F479386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 757 | 359 | 1514 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10095874|Ga0114129_100958742 |
| Length | 412 |
| Sequence | MRGMHFEHSEKAKDLQRRVQAFMDEHIYPNEATYHDQIAEGDRWQPIPIIEQLKPKARAAKLWNLFLPASEYGAGLTNVEYAPLCEIMGRVPGFAAEVFNCSAPDTGNMEVLVRYGTDAQRTQWLEPLLAGEIRSCFAMTEPDVASSDATNIRSSIARDVAHGDAYVINGCKWWISGAGDPRCKIAIFMGKSNPDAPKHQQQSMVLVPMETPGVTIRRLLPVFGYDDAPHGHAEITFENVRVPASNMLLGEGRGFEIAQGRLGPGRIHHCMRLIGVAERALEAMCARVTKRIAFGKPLAEQGTIRADIAESRMEIEQARLLTMKAAYLMDTVGNKAARGEIAMIKVVVPRMALRVLDRAIQAHGAAGVSADFPLAAAWAHTRTIRLADGPDEVHREAIAKLELGKSHWAEKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 194 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 287 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 290 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 301 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 318 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 325 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 326 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 327 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 328 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 329 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 330 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 331 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 332 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 333 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 334 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 335 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 336 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 337 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 338 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 339 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 340 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 341 | 2898907183 | Brevibacillus sp. SYP-B805 | Isolate | Rhizosphere |
| 342 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 343 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 344 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 345 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 346 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 347 | 2928510474 | Sporosarcina psychrophila 1288 | Isolate | Rhizosphere |
| 348 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 349 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 350 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 351 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 352 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 353 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 354 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 355 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 356 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 357 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 358 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 359 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.45 |
| Metatranscriptomes | 0.79 |
