1 nmdc:mga00v17_7006_c1_4392_4616 74
193 3300050492 nmdc:mga0yw44_296286_c1 nmdc:mga0yw44_296286_c1_255_479 74
194 3300050492 nmdc:mga0yw44_5046_c2 nmdc:mga0yw44_5046_c2_2225_2449 74
195 3300050492 nmdc:mga0yw44_55405_c1 nmdc:mga0yw44_55405_c1_657_881 74
196 3300050494 nmdc:mga06z11_56892_c1 nmdc:mga06z11_56892_c1_168_392 74
197 3300050495 nmdc:mga04h51_105346_c1 nmdc:mga04h51_105346_c1_745_969 74
198 3300050496 nmdc:mga07m45_343383_c1 nmdc:mga07m45_343383_c1_468_692 74
199 3300050496 nmdc:mga07m45_365975_c1 nmdc:mga07m45_365975_c1_333_557 74
200 3300050513 nmdc:mga0rr50_1629683_c1 nmdc:mga0rr50_1629683_c1_58_282 74
201 3300050516 nmdc:mga0sz30_12709_c1 nmdc:mga0sz30_12709_c1_728_952 74
202 3300050516 nmdc:mga0sz30_18015_c1 nmdc:mga0sz30_18015_c1_1589_1813 74
203 3300050516 nmdc:mga0sz30_24933_c1 nmdc:mga0sz30_24933_c1_1656_1880 74
204 3300050516 nmdc:mga0sz30_57596_c1 nmdc:mga0sz30_57596_c1_143_367 74
205 3300050516 nmdc:mga0sz30_64448_c1 nmdc:mga0sz30_64448_c1_1149_1373 74
206 3300053079 Ga0500610_0003254 Ga0500610_0003254_3249_3473 74
207 3300053080 Ga0500635_0042756 Ga0500635_0042756_472_696 74
208 3300053083 Ga0495655_0171204 Ga0495655_0171204_360_584 74
209 3300053087 Ga0500643_033189 Ga0500643_033189_786_1010 74
210 3300053098 Ga0500650_0189011 Ga0500650_0189011_486_710 74
211 3300053119 Ga0500595_070257 Ga0500595_070257_423_647 74
212 3300053122 Ga0500608_123746 Ga0500608_123746_584_808 74
213 3300053131 Ga0500652_000825 Ga0500652_000825_7478_7702 74
214 3300053136 Ga0500559_0062490 Ga0500559_0062490_1127_1351 74
215 3300053153 Ga0500616_0007498 Ga0500616_0007498_4497_4721 74
216 3300053730 Ga0500645_003171 Ga0500645_003171_2523_2747 74
217 3300061719 Ga0466962_0004026 Ga0466962_0004026_1482_1706 74
218 3300005981 Ga0081538_10238976 Ga0081538_102389762 75
219 3300031733 Ga0316577_10316910 Ga0316577_103169101 75
220 3300031995 Ga0307409_101419491 Ga0307409_1014194912 75
221 3300033179 Ga0307507_10114224 Ga0307507_101142242 75
222 3300036712 Ga0316584_0186137 Ga0316584_0186137_547_783 75
223 iso_pu_bacteria 2643221715 2644634181 75
224 iso_pu_bacteria 2902810491 2902810547 75
225 3300002070 JGI24750J21931_1023575 JGI24750J21931_10235752 77
226 3300002239 JGI24034J26672_10004458 JGI24034J26672_100044583 77
227 3300005347 Ga0070668_100061829 Ga0070668_1000618293 77
228 3300005347 Ga0070668_101996864 Ga0070668_1019968642 77
229 3300005355 Ga0070671_100124174 Ga0070671_1001241743 77
230 3300005367 Ga0070667_100024671 Ga0070667_1000246714 77
231 3300005467 Ga0070706_100015125 Ga0070706_1000151257 77
232 3300005468 Ga0070707_100120284 Ga0070707_1001202844 77
233 3300005471 Ga0070698_100172088 Ga0070698_1001720884 77
234 3300005518 Ga0070699_100007861 Ga0070699_1000078614 77
235 3300005536 Ga0070697_100079472 Ga0070697_1000794724 77
236 3300005544 Ga0070686_100671204 Ga0070686_1006712041 77
237 3300005617 Ga0068859_101655862 Ga0068859_1016558621 77
238 3300005719 Ga0068861_100126170 Ga0068861_1001261704 77
239 3300005841 Ga0068863_100599913 Ga0068863_1005999131 77
240 3300005843 Ga0068860_100385733 Ga0068860_1003857332 77
241 3300005844 Ga0068862_101029497 Ga0068862_1010294972 77
242 3300005937 Ga0081455_10023525 Ga0081455_100235253 77
243 3300006028 Ga0070717_10009317 Ga0070717_100093177 77
244 3300006186 Ga0075369_10341736 Ga0075369_103417361 77
245 3300006931 Ga0097620_101656152 Ga0097620_1016561521 77
246 3300009092 Ga0105250_10019823 Ga0105250_100198235 77
247 3300009553 Ga0105249_10036484 Ga0105249_100364848 77
248 3300025711 Ga0207696_1108187 Ga0207696_11081872 77
249 3300025901 Ga0207688_10598276 Ga0207688_105982762 77
250 3300025910 Ga0207684_10086662 Ga0207684_100866622 77
251 3300025922 Ga0207646_10126872 Ga0207646_101268721 77
252 3300025931 Ga0207644_10176865 Ga0207644_101768652 77
253 3300025961 Ga0207712_10570986 Ga0207712_105709862 77
254 3300026088 Ga0207641_10043028 Ga0207641_100430285 77
255 3300026118 Ga0207675_100145242 Ga0207675_1001452422 77
256 3300028380 Ga0268265_10289879 Ga0268265_102898793 77
257 3300031824 Ga0307413_10203923 Ga0307413_102039233 77
258 3300031852 Ga0307410_10101672 Ga0307410_101016722 77
259 3300031852 Ga0307410_10320166 Ga0307410_103201663 77
260 3300031889 Ga0326468_10036814 Ga0326468_100368143 77
261 3300031903 Ga0307407_10015163 Ga0307407_100151632 77
262 3300031903 Ga0307407_11547461 Ga0307407_115474611 77
263 3300031911 Ga0307412_10683970 Ga0307412_106839702 77