| Isolates | 4.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.64 |
| Nodule | 0.13 |
| Rhizoplane | 4.49 |
| Rhizosphere | 87.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10095874 | 3300009147 | Bacteria | 4108 |
| 2 | CNAas_1000010 | 3300000532 | Bacteria | 11171 |
| 3 | JGI24740J21852_10033568 | 3300001979 | Bacteria | 1627 |
| 4 | JGI24751J29686_10014474 | 3300002459 | Bacteria | 1627 |
| 5 | JGI25151J46595_10020935 | 3300003187 | Bacteria | 2746 |
| 6 | JGI25151J46595_10022122 | 3300003187 | Bacteria | 2645 |
| 7 | JGI25406J46586_10021821 | 3300003203 | Bacteria | 2562 |
| 8 | Ga0006562J51391_1001725 | 3300003578 | Bacteria | 6030 |
| 9 | Ga0055532_1000161 | 3300003758 | Bacteria | 58318 |
| 10 | Ga0055532_1006623 | 3300003758 | Bacteria | 1537 |
| 11 | Ga0055528_1002488 | 3300003790 | Bacteria | 9840 |
| 12 | Ga0065704_10162316 | 3300005289 | Bacteria | 1346 |
| 13 | Ga0065712_10113323 | 3300005290 | Bacteria | 1785 |
| 14 | Ga0065715_10095415 | 3300005293 | Bacteria | 4089 |
| 15 | Ga0065715_10128269 | 3300005293 | Bacteria | 2069 |
| 16 | Ga0065707_10001541 | 3300005295 | Bacteria | 8030 |
| 17 | Ga0065707_10007309 | 3300005295 | Bacteria | 5913 |
| 18 | Ga0070676_10050730 | 3300005328 | Bacteria | 2433 |
| 19 | Ga0070676_10109923 | 3300005328 | Bacteria | 1715 |
| 20 | Ga0070683_100001766 | 3300005329 | Bacteria | 16828 |
| 21 | Ga0070683_100019945 | 3300005329 | Bacteria | 5959 |
| 22 | Ga0070683_100020756 | 3300005329 | Bacteria | 5851 |
| 23 | Ga0070690_100021663 | 3300005330 | Bacteria | 3926 |
| 24 | Ga0070690_100031674 | 3300005330 | Bacteria | 3296 |
| 25 | Ga0070670_100144767 | 3300005331 | Bacteria | 2056 |
| 26 | Ga0070677_10033319 | 3300005333 | Bacteria | 1982 |
| 27 | Ga0068869_100105335 | 3300005334 | Bacteria | 2139 |
| 28 | Ga0070666_10113223 | 3300005335 | Bacteria | 1877 |
| 29 | Ga0070680_100021211 | 3300005336 | Bacteria | 5162 |
| 30 | Ga0070660_100000852 | 3300005339 | Bacteria | 20293 |
| 31 | Ga0070660_100007755 | 3300005339 | Bacteria | 7486 |
| 32 | Ga0070660_100029533 | 3300005339 | Bacteria | 4109 |
| 33 | Ga0070689_100130669 | 3300005340 | Bacteria | 2013 |
| 34 | Ga0070691_10041083 | 3300005341 | Bacteria | 2186 |
| 35 | Ga0070661_100021039 | 3300005344 | Bacteria | 4657 |
| 36 | Ga0070661_100187592 | 3300005344 | Bacteria | 1576 |
| 37 | Ga0070692_10001526 | 3300005345 | Bacteria | 8489 |
| 38 | Ga0070692_10005532 | 3300005345 | Bacteria | 5399 |
| 39 | Ga0070692_10158828 | 3300005345 | Bacteria | 1294 |
| 40 | Ga0070669_100000822 | 3300005353 | Bacteria | 22595 |
| 41 | Ga0070669_100007179 | 3300005353 | Bacteria | 8001 |
| 42 | Ga0070669_100016194 | 3300005353 | Bacteria | 5318 |
| 43 | Ga0070669_100016421 | 3300005353 | Bacteria | 5281 |
| 44 | Ga0070669_100034546 | 3300005353 | Bacteria | 3661 |
| 45 | Ga0070669_100123040 | 3300005353 | Bacteria | 1982 |
| 46 | Ga0070669_100165160 | 3300005353 | Bacteria | 1723 |
| 47 | Ga0070669_100166238 | 3300005353 | Bacteria | 1717 |
| 48 | Ga0070675_100000980 | 3300005354 | Bacteria | 20412 |