264 3300031995 Ga0307409_100176711 Ga0307409_1001767111 77
265 3300032002 Ga0307416_100383010 Ga0307416_1003830103 77
266 3300032126 Ga0307415_100179571 Ga0307415_1001795712 77
267 3300041410 Ga0439461_0050607 Ga0439461_0050607_149_388 77
268 3300041411 Ga0439466_0064683 Ga0439466_0064683_528_767 77
269 3300041413 Ga0439465_0015134 Ga0439465_0015134_1904_2143 77
270 3300041997 Ga0439431_0073619 Ga0439431_0073619_415_654 77
271 3300042004 Ga0439445_0073051 Ga0439445_0073051_55_294 77
272 3300048906 Ga0496103_0641771 Ga0496103_0641771_364_603 77
273 3300048911 Ga0496108_0045722 Ga0496108_0045722_1735_1974 77
274 3300048912 Ga0496109_0090488 Ga0496109_0090488_94_333 77
275 3300048914 Ga0496111_0468911 Ga0496111_0468911_137_376 77
276 3300048915 Ga0496112_0015977 Ga0496112_0015977_461_700 77
277 3300048916 Ga0496113_0120716 Ga0496113_0120716_724_963 77
278 3300002067 JGI24735J21928_10172605 JGI24735J21928_101726052 78
279 3300002239 JGI24034J26672_10114638 JGI24034J26672_101146381 78
280 3300002244 JGI24742J22300_10068884 JGI24742J22300_100688841 78
281 3300005289 Ga0065704_10414286 Ga0065704_104142861 78
282 3300005330 Ga0070690_100487282 Ga0070690_1004872822 78
283 3300005331 Ga0070670_100048485 Ga0070670_1000484854 78
284 3300005334 Ga0068869_100181551 Ga0068869_1001815513 78
285 3300005335 Ga0070666_10697788 Ga0070666_106977882 78
286 3300005337 Ga0070682_100003990 Ga0070682_1000039909 78
287 3300005337 Ga0070682_101528546 Ga0070682_1015285461 78
288 3300005338 Ga0068868_100298665 Ga0068868_1002986653 78
289 3300005340 Ga0070689_100292911 Ga0070689_1002929113 78
290 3300005341 Ga0070691_10163501 Ga0070691_101635012 78
291 3300005344 Ga0070661_101140799 Ga0070661_1011407992 78
292 3300005345 Ga0070692_10554904 Ga0070692_105549042 78
293 3300005347 Ga0070668_100011959 Ga0070668_1000119593 78
294 3300005353 Ga0070669_100000585 Ga0070669_10000058516 78
295 3300005355 Ga0070671_100004637 Ga0070671_10000463713 78
296 3300005355 Ga0070671_100341920 Ga0070671_1003419203 78
297 3300005355 Ga0070671_100637582 Ga0070671_1006375822 78
298 3300005356 Ga0070674_100045623 Ga0070674_1000456235 78
299 3300005356 Ga0070674_101424652 Ga0070674_1014246521 78
300 3300005365 Ga0070688_100507032 Ga0070688_1005070322 78
301 3300005366 Ga0070659_100325107 Ga0070659_1003251072 78
302 3300005367 Ga0070667_100000033 Ga0070667_10000003344 78
303 3300005367 Ga0070667_100195203 Ga0070667_1001952033 78
304 3300005367 Ga0070667_100223944 Ga0070667_1002239443 78
305 3300005437 Ga0070710_10180346 Ga0070710_101803463 78
306 3300005438 Ga0070701_10369253 Ga0070701_103692532 78
307 3300005439 Ga0070711_100508055 Ga0070711_1005080551 78
308 3300005440 Ga0070705_100140614 Ga0070705_1001406142 78
309 3300005441 Ga0070700_101527401 Ga0070700_1015274012 78
310 3300005444 Ga0070694_100374454 Ga0070694_1003744542 78
311 3300005445 Ga0070708_100022132 Ga0070708_1000221326 78
312 3300005456 Ga0070678_100043294 Ga0070678_1000432942 78
313 3300005467 Ga0070706_100073183 Ga0070706_1000731834 78
314 3300005468 Ga0070707_100007233 Ga0070707_1000072336 78
315 3300005471 Ga0070698_100048472 Ga0070698_1000484727 78
316 3300005518 Ga0070699_100069585 Ga0070699_1000695854 78
317 3300005535 Ga0070684_100527954 Ga0070684_1005279542 78
318 3300005539 Ga0068853_100056314 Ga0068853_1000563146 78
319 3300005544 Ga0070686_101549076 Ga0070686_1015490761 78
320 3300005545 Ga0070695_100158148 Ga0070695_1001581483 78
321 3300005546 Ga0070696_100167006 Ga0070696_1001670062 78
322 3300005547 Ga0070693_100083170 Ga0070693_1000831703 78
323 3300005548 Ga0070665_100003448 Ga0070665_10000344812 78
324 3300005548 Ga0070665_100012289 Ga0070665_1000122896 78
325 3300005548 Ga0070665_100739826 Ga0070665_1007398262 78
326 3300005548 Ga0070665_101537949 Ga0070665_1015379491 78
327 3300005549 Ga0070704_100296291 Ga0070704_1002962913 78
328 3300005578 Ga0068854_100061794 Ga0068854_1000617943 78
329 3300005578 Ga0068854_100127770 Ga0068854_1001277703 78
330 3300005614 Ga0068856_100119856 Ga0068856_1001198562 78
331 3300005615 Ga0070702_100214242 Ga0070702_1002142423 78
332 3300005615 Ga0070702_100465749 Ga0070702_1004657492 78
333 3300005616 Ga0068852_100288167 Ga0068852_1002881672 78
334 3300005616 Ga0068852_101140323 Ga0068852_1011403232 78
335 3300005617 Ga0068859_100004951 Ga0068859_10000495114 78
336 3300005617 Ga0068859_100391310 Ga0068859_1003913102 78
337 3300005617 Ga0068859_100669230 Ga0068859_1006692303 78
338 3300005618 Ga0068864_102243308 Ga0068864_1022433082 78
339 3300005618 Ga0068864_102375773 Ga0068864_1023757731 78
340 3300005718 Ga0068866_10040171 Ga0068866_100401713 78
341 3300005719 Ga0068861_100142389 Ga0068861_1001423893 78
342 3300005719 Ga0068861_100988208 Ga0068861_1009882082 78
343 3300005834 Ga0068851_10688267 Ga0068851_106882671 78
344 3300005840 Ga0068870_10225571 Ga0068870_102255712 78
345 3300005841 Ga0068863_100000193 Ga0068863_1000001937 78
346 3300005841 Ga0068863_100016574 Ga0068863_1000165747 78
347 3300005842 Ga0068858_100052259 Ga0068858_1000522591 78
348 3300005842 Ga0068858_100176765 Ga0068858_1001767653 78
349 3300005842 Ga0068858_101984617 Ga0068858_1019846171 78
350 3300005843 Ga0068860_100000010 Ga0068860_10000001046 78
351 3300005843 Ga0068860_100107051 Ga0068860_1001070513 78
352 3300005843 Ga0068860_102115588 Ga0068860_1021155881 78
353 3300005844 Ga0068862_100000008 Ga0068862_100000008281 78
354 3300005844 Ga0068862_100690104 Ga0068862_1006901042 78
355 3300005844 Ga0068862_100778855 Ga0068862_1007788552 78
356 3300005937 Ga0081455_10484431 Ga0081455_104844312 78
357 3300005983 Ga0081540_1124881 Ga0081540_11248813 78
358 3300006028 Ga0070717_11403824 Ga0070717_114038242 78
359 3300006038 Ga0075365_10074261 Ga0075365_100742614 78
360 3300006038 Ga0075365_11064074 Ga0075365_110640742 78
361 3300006042 Ga0075368_10132777 Ga0075368_101327771 78
362 3300006042 Ga0075368_10344571 Ga0075368_103445712 78
363 3300006048 Ga0075363_100006581 Ga0075363_1000065812 78
364 3300006048 Ga0075363_100014648 Ga0075363_1000146483 78
365 3300006048 Ga0075363_100068718 Ga0075363_1000687184 78
366 3300006048 Ga0075363_100078566 Ga0075363_1000785663 78
367 3300006048 Ga0075363_100288161 Ga0075363_1002881612 78
368 3300006048 Ga0075363_100363649 Ga0075363_1003636492 78
369 3300006048 Ga0075363_100368669 Ga0075363_1003686692 78
370 3300006048 Ga0075363_100400865 Ga0075363_1004008652 78
371 3300006048 Ga0075363_100663958 Ga0075363_1006639581 78
372 3300006051 Ga0075364_10026274 Ga0075364_100262742 78
373 3300006051 Ga0075364_10044848 Ga0075364_100448482 78
374 3300006051 Ga0075364_10124844 Ga0075364_101248442 78
375 3300006051 Ga0075364_10351207 Ga0075364_103512072 78
376 3300006051 Ga0075364_10437256 Ga0075364_104372562 78
377 3300006051 Ga0075364_10527113 Ga0075364_105271132 78
378 3300006051 Ga0075364_10877813 Ga0075364_108778132 78
379 3300006051 Ga0075364_11150758 Ga0075364_111507581 78
380 3300006051 Ga0075364_11260911 Ga0075364_112609112 78
381 3300006177 Ga0075362_10073804 Ga0075362_100738044 78
382 3300006177 Ga0075362_10174138 Ga0075362_101741381 78
383 3300006177 Ga0075362_10291445 Ga0075362_102914451 78
384 3300006178 Ga0075367_10058413 Ga0075367_100584132 78
385 3300006178 Ga0075367_10735649 Ga0075367_107356492 78
386 3300006178 Ga0075367_10945551 Ga0075367_109455511 78
387 3300006186 Ga0075369_10001584 Ga0075369_100015847 78
388 3300006186 Ga0075369_10010179 Ga0075369_100101793 78
389 3300006186 Ga0075369_10092227 Ga0075369_100922273 78
390 3300006186 Ga0075369_10436482 Ga0075369_104364822 78
391 3300006186 Ga0075369_10490366 Ga0075369_104903662 78
392 3300006186 Ga0075369_10541941 Ga0075369_105419411 78
393 3300006237 Ga0097621_101250835 Ga0097621_1012508351 78
394 3300006353 Ga0075370_10045478 Ga0075370_100454782 78
395 3300006353 Ga0075370_10066312 Ga0075370_100663122 78
396 3300006353 Ga0075370_10492331 Ga0075370_104923311 78
397 3300006353 Ga0075370_10534360 Ga0075370_105343602 78
398 3300006844 Ga0075428_100004424 Ga0075428_1000044245 78
399 3300006846 Ga0075430_100053158 Ga0075430_1000531584 78
400 3300006847 Ga0075431_100248587 Ga0075431_1002485872 78
401 3300006881 Ga0068865_100116864 Ga0068865_1001168643 78
402 3300006881 Ga0068865_100393735 Ga0068865_1003937351 78
403 3300006931 Ga0097620_100004951 Ga0097620_10000495114 78
404 3300006931 Ga0097620_100391346 Ga0097620_1003913462 78
405 3300006931 Ga0097620_100669229 Ga0097620_1006692293 78
406 3300007076 Ga0075435_101855191 Ga0075435_1018551912 78
407 3300009098 Ga0105245_10084905 Ga0105245_100849054 78
408 3300009101 Ga0105247_10000082 Ga0105247_1000008270 78
409 3300009101 Ga0105247_10041169 Ga0105247_100411694 78
410 3300009101 Ga0105247_10559342 Ga0105247_105593422 78
411 3300009147 Ga0114129_10826262 Ga0114129_108262622 78
412 3300009147 Ga0114129_12841318 Ga0114129_128413182 78
413 3300009148 Ga0105243_10200174 Ga0105243_102001742 78