| 49 | Ga0070675_100002714 | 3300005354 | Bacteria | 13302 |
| 50 | Ga0070675_100080440 | 3300005354 | Bacteria | 2716 |
| 51 | Ga0070671_100018300 | 3300005355 | Bacteria | 5689 |
| 52 | Ga0070671_100193977 | 3300005355 | Bacteria | 1722 |
| 53 | Ga0070688_100034767 | 3300005365 | Bacteria | 3056 |
| 54 | Ga0070688_100174346 | 3300005365 | Bacteria | 1487 |
| 55 | Ga0070659_100113013 | 3300005366 | Bacteria | 2193 |
| 56 | Ga0070667_100173050 | 3300005367 | Bacteria | 1907 |
| 57 | Ga0070703_10001638 | 3300005406 | Bacteria | 6653 |
| 58 | Ga0070709_10100320 | 3300005434 | Bacteria | 1928 |
| 59 | Ga0070714_100000042 | 3300005435 | Bacteria | 116805 |
| 60 | Ga0070714_100008585 | 3300005435 | Bacteria | 7993 |
| 61 | Ga0070714_100177776 | 3300005435 | Bacteria | 1935 |
| 62 | Ga0070713_100010152 | 3300005436 | Bacteria | 6792 |
| 63 | Ga0070713_100109994 | 3300005436 | Bacteria | 2401 |
| 64 | Ga0070701_10032855 | 3300005438 | Bacteria | 2587 |
| 65 | Ga0070711_100000004 | 3300005439 | Bacteria | 188789 |
| 66 | Ga0070711_100006583 | 3300005439 | Bacteria | 7015 |
| 67 | Ga0070711_100035721 | 3300005439 | Bacteria | 3325 |
| 68 | Ga0070711_100165193 | 3300005439 | Bacteria | 1682 |
| 69 | Ga0070705_100010022 | 3300005440 | Bacteria | 4732 |
| 70 | Ga0070705_100019033 | 3300005440 | Bacteria | 3609 |
| 71 | Ga0070705_100021714 | 3300005440 | Bacteria | 3418 |
| 72 | Ga0070700_100008938 | 3300005441 | Bacteria | 5480 |
| 73 | Ga0070700_100010357 | 3300005441 | Bacteria | 5145 |
| 74 | Ga0070694_100001409 | 3300005444 | Bacteria | 14070 |
| 75 | Ga0070694_100004370 | 3300005444 | Bacteria | 8502 |
| 76 | Ga0070694_100078554 | 3300005444 | Bacteria | 2289 |
| 77 | Ga0070694_100084431 | 3300005444 | Bacteria | 2215 |
| 78 | Ga0070708_100002264 | 3300005445 | Bacteria | 14883 |
| 79 | Ga0070708_100019835 | 3300005445 | Bacteria | 5657 |
| 80 | Ga0070708_100090693 | 3300005445 | Bacteria | 2782 |
| 81 | Ga0070663_100019691 | 3300005455 | Bacteria | 4455 |
| 82 | Ga0070662_100074240 | 3300005457 | Bacteria | 2515 |
| 83 | Ga0070662_100207054 | 3300005457 | Bacteria | 1559 |
| 84 | Ga0070681_10040852 | 3300005458 | Bacteria | 4647 |
| 85 | Ga0070681_10071298 | 3300005458 | Bacteria | 3439 |
| 86 | Ga0068867_100073414 | 3300005459 | Bacteria | 2562 |
| 87 | Ga0068867_100222474 | 3300005459 | Bacteria | 1522 |
| 88 | Ga0070706_100009512 | 3300005467 | Bacteria | 9039 |
| 89 | Ga0070706_100011203 | 3300005467 | Bacteria | 8326 |
| 90 | Ga0070706_100021926 | 3300005467 | Bacteria | 5882 |
| 91 | Ga0070706_100033217 | 3300005467 | Bacteria | 4762 |
| 92 | Ga0070706_100281336 | 3300005467 | Bacteria | 1552 |
| 93 | Ga0070707_100001003 | 3300005468 | Bacteria | 27969 |
| 94 | Ga0070707_100017114 | 3300005468 | Bacteria | 6809 |
| 95 | Ga0070698_100005359 | 3300005471 | Bacteria | 14030 |
| 96 | Ga0070698_100042403 | 3300005471 | Bacteria | 4667 |
| 97 | Ga0070698_100090922 | 3300005471 | Bacteria | 3035 |
| 98 | Ga0070698_100245884 | 3300005471 | Bacteria | 1722 |
| 99 | Ga0070699_100147674 | 3300005518 | Bacteria | 2078 |