414 3300009174 Ga0105241_10259202 Ga0105241_102592022 78
415 3300009177 Ga0105248_10000084 Ga0105248_1000008465 78
416 3300009177 Ga0105248_10066413 Ga0105248_100664136 78
417 3300009177 Ga0105248_11432024 Ga0105248_114320242 78
418 3300009553 Ga0105249_10000285 Ga0105249_1000028544 78
419 3300009553 Ga0105249_10306145 Ga0105249_103061454 78
420 3300009553 Ga0105249_11693652 Ga0105249_116936522 78
421 3300009553 Ga0105249_13106271 Ga0105249_131062712 78
422 3300010375 Ga0105239_10583908 Ga0105239_105839082 78
423 3300010375 Ga0105239_11859294 Ga0105239_118592942 78
424 3300010375 Ga0105239_11956336 Ga0105239_119563362 78
425 3300011119 Ga0105246_10851220 Ga0105246_108512202 78
426 3300013104 Ga0157370_11448349 Ga0157370_114483491 78
427 3300013296 Ga0157374_10406780 Ga0157374_104067803 78
428 3300013297 Ga0157378_10155787 Ga0157378_101557873 78
429 3300013306 Ga0163162_10235777 Ga0163162_102357773 78
430 3300013306 Ga0163162_10565322 Ga0163162_105653222 78
431 3300013306 Ga0163162_10806367 Ga0163162_108063672 78
432 3300013306 Ga0163162_11824357 Ga0163162_118243572 78
433 3300013308 Ga0157375_10306065 Ga0157375_103060652 78
434 3300013308 Ga0157375_10362306 Ga0157375_103623063 78
435 3300014325 Ga0163163_10010591 Ga0163163_100105914 78
436 3300014325 Ga0163163_10014507 Ga0163163_100145074 78
437 3300014325 Ga0163163_10552520 Ga0163163_105525203 78
438 3300014325 Ga0163163_11626437 Ga0163163_116264372 78
439 3300014325 Ga0163163_11643584 Ga0163163_116435842 78
440 3300014326 Ga0157380_10107081 Ga0157380_101070812 78
441 3300014968 Ga0157379_10096326 Ga0157379_100963264 78
442 3300014968 Ga0157379_10258577 Ga0157379_102585772 78
443 3300014968 Ga0157379_11448792 Ga0157379_114487922 78
444 3300014969 Ga0157376_11420197 Ga0157376_114201972 78
445 3300017792 Ga0163161_10148354 Ga0163161_101483542 78
446 3300017792 Ga0163161_11602544 Ga0163161_116025442 78
447 3300025303 Ga0209051_1002514 Ga0209051_100251410 78
448 3300025321 Ga0207656_10460559 Ga0207656_104605591 78
449 3300025899 Ga0207642_10013951 Ga0207642_100139513 78
450 3300025900 Ga0207710_10000194 Ga0207710_1000019439 78
451 3300025900 Ga0207710_10087829 Ga0207710_100878292 78
452 3300025901 Ga0207688_10059175 Ga0207688_100591753 78
453 3300025910 Ga0207684_10056393 Ga0207684_100563933 78
454 3300025911 Ga0207654_10069392 Ga0207654_100693922 78
455 3300025916 Ga0207663_10274137 Ga0207663_102741374 78
456 3300025919 Ga0207657_11253222 Ga0207657_112532222 78
457 3300025920 Ga0207649_10952347 Ga0207649_109523472 78
458 3300025922 Ga0207646_10028552 Ga0207646_100285521 78
459 3300025923 Ga0207681_10030439 Ga0207681_100304395 78
460 3300025924 Ga0207694_11447941 Ga0207694_114479412 78
461 3300025925 Ga0207650_10445116 Ga0207650_104451163 78
462 3300025927 Ga0207687_10017616 Ga0207687_1001761610 78
463 3300025932 Ga0207690_10380341 Ga0207690_103803412 78
464 3300025936 Ga0207670_10238714 Ga0207670_102387144 78
465 3300025937 Ga0207669_10002980 Ga0207669_1000298010 78
466 3300025937 Ga0207669_11645605 Ga0207669_116456052 78
467 3300025938 Ga0207704_10160315 Ga0207704_101603152 78
468 3300025941 Ga0207711_10000690 Ga0207711_1000069014 78
469 3300025941 Ga0207711_10268028 Ga0207711_102680282 78
470 3300025942 Ga0207689_10618224 Ga0207689_106182242 78
471 3300025945 Ga0207679_10282952 Ga0207679_102829521 78
472 3300025961 Ga0207712_10000011 Ga0207712_10000011361 78
473 3300025972 Ga0207668_10002560 Ga0207668_100025607 78
474 3300025972 Ga0207668_10096909 Ga0207668_100969094 78
475 3300025972 Ga0207668_12016793 Ga0207668_120167932 78
476 3300025981 Ga0207640_10139840 Ga0207640_101398403 78
477 3300025981 Ga0207640_10331438 Ga0207640_103314383 78
478 3300025986 Ga0207658_10000220 Ga0207658_1000022032 78
479 3300025986 Ga0207658_10004124 Ga0207658_1000412413 78
480 3300025986 Ga0207658_10247762 Ga0207658_102477622 78
481 3300026023 Ga0207677_10142531 Ga0207677_101425313 78
482 3300026035 Ga0207703_10019991 Ga0207703_100199913 78
483 3300026035 Ga0207703_10183614 Ga0207703_101836141 78
484 3300026035 Ga0207703_10692207 Ga0207703_106922072 78
485 3300026041 Ga0207639_10073551 Ga0207639_100735515 78
486 3300026041 Ga0207639_10881612 Ga0207639_108816122 78
487 3300026067 Ga0207678_10053474 Ga0207678_100534744 78
488 3300026067 Ga0207678_10303566 Ga0207678_103035663 78
489 3300026088 Ga0207641_10001710 Ga0207641_100017109 78
490 3300026088 Ga0207641_10012303 Ga0207641_100123036 78
491 3300026088 Ga0207641_10960899 Ga0207641_109608992 78
492 3300026095 Ga0207676_11347891 Ga0207676_113478911 78
493 3300026095 Ga0207676_12099632 Ga0207676_120996322 78
494 3300026118 Ga0207675_100177028 Ga0207675_1001770284 78
495 3300026121 Ga0207683_10159484 Ga0207683_101594844 78
496 3300026142 Ga0207698_10272784 Ga0207698_102727842 78
497 3300027866 Ga0209813_10330654 Ga0209813_103306541 78
498 3300028379 Ga0268266_10003448 Ga0268266_100034487 78
499 3300028379 Ga0268266_10038628 Ga0268266_100386285 78
500 3300028379 Ga0268266_10614673 Ga0268266_106146732 78
501 3300028379 Ga0268266_11214857 Ga0268266_112148572 78
502 3300028379 Ga0268266_11617117 Ga0268266_116171171 78
503 3300028380 Ga0268265_10000007 Ga0268265_10000007274 78
504 3300028380 Ga0268265_10196731 Ga0268265_101967313 78
505 3300028381 Ga0268264_10000007 Ga0268264_10000007405 78
506 3300028381 Ga0268264_10059097 Ga0268264_100590974 78
507 3300031731 Ga0307405_10783953 Ga0307405_107839532 78
508 3300031901 Ga0307406_10959286 Ga0307406_109592862 78
509 3300035114 Ga0373939_0214628 Ga0373939_0214628_413_673 78
510 3300035725 Ga0373947_0297871 Ga0373947_0297871_53_313 78
511 3300039450 Ga0436363_1457429 Ga0436363_1457429_753_992 78
512 3300039453 Ga0436362_0983837 Ga0436362_0983837_147_386 78
513 3300041410 Ga0439461_0080682 Ga0439461_0080682_94_336 78
514 3300041410 Ga0439461_0145607 Ga0439461_0145607_308_550 78
515 3300041411 Ga0439466_0010101 Ga0439466_0010101_382_624 78
516 3300041411 Ga0439466_0016370 Ga0439466_0016370_230_472 78
517 3300041413 Ga0439465_0008953 Ga0439465_0008953_2153_2395 78
518 3300041413 Ga0439465_0012697 Ga0439465_0012697_2196_2438 78
519 3300041413 Ga0439465_0029435 Ga0439465_0029435_687_929 78
520 3300041512 Ga0451853_3958433 Ga0451853_3958433_12_248 78
521 3300041997 Ga0439431_0001993 Ga0439431_0001993_2814_3056 78
522 3300042001 Ga0439441_138124 Ga0439441_138124_183_425 78
523 3300042002 Ga0439442_060313 Ga0439442_060313_22_264 78
524 3300042435 Ga0439434_0004335 Ga0439434_0004335_3181_3423 78
525 3300042435 Ga0439434_0081528 Ga0439434_0081528_275_517 78
526 3300042438 Ga0439459_0077582 Ga0439459_0077582_131_400 78
527 3300044901 Ga0466960_0026185 Ga0466960_0026185_1110_1352 78
528 3300044901 Ga0466960_0230150 Ga0466960_0230150_689_931 78
529 3300046491 Ga0495584_0199897 Ga0495584_0199897_199_465 78
530 3300046523 Ga0495644_0280457 Ga0495644_0280457_289_555 78
531 3300046524 Ga0495648_0005784 Ga0495648_0005784_1021_1260 78
532 3300046533 Ga0495640_0634866 Ga0495640_0634866_80_319 78
533 3300046615 Ga0495656_0234427 Ga0495656_0234427_591_860 78
534 3300046694 Ga0495649_0158833 Ga0495649_0158833_616_855 78
535 3300047320 Ga0495672_0024321 Ga0495672_0024321_1639_1878 78
536 3300047320 Ga0495672_0097859 Ga0495672_0097859_155_397 78
537 3300047320 Ga0495672_0339837 Ga0495672_0339837_137_376 78
538 3300047469 Ga0495673_0001846 Ga0495673_0001846_4686_4925 78
539 3300048903 Ga0496100_0207568 Ga0496100_0207568_861_1100 78
540 3300048903 Ga0496100_1255226 Ga0496100_1255226_247_507 78
541 3300048905 Ga0496102_0036339 Ga0496102_0036339_2815_3057 78
542 3300048905 Ga0496102_0153117 Ga0496102_0153117_926_1168 78
543 3300048905 Ga0496102_0209834 Ga0496102_0209834_615_854 78
544 3300048906 Ga0496103_0355875 Ga0496103_0355875_400_642 78
545 3300048906 Ga0496103_0519298 Ga0496103_0519298_367_609 78
546 3300048907 Ga0496104_0170499 Ga0496104_0170499_1231_1491 78
547 3300048907 Ga0496104_1133772 Ga0496104_1133772_120_362 78
548 3300048907 Ga0496104_1495793 Ga0496104_1495793_302_562 78
549 3300048908 Ga0496105_0052394 Ga0496105_0052394_2436_2678 78
550 3300048909 Ga0496106_0203933 Ga0496106_0203933_633_872 78
551 3300048910 Ga0496107_0090819 Ga0496107_0090819_1505_1744 78
552 3300048910 Ga0496107_0930496 Ga0496107_0930496_81_341 78
553 3300048911 Ga0496108_0066726 Ga0496108_0066726_1636_1875 78
554 3300048911 Ga0496108_0247975 Ga0496108_0247975_255_497 78
555 3300048912 Ga0496109_0058782 Ga0496109_0058782_976_1236 78
556 3300048912 Ga0496109_0101156 Ga0496109_0101156_2053_2295 78
557 3300048912 Ga0496109_0434335 Ga0496109_0434335_598_837 78
558 3300048912 Ga0496109_1723233 Ga0496109_1723233_57_299 78
559 3300048913 Ga0496110_0059967 Ga0496110_0059967_742_984 78
560 3300048913 Ga0496110_0205623 Ga0496110_0205623_1404_1664 78
561 3300048913 Ga0496110_0245260 Ga0496110_0245260_606_866 78
562 3300048914 Ga0496111_0137824 Ga0496111_0137824_895_1137 78
563 3300048914 Ga0496111_0176634 Ga0496111_0176634_440_700 78