| 100 | Ga0070679_100188558 | 3300005530 | Bacteria | 2032 |
| 101 | Ga0070679_100192532 | 3300005530 | Bacteria | 2008 |
| 102 | Ga0070684_100009761 | 3300005535 | Bacteria | 7578 |
| 103 | Ga0070684_100016587 | 3300005535 | Bacteria | 6023 |
| 104 | Ga0070684_100113376 | 3300005535 | Bacteria | 2433 |
| 105 | Ga0070697_100001166 | 3300005536 | Bacteria | 19926 |
| 106 | Ga0070697_100001644 | 3300005536 | Bacteria | 17028 |
| 107 | Ga0070697_100128153 | 3300005536 | Bacteria | 2126 |
| 108 | Ga0070697_100267073 | 3300005536 | Bacteria | 1466 |
| 109 | Ga0070672_100115797 | 3300005543 | Bacteria | 2189 |
| 110 | Ga0070672_100128960 | 3300005543 | Bacteria | 2077 |
| 111 | Ga0070686_100001011 | 3300005544 | Bacteria | 16192 |
| 112 | Ga0070686_100019152 | 3300005544 | Bacteria | 4028 |
| 113 | Ga0070695_100001409 | 3300005545 | Bacteria | 13321 |
| 114 | Ga0070695_100021992 | 3300005545 | Bacteria | 3909 |
| 115 | Ga0070695_100031006 | 3300005545 | Bacteria | 3331 |
| 116 | Ga0070696_100002406 | 3300005546 | Bacteria | 12389 |
| 117 | Ga0070696_100003432 | 3300005546 | Bacteria | 10562 |
| 118 | Ga0070696_100019377 | 3300005546 | Bacteria | 4608 |
| 119 | Ga0070693_100002801 | 3300005547 | Bacteria | 8021 |
| 120 | Ga0070693_100004068 | 3300005547 | Bacteria | 6885 |
| 121 | Ga0070693_100134512 | 3300005547 | Bacteria | 1549 |
| 122 | Ga0070665_100013962 | 3300005548 | Bacteria | 8078 |
| 123 | Ga0070665_100079688 | 3300005548 | Bacteria | 3280 |
| 124 | Ga0070665_100182832 | 3300005548 | Bacteria | 2097 |
| 125 | Ga0070665_100228844 | 3300005548 | Bacteria | 1859 |
| 126 | Ga0070704_100081645 | 3300005549 | Bacteria | 2382 |
| 127 | Ga0068855_100000860 | 3300005563 | Bacteria | 37683 |
| 128 | Ga0068855_100147837 | 3300005563 | Bacteria | 2673 |
| 129 | Ga0068855_100212169 | 3300005563 | Bacteria | 2175 |
| 130 | Ga0070664_100000222 | 3300005564 | Bacteria | 40764 |
| 131 | Ga0068857_100038977 | 3300005577 | Bacteria | 4207 |
| 132 | Ga0068857_100151233 | 3300005577 | Bacteria | 2103 |
| 133 | Ga0068857_100220036 | 3300005577 | Bacteria | 1734 |
| 134 | Ga0070702_100022199 | 3300005615 | Bacteria | 3351 |
| 135 | Ga0068859_100040718 | 3300005617 | Bacteria | 4666 |
| 136 | Ga0068859_100065301 | 3300005617 | Bacteria | 3673 |
| 137 | Ga0068859_100151055 | 3300005617 | Bacteria | 2398 |
| 138 | Ga0068859_100154208 | 3300005617 | Bacteria | 2373 |
| 139 | Ga0068859_100166921 | 3300005617 | Bacteria | 2281 |
| 140 | Ga0068864_100011022 | 3300005618 | Bacteria | 7473 |
| 141 | Ga0068864_100320119 | 3300005618 | Bacteria | 1456 |
| 142 | Ga0068866_10012480 | 3300005718 | Bacteria | 3702 |
| 143 | Ga0068861_100055707 | 3300005719 | Bacteria | 3016 |
| 144 | Ga0068861_100058309 | 3300005719 | Bacteria | 2952 |
| 145 | Ga0068861_100110009 | 3300005719 | Bacteria | 2206 |
| 146 | Ga0068863_100001797 | 3300005841 | Bacteria | 21288 |
| 147 | Ga0068863_100098514 | 3300005841 | Bacteria | 2777 |
| 148 | Ga0068863_100115669 | 3300005841 | Bacteria | 2556 |
| 149 | Ga0068858_100008882 | 3300005842 | Bacteria | 9634 |