564 3300048915 Ga0496112_0057875 Ga0496112_0057875_479_739 78
565 3300048916 Ga0496113_0906694 Ga0496113_0906694_145_405 78
566 3300048917 Ga0496114_0320743 Ga0496114_0320743_737_976 78
567 3300048917 Ga0496114_1218025 Ga0496114_1218025_116_358 78
568 3300048918 Ga0496115_0538140 Ga0496115_0538140_304_543 78
569 3300048922 Ga0496119_0192761 Ga0496119_0192761_798_1040 78
570 3300048929 Ga0496126_0625818 Ga0496126_0625818_360_602 78
571 3300049571 Ga0501034_0286511 Ga0501034_0286511_450_689 78
572 3300050489 nmdc:mga03683_236302_c1 nmdc:mga03683_236302_c1_546_788 78
573 3300050490 nmdc:mga03n38_154777_c1 nmdc:mga03n38_154777_c1_729_971 78
574 3300050490 nmdc:mga03n38_177985_c1 nmdc:mga03n38_177985_c1_60_302 78
575 3300050490 nmdc:mga03n38_253747_c1 nmdc:mga03n38_253747_c1_568_810 78
576 3300050490 nmdc:mga03n38_426640_c1 nmdc:mga03n38_426640_c1_418_660 78
577 3300050490 nmdc:mga03n38_530643_c1 nmdc:mga03n38_530643_c1_204_446 78
578 3300050490 nmdc:mga03n38_53247_c1 nmdc:mga03n38_53247_c1_251_490 78
579 3300050490 nmdc:mga03n38_694151_c1 nmdc:mga03n38_694151_c1_115_357 78
580 3300050490 nmdc:mga03n38_883599_c1 nmdc:mga03n38_883599_c1_39_281 78
581 3300050491 nmdc:mga00v17_116301_c1 nmdc:mga00v17_116301_c1_115_357 78
582 3300050491 nmdc:mga00v17_153246_c1 nmdc:mga00v17_153246_c1_586_825 78
583 3300050491 nmdc:mga00v17_219045_c1 nmdc:mga00v17_219045_c1_363_605 78
584 3300050491 nmdc:mga00v17_396272_c1 nmdc:mga00v17_396272_c1_66_308 78
585 3300050491 nmdc:mga00v17_554942_c1 nmdc:mga00v17_554942_c1_116_355 78
586 3300050491 nmdc:mga00v17_75146_c1 nmdc:mga00v17_75146_c1_845_1087 78
587 3300050492 nmdc:mga0yw44_18493_c1 nmdc:mga0yw44_18493_c1_3470_3712 78
588 3300050494 nmdc:mga06z11_20547_c1 nmdc:mga06z11_20547_c1_1418_1660 78
589 3300050495 nmdc:mga04h51_115475_c1 nmdc:mga04h51_115475_c1_686_928 78
590 3300050496 nmdc:mga07m45_19884_c1 nmdc:mga07m45_19884_c1_1251_1493 78
591 3300050496 nmdc:mga07m45_41866_c1 nmdc:mga07m45_41866_c1_145_387 78
592 3300050496 nmdc:mga07m45_622518_c1 nmdc:mga07m45_622518_c1_173_415 78
593 3300050507 nmdc:mga05p37_49451_c1 nmdc:mga05p37_49451_c1_102_344 78
594 3300050509 nmdc:mga0qj67_15786_c1 nmdc:mga0qj67_15786_c1_295_537 78
595 3300050510 nmdc:mga06r32_22714_c1 nmdc:mga06r32_22714_c1_2982_3224 78
596 3300050516 nmdc:mga0sz30_15354_c1 nmdc:mga0sz30_15354_c1_510_752 78
597 3300050516 nmdc:mga0sz30_22431_c1 nmdc:mga0sz30_22431_c1_2235_2477 78
598 3300050516 nmdc:mga0sz30_253975_c1 nmdc:mga0sz30_253975_c1_456_698 78
599 3300050516 nmdc:mga0sz30_392457_c1 nmdc:mga0sz30_392457_c1_118_360 78
600 3300053108 Ga0500562_014843 Ga0500562_014843_1714_1953 78
601 3300053153 Ga0500616_0163851 Ga0500616_0163851_25_264 78
602 3300001977 JGI24746J21847_1003633 JGI24746J21847_10036334 79
603 3300001989 JGI24739J22299_10152601 JGI24739J22299_101526012 79
604 3300001990 JGI24737J22298_10032763 JGI24737J22298_100327632 79
605 3300001991 JGI24743J22301_10032924 JGI24743J22301_100329241 79
606 3300002067 JGI24735J21928_10045320 JGI24735J21928_100453203 79
607 3300002073 JGI24745J21846_1002064 JGI24745J21846_10020642 79
608 3300002075 JGI24738J21930_10036836 JGI24738J21930_100368362 79
609 3300002077 JGI24744J21845_10004063 JGI24744J21845_100040632 79
610 3300002239 JGI24034J26672_10010903 JGI24034J26672_100109032 79
611 3300002244 JGI24742J22300_10025243 JGI24742J22300_100252432 79
612 3300005328 Ga0070676_10114087 Ga0070676_101140873 79
613 3300005330 Ga0070690_100178641 Ga0070690_1001786413 79
614 3300005333 Ga0070677_10293030 Ga0070677_102930302 79
615 3300005334 Ga0068869_100053371 Ga0068869_1000533715 79
616 3300005335 Ga0070666_10360984 Ga0070666_103609842 79
617 3300005337 Ga0070682_100362958 Ga0070682_1003629583 79
618 3300005338 Ga0068868_100177748 Ga0068868_1001777483 79
619 3300005338 Ga0068868_100862323 Ga0068868_1008623232 79
620 3300005339 Ga0070660_100088227 Ga0070660_1000882272 79
621 3300005340 Ga0070689_100109321 Ga0070689_1001093213 79
622 3300005341 Ga0070691_10160743 Ga0070691_101607431 79
623 3300005343 Ga0070687_100860647 Ga0070687_1008606471 79
624 3300005347 Ga0070668_100560864 Ga0070668_1005608642 79
625 3300005347 Ga0070668_101001721 Ga0070668_1010017212 79
626 3300005353 Ga0070669_100088627 Ga0070669_1000886273 79
627 3300005355 Ga0070671_100176939 Ga0070671_1001769392 79
628 3300005356 Ga0070674_100224370 Ga0070674_1002243702 79
629 3300005364 Ga0070673_100017849 Ga0070673_1000178496 79