| 150 | Ga0068858_100012838 | 3300005842 | Bacteria | 7898 |
| 151 | Ga0068858_100016085 | 3300005842 | Bacteria | 7027 |
| 152 | Ga0068858_100225307 | 3300005842 | Bacteria | 1776 |
| 153 | Ga0068860_100038658 | 3300005843 | Bacteria | 4565 |
| 154 | Ga0068860_100066375 | 3300005843 | Bacteria | 3427 |
| 155 | Ga0068860_100215385 | 3300005843 | Bacteria | 1864 |
| 156 | Ga0068862_100091191 | 3300005844 | Bacteria | 2654 |
| 157 | Ga0068862_100175256 | 3300005844 | Bacteria | 1922 |
| 158 | Ga0081455_10106957 | 3300005937 | Bacteria | 2231 |
| 159 | Ga0081538_10013858 | 3300005981 | Bacteria | 6358 |
| 160 | Ga0081539_10000977 | 3300005985 | Bacteria | 53347 |
| 161 | Ga0081539_10012072 | 3300005985 | Bacteria | 6716 |
| 162 | Ga0070717_10097772 | 3300006028 | Bacteria | 2487 |
| 163 | Ga0070715_10000005 | 3300006163 | Bacteria | 298716 |
| 164 | Ga0070712_100048021 | 3300006175 | Bacteria | 2957 |
| 165 | Ga0097621_100003251 | 3300006237 | Bacteria | 11173 |
| 166 | Ga0097621_100135745 | 3300006237 | Bacteria | 2098 |
| 167 | Ga0068871_100003400 | 3300006358 | Bacteria | 10935 |
| 168 | Ga0068871_100011972 | 3300006358 | Bacteria | 6385 |
| 169 | Ga0068871_100210148 | 3300006358 | Bacteria | 1683 |
| 170 | Ga0075428_100024598 | 3300006844 | Bacteria | 6664 |
| 171 | Ga0075428_100032701 | 3300006844 | Bacteria | 5745 |
| 172 | Ga0075428_100034272 | 3300006844 | Bacteria | 5601 |
| 173 | Ga0075428_100070521 | 3300006844 | Bacteria | 3820 |
| 174 | Ga0075430_100013445 | 3300006846 | Bacteria | 6977 |
| 175 | Ga0075430_100206833 | 3300006846 | Bacteria | 1629 |
| 176 | Ga0075431_100007090 | 3300006847 | Bacteria | 11134 |
| 177 | Ga0075431_100026761 | 3300006847 | Bacteria | 5916 |
| 178 | Ga0075431_100135097 | 3300006847 | Bacteria | 2543 |
| 179 | Ga0075433_10057621 | 3300006852 | Bacteria | 3396 |
| 180 | Ga0075433_10066765 | 3300006852 | Bacteria | 3156 |
| 181 | Ga0075433_10068543 | 3300006852 | Bacteria | 3115 |
| 182 | Ga0075433_10201513 | 3300006852 | Bacteria | 1769 |
| 183 | Ga0075433_10333143 | 3300006852 | Bacteria | 1342 |
| 184 | Ga0075434_100000023 | 3300006871 | Bacteria | 68942 |
| 185 | Ga0075434_100003264 | 3300006871 | Bacteria | 14498 |
| 186 | Ga0075434_100020114 | 3300006871 | Bacteria | 6469 |
| 187 | Ga0075434_100169912 | 3300006871 | Bacteria | 2200 |
| 188 | Ga0075434_100305615 | 3300006871 | Bacteria | 1611 |
| 189 | Ga0075429_100005407 | 3300006880 | Bacteria | 10991 |
| 190 | Ga0075429_100081098 | 3300006880 | Bacteria | 2829 |
| 191 | Ga0068865_100005219 | 3300006881 | Bacteria | 7854 |
| 192 | Ga0075436_100000570 | 3300006914 | Bacteria | 24112 |
| 193 | Ga0075436_100000624 | 3300006914 | Bacteria | 23244 |
| 194 | Ga0075436_100010079 | 3300006914 | Bacteria | 6466 |
| 195 | Ga0075436_100016434 | 3300006914 | Bacteria | 5064 |
| 196 | Ga0075436_100057077 | 3300006914 | Bacteria | 2696 |
| 197 | Ga0097620_100040718 | 3300006931 | Bacteria | 4666 |
| 198 | Ga0097620_100065301 | 3300006931 | Bacteria | 3673 |
| 199 | Ga0097620_100151064 | 3300006931 | Bacteria | 2398 |
| 200 | Ga0097620_100154204 | 3300006931 | Bacteria | 2373 |
| 201 | Ga0097620_100166919 | 3300006931 | Bacteria | 2281 |
| 202 | Ga0075435_100000037 | 3300007076 | Bacteria | 68955 |
| 203 | Ga0075435_100003062 | 3300007076 | Bacteria | 11277 |
| 204 | Ga0075435_100196538 | 3300007076 | Bacteria | 1708 |
| 205 | Ga0099794_10017963 | 3300007265 | Bacteria | 3162 |
| 206 | Ga0099794_10023938 | 3300007265 | Bacteria | 2798 |
| 207 | Ga0099794_10093358 | 3300007265 | Bacteria | 1496 |
| 208 | Ga0099794_10102280 | 3300007265 | Bacteria | 1431 |
| 209 | Ga0105240_10201803 | 3300009093 | Bacteria | 2330 |
| 210 | Ga0105240_10301717 | 3300009093 | Bacteria | 1832 |
| 211 | Ga0111539_10001215 | 3300009094 | Bacteria | 34303 |
| 212 | Ga0111539_10005649 | 3300009094 | Bacteria | 16175 |
| 213 | Ga0111539_10005752 | 3300009094 | Bacteria | 16034 |
| 214 | Ga0111539_10007447 | 3300009094 | Bacteria | 14023 |
| 215 | Ga0111539_10017186 | 3300009094 | Bacteria | 8954 |
| 216 | Ga0111539_10031675 | 3300009094 | Bacteria | 6424 |
| 217 | Ga0111539_10043759 | 3300009094 | Bacteria | 5367 |
| 218 | Ga0111539_10103045 | 3300009094 | Bacteria | 3349 |
| 219 | Ga0111539_10165371 | 3300009094 | Bacteria | 2587 |
| 220 | Ga0111539_10208103 | 3300009094 | Bacteria | 2280 |
| 221 | Ga0111539_10325843 | 3300009094 | Bacteria | 1788 |
| 222 | Ga0105245_10241979 | 3300009098 | Bacteria | 1749 |
| 223 | Ga0105245_10405480 | 3300009098 | Bacteria | 1363 |
| 224 | Ga0114129_10000532 | 3300009147 | Bacteria | 46632 |
| 225 | Ga0114129_10007870 | 3300009147 | Bacteria | 15163 |
| 226 | Ga0114129_10008261 | 3300009147 | Bacteria | 14848 |
| 227 | Ga0114129_10008651 | 3300009147 | Bacteria | 14513 |
| 228 | Ga0114129_10010720 | 3300009147 | Bacteria | 13068 |
| 229 | Ga0114129_10021723 | 3300009147 | Bacteria | 9107 |
| 230 | Ga0114129_10030805 | 3300009147 | Bacteria | 7586 |
| 231 | Ga0114129_10062240 | 3300009147 | Bacteria | 5214 |
| 232 | Ga0114129_10094397 | 3300009147 | Bacteria | 4143 |
| 233 | Ga0114129_10103681 | 3300009147 | Bacteria | 3932 |
| 234 | Ga0114129_10302332 | 3300009147 | Bacteria | 2132 |
| 235 | Ga0114129_10357466 | 3300009147 | Bacteria | 1933 |
| 236 | Ga0105243_10001313 | 3300009148 | Bacteria | 22196 |
| 237 | Ga0105243_10047886 | 3300009148 | Bacteria | 3368 |
| 238 | Ga0105243_10156139 | 3300009148 | Bacteria | 1962 |
| 239 | Ga0105241_10031532 | 3300009174 | Bacteria | 3969 |
| 240 | Ga0105242_10000997 | 3300009176 | Bacteria | 22197 |
| 241 | Ga0105242_10009632 | 3300009176 | Bacteria | 7404 |
| 242 | Ga0105242_10271424 | 3300009176 | Bacteria | 1537 |
| 243 | Ga0105248_10015013 | 3300009177 | Bacteria | 8525 |
| 244 | Ga0105248_10057589 | 3300009177 | Bacteria | 4363 |
| 245 | Ga0105248_10082497 | 3300009177 | Bacteria | 3615 |
| 246 | Ga0105248_10115731 | 3300009177 | Bacteria | 3024 |
| 247 | Ga0105248_10197391 | 3300009177 | Bacteria | 2267 |
| 248 | Ga0105248_10222613 | 3300009177 | Bacteria | 2124 |
| 249 | Ga0105248_10539129 | 3300009177 | Bacteria | 1316 |
| 250 | Ga0105237_10151569 | 3300009545 | Bacteria | 2315 |