630 3300005366 Ga0070659_100087977 Ga0070659_1000879774 79
631 3300005367 Ga0070667_100022244 Ga0070667_1000222444 79
632 3300005434 Ga0070709_10013527 Ga0070709_100135276 79
633 3300005437 Ga0070710_10005227 Ga0070710_100052276 79
634 3300005438 Ga0070701_10100724 Ga0070701_101007243 79
635 3300005439 Ga0070711_100125537 Ga0070711_1001255374 79
636 3300005440 Ga0070705_100031435 Ga0070705_1000314351 79
637 3300005444 Ga0070694_100111372 Ga0070694_1001113723 79
638 3300005445 Ga0070708_100792267 Ga0070708_1007922672 79
639 3300005445 Ga0070708_101367605 Ga0070708_1013676052 79
640 3300005455 Ga0070663_101121020 Ga0070663_1011210202 79
641 3300005456 Ga0070678_100034461 Ga0070678_1000344616 79
642 3300005456 Ga0070678_100567173 Ga0070678_1005671732 79
643 3300005457 Ga0070662_100172232 Ga0070662_1001722323 79
644 3300005458 Ga0070681_11568200 Ga0070681_115682002 79
645 3300005539 Ga0068853_100135994 Ga0068853_1001359943 79
646 3300005539 Ga0068853_101144945 Ga0068853_1011449452 79
647 3300005543 Ga0070672_100875423 Ga0070672_1008754232 79
648 3300005545 Ga0070695_100149934 Ga0070695_1001499341 79
649 3300005546 Ga0070696_100082713 Ga0070696_1000827134 79
650 3300005547 Ga0070693_100101787 Ga0070693_1001017873 79
651 3300005548 Ga0070665_100013763 Ga0070665_1000137636 79
652 3300005549 Ga0070704_100142284 Ga0070704_1001422843 79
653 3300005563 Ga0068855_100397180 Ga0068855_1003971801 79
654 3300005578 Ga0068854_100214659 Ga0068854_1002146592 79
655 3300005615 Ga0070702_100034485 Ga0070702_1000344852 79
656 3300005615 Ga0070702_101284614 Ga0070702_1012846141 79
657 3300005616 Ga0068852_101175799 Ga0068852_1011757992 79
658 3300005617 Ga0068859_101166934 Ga0068859_1011669341 79
659 3300005618 Ga0068864_100323023 Ga0068864_1003230233 79
660 3300005718 Ga0068866_11403301 Ga0068866_114033012 79
661 3300005719 Ga0068861_100148206 Ga0068861_1001482063 79
662 3300005719 Ga0068861_100457938 Ga0068861_1004579382 79
663 3300005719 Ga0068861_102232519 Ga0068861_1022325191 79
664 3300005842 Ga0068858_100128436 Ga0068858_1001284363 79
665 3300005842 Ga0068858_100557208 Ga0068858_1005572081 79
666 3300005843 Ga0068860_101120431 Ga0068860_1011204312 79
667 3300005843 Ga0068860_101233988 Ga0068860_1012339882 79
668 3300005844 Ga0068862_100037226 Ga0068862_1000372263 79
669 3300005937 Ga0081455_10062815 Ga0081455_100628154 79
670 3300006038 Ga0075365_10118319 Ga0075365_101183193 79
671 3300006048 Ga0075363_100235383 Ga0075363_1002353832 79
672 3300006051 Ga0075364_10000608 Ga0075364_100006086 79
673 3300006163 Ga0070715_10006084 Ga0070715_100060845 79
674 3300006163 Ga0070715_10789040 Ga0070715_107890402 79
675 3300006173 Ga0070716_100004652 Ga0070716_1000046527 79
676 3300006175 Ga0070712_100010399 Ga0070712_1000103994 79
677 3300006175 Ga0070712_100257080 Ga0070712_1002570802 79
678 3300006177 Ga0075362_10030275 Ga0075362_100302754 79
679 3300006186 Ga0075369_10005927 Ga0075369_100059276 79
680 3300006186 Ga0075369_10007728 Ga0075369_100077286 79
681 3300006186 Ga0075369_10013814 Ga0075369_100138144 79
682 3300006237 Ga0097621_100527738 Ga0097621_1005277382 79
683 3300006237 Ga0097621_100856186 Ga0097621_1008561862 79
684 3300006358 Ga0068871_100192464 Ga0068871_1001924643 79
685 3300006846 Ga0075430_100528453 Ga0075430_1005284532 79
686 3300006881 Ga0068865_100118364 Ga0068865_1001183642 79
687 3300006881 Ga0068865_101587785 Ga0068865_1015877852 79
688 3300006931 Ga0097620_101166789 Ga0097620_1011667891 79
689 3300009545 Ga0105237_10006962 Ga0105237_1000696210 79
690 3300010375 Ga0105239_10046124 Ga0105239_100461242 79
691 3300017792 Ga0163161_10181693 Ga0163161_101816932 79
692 3300017792 Ga0163161_10425199 Ga0163161_104251992 79
693 3300017792 Ga0163161_10554663 Ga0163161_105546632 79
694 3300025711 Ga0207696_1047827 Ga0207696_10478272 79
695 3300025898 Ga0207692_10069904 Ga0207692_100699044 79
696 3300025899 Ga0207642_10069964 Ga0207642_100699642 79
697 3300025901 Ga0207688_10001753 Ga0207688_100017536 79
698 3300025903 Ga0207680_10341347 Ga0207680_103413471 79
699 3300025904 Ga0207647_10340661 Ga0207647_103406612 79
700 3300025905 Ga0207685_10052796 Ga0207685_100527962 79
701 3300025905 Ga0207685_10601742 Ga0207685_106017421 79
702 3300025907 Ga0207645_10034985 Ga0207645_100349855 79
703 3300025908 Ga0207643_10248916 Ga0207643_102489162 79
704 3300025911 Ga0207654_10431888 Ga0207654_104318882 79
705 3300025912 Ga0207707_10738782 Ga0207707_107387821 79