| 251 | Ga0105238_10070537 | 3300009551 | Bacteria | 3493 |
| 252 | Ga0105238_10108114 | 3300009551 | Bacteria | 2762 |
| 253 | Ga0105249_10104503 | 3300009553 | Bacteria | 2669 |
| 254 | Ga0099796_10025194 | 3300010159 | Bacteria | 1875 |
| 255 | Ga0157371_10023407 | 3300013102 | Bacteria | 4517 |
| 256 | Ga0157371_10033303 | 3300013102 | Bacteria | 3702 |
| 257 | Ga0157370_10068492 | 3300013104 | Bacteria | 3354 |
| 258 | Ga0157369_10005912 | 3300013105 | Bacteria | 14211 |
| 259 | Ga0157369_10010082 | 3300013105 | Bacteria | 10790 |
| 260 | Ga0157369_10233964 | 3300013105 | Bacteria | 1920 |
| 261 | Ga0157374_10256241 | 3300013296 | Bacteria | 1722 |
| 262 | Ga0163162_10023280 | 3300013306 | Bacteria | 6112 |
| 263 | Ga0157372_10059428 | 3300013307 | Bacteria | 4276 |
| 264 | Ga0157372_10360868 | 3300013307 | Bacteria | 1693 |
| 265 | Ga0163163_10019122 | 3300014325 | Bacteria | 6428 |
| 266 | Ga0163163_10077488 | 3300014325 | Bacteria | 3319 |
| 267 | Ga0157380_10004771 | 3300014326 | Bacteria | 9443 |
| 268 | Ga0157380_10021373 | 3300014326 | Bacteria | 4853 |
| 269 | Ga0157380_10023408 | 3300014326 | Bacteria | 4659 |
| 270 | Ga0157380_10038123 | 3300014326 | Bacteria | 3730 |
| 271 | Ga0157377_10038323 | 3300014745 | Bacteria | 2645 |
| 272 | Ga0157379_10001085 | 3300014968 | Bacteria | 22205 |
| 273 | Ga0157379_10044723 | 3300014968 | Bacteria | 3953 |
| 274 | Ga0157376_10003868 | 3300014969 | Bacteria | 10350 |
| 275 | Ga0157376_10029040 | 3300014969 | Bacteria | 4403 |
| 276 | Ga0157376_10086649 | 3300014969 | Bacteria | 2701 |
| 277 | Ga0157376_10097675 | 3300014969 | Bacteria | 2559 |
| 278 | Ga0163161_10051920 | 3300017792 | Bacteria | 2972 |
| 279 | Ga0213876_10000057 | 3300021384 | Bacteria | 134631 |
| 280 | Ga0213876_10000172 | 3300021384 | Bacteria | 67291 |
| 281 | Ga0228598_1000025 | 3300024227 | Bacteria | 20869 |
| 282 | Ga0228598_1005065 | 3300024227 | Bacteria | 2768 |
| 283 | Ga0209566_100189 | 3300025225 | Bacteria | 64931 |
| 284 | Ga0209147_100222 | 3300025229 | Bacteria | 58370 |
| 285 | Ga0209147_100408 | 3300025229 | Bacteria | 29102 |
| 286 | Ga0209258_103941 | 3300025242 | Bacteria | 2983 |
| 287 | Ga0209673_1012288 | 3300025273 | Bacteria | 3459 |
| 288 | Ga0209025_1000127 | 3300025294 | Bacteria | 200766 |
| 289 | Ga0209025_1000568 | 3300025294 | Bacteria | 67279 |
| 290 | Ga0209025_1001477 | 3300025294 | Bacteria | 30602 |
| 291 | Ga0209025_1003847 | 3300025294 | Bacteria | 13635 |
| 292 | Ga0209025_1004999 | 3300025294 | Bacteria | 11081 |
| 293 | Ga0209025_1011725 | 3300025294 | Bacteria | 5725 |
| 294 | Ga0209025_1018270 | 3300025294 | Bacteria | 3991 |
| 295 | Ga0209025_1019288 | 3300025294 | Bacteria | 3798 |
| 296 | Ga0207697_10009622 | 3300025315 | Bacteria | 4165 |
| 297 | Ga0207696_1008193 | 3300025711 | Bacteria | 4023 |
| 298 | Ga0207653_10002016 | 3300025885 | Bacteria | 6481 |
| 299 | Ga0207682_10024480 | 3300025893 | Bacteria | 2391 |
| 300 | Ga0207680_10054194 | 3300025903 | Bacteria | 2412 |
| 301 | Ga0207647_10018632 | 3300025904 | Bacteria | 4688 |
| 302 | Ga0207647_10057778 | 3300025904 | Bacteria | 2378 |
| 303 | Ga0207685_10000026 | 3300025905 | Bacteria | 109892 |
| 304 | Ga0207699_10070043 | 3300025906 | Bacteria | 2140 |
| 305 | Ga0207645_10001021 | 3300025907 | Bacteria | 23141 |
| 306 | Ga0207645_10028529 | 3300025907 | Bacteria | 3602 |
| 307 | Ga0207645_10173344 | 3300025907 | Bacteria | 1414 |
| 308 | Ga0207705_10000648 | 3300025909 | Bacteria | 28951 |
| 309 | Ga0207705_10001745 | 3300025909 | Bacteria | 17203 |
| 310 | Ga0207705_10003867 | 3300025909 | Bacteria | 11391 |
| 311 | Ga0207684_10015939 | 3300025910 | Bacteria | 6459 |
| 312 | Ga0207684_10017140 | 3300025910 | Bacteria | 6217 |
| 313 | Ga0207684_10024307 | 3300025910 | Bacteria | 5167 |
| 314 | Ga0207684_10128245 | 3300025910 | Bacteria | 2177 |
| 315 | Ga0207707_10325626 | 3300025912 | Bacteria | 1326 |
| 316 | Ga0207695_10090405 | 3300025913 | Bacteria | 3077 |
| 317 | Ga0207695_10098606 | 3300025913 | Bacteria | 2921 |
| 318 | Ga0207693_10061849 | 3300025915 | Bacteria | 2933 |
| 319 | Ga0207663_10000007 | 3300025916 | Bacteria | 208566 |
| 320 | Ga0207663_10004341 | 3300025916 | Bacteria | 7040 |
| 321 | Ga0207663_10011482 | 3300025916 | Bacteria | 4755 |
| 322 | Ga0207663_10098338 | 3300025916 | Bacteria | 1959 |
| 323 | Ga0207660_10179723 | 3300025917 | Bacteria | 1642 |
| 324 | Ga0207662_10002970 | 3300025918 | Bacteria | 8632 |
| 325 | Ga0207662_10037194 | 3300025918 | Bacteria | 2848 |
| 326 | Ga0207657_10001247 | 3300025919 | Bacteria | 27200 |
| 327 | Ga0207657_10001696 | 3300025919 | Bacteria | 23760 |
| 328 | Ga0207657_10118582 | 3300025919 | Bacteria | 2178 |
| 329 | Ga0207646_10000165 | 3300025922 | Bacteria | 89540 |
| 330 | Ga0207646_10105599 | 3300025922 | Bacteria | 2526 |
| 331 | Ga0207681_10016455 | 3300025923 | Bacteria | 4627 |
| 332 | Ga0207681_10032205 | 3300025923 | Bacteria | 3431 |
| 333 | Ga0207681_10095856 | 3300025923 | Bacteria | 2129 |
| 334 | Ga0207681_10210456 | 3300025923 | Bacteria | 1498 |
| 335 | Ga0207694_10119731 | 3300025924 | Bacteria | 2101 |
| 336 | Ga0207650_10110218 | 3300025925 | Bacteria | 2130 |
| 337 | Ga0207650_10125836 | 3300025925 | Bacteria | 2001 |
| 338 | Ga0207659_10001618 | 3300025926 | Bacteria | 13342 |
| 339 | Ga0207659_10138134 | 3300025926 | Bacteria | 1889 |
| 340 | Ga0207700_10023389 | 3300025928 | Bacteria | 4259 |
| 341 | Ga0207700_10057336 | 3300025928 | Bacteria | 2936 |
| 342 | Ga0207664_10000037 | 3300025929 | Bacteria | 171467 |
| 343 | Ga0207664_10153081 | 3300025929 | Bacteria | 1960 |
| 344 | Ga0207644_10075116 | 3300025931 | Bacteria | 2483 |
| 345 | Ga0207644_10142530 | 3300025931 | Bacteria | 1847 |
| 346 | Ga0207690_10038910 | 3300025932 | Bacteria | 3099 |
| 347 | Ga0207706_10095895 | 3300025933 | Bacteria | 2609 |
| 348 | Ga0207686_10000208 | 3300025934 | Bacteria | 44632 |
| 349 | Ga0207686_10070026 | 3300025934 | Bacteria | 2252 |
| 350 | Ga0207686_10169196 | 3300025934 | Bacteria | 1539 |
| 351 | Ga0207709_10000029 | 3300025935 | Bacteria | 333327 |
| 352 | Ga0207669_10011976 | 