706 3300025915 Ga0207693_10004579 Ga0207693_100045798 79
707 3300025915 Ga0207693_10160422 Ga0207693_101604221 79
708 3300025916 Ga0207663_10081504 Ga0207663_100815043 79
709 3300025918 Ga0207662_10246054 Ga0207662_102460543 79
710 3300025919 Ga0207657_10050227 Ga0207657_100502273 79
711 3300025923 Ga0207681_10120463 Ga0207681_101204632 79
712 3300025926 Ga0207659_10403810 Ga0207659_104038102 79
713 3300025927 Ga0207687_10108807 Ga0207687_101088073 79
714 3300025932 Ga0207690_10183799 Ga0207690_101837993 79
715 3300025933 Ga0207706_10028298 Ga0207706_100282986 79
716 3300025935 Ga0207709_10278351 Ga0207709_102783512 79
717 3300025936 Ga0207670_10090068 Ga0207670_100900683 79
718 3300025937 Ga0207669_10912067 Ga0207669_109120672 79
719 3300025937 Ga0207669_11496677 Ga0207669_114966772 79
720 3300025938 Ga0207704_10131609 Ga0207704_101316092 79
721 3300025939 Ga0207665_10003777 Ga0207665_100037778 79
722 3300025939 Ga0207665_10314502 Ga0207665_103145022 79
723 3300025940 Ga0207691_10033341 Ga0207691_100333415 79
724 3300025942 Ga0207689_10050263 Ga0207689_100502635 79
725 3300025949 Ga0207667_10505468 Ga0207667_105054682 79
726 3300025960 Ga0207651_10122729 Ga0207651_101227293 79
727 3300025961 Ga0207712_10064034 Ga0207712_100640341 79
728 3300025972 Ga0207668_10597014 Ga0207668_105970142 79
729 3300025972 Ga0207668_10902847 Ga0207668_109028472 79
730 3300025981 Ga0207640_10744761 Ga0207640_107447612 79
731 3300025986 Ga0207658_10119986 Ga0207658_101199863 79
732 3300026023 Ga0207677_10797660 Ga0207677_107976602 79
733 3300026023 Ga0207677_11039312 Ga0207677_110393121 79
734 3300026035 Ga0207703_10040277 Ga0207703_100402773 79
735 3300026035 Ga0207703_10971459 Ga0207703_109714591 79
736 3300026041 Ga0207639_10271993 Ga0207639_102719932 79
737 3300026041 Ga0207639_12031165 Ga0207639_120311652 79
738 3300026067 Ga0207678_10232200 Ga0207678_102322003 79
739 3300026075 Ga0207708_10042495 Ga0207708_100424954 79
740 3300026089 Ga0207648_10098384 Ga0207648_100983843 79
741 3300026095 Ga0207676_10153177 Ga0207676_101531773 79
742 3300026118 Ga0207675_100090749 Ga0207675_1000907494 79
743 3300026118 Ga0207675_100115957 Ga0207675_1001159573 79
744 3300026118 Ga0207675_100832347 Ga0207675_1008323472 79
745 3300026121 Ga0207683_10098056 Ga0207683_100980562 79
746 3300026142 Ga0207698_10194931 Ga0207698_101949312 79
747 3300028379 Ga0268266_10019883 Ga0268266_100198833 79
748 3300028380 Ga0268265_10054607 Ga0268265_100546074 79
749 3300028381 Ga0268264_11681211 Ga0268264_116812112 79
750 3300031852 Ga0307410_10377320 Ga0307410_103773203 79
751 3300031852 Ga0307410_11588743 Ga0307410_115887431 79
752 3300031903 Ga0307407_10216568 Ga0307407_102165682 79
753 3300031995 Ga0307409_102978064 Ga0307409_1029780642 79
754 3300032002 Ga0307416_100890164 Ga0307416_1008901642 79
755 3300032002 Ga0307416_101486597 Ga0307416_1014865972 79
756 3300046523 Ga0495644_0292295 Ga0495644_0292295_101_340 79
757 3300046691 Ga0495670_0672048 Ga0495670_0672048_56_295 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

9

42

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.7667 13 59
3hug-assembly6.cif.gz_P crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6646 13 63
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6626 12 62
3hug-assembly3.cif.gz_L crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.66 13 63
5wur-assembly1.cif.gz_C crystal structure of sigw in complex with its anti-sigma rsiw, an oxdized form 0.6319 7 73
ID Description Score Start End Superfamily
2q1zD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7577 13 59 1.10.10.1320
2z2sD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6858 1 59 1.10.10.1320
5olnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.6849 6 36 1.20.970.10
3hugH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6663 13 63 1.10.10.1320
3hugP00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6646 13 63 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A399X1K3-F1-model_v4 Uncharacterized protein 0.8128 6 75
AF-A0A4R6YKZ8-F1-model_v4 Anti-sigma-K factor RskA 0.7983 7 66
AF-A0A7Y8IAT4-F1-model_v4 Zf-HC2 domain-containing protein 0.7958 6 57 GO:0016020
AF-A0A136NDH7-F1-model_v4 RNA polymerase subunit sigma-70 0.7851 1 57 GO:0006352
GO:0016020
GO:0016987
AF-A3SHJ4-F1-model_v4 Anti-sigma factor 0.781 3 59

Feature Viewer

pLDDT pTM Quality
83.32 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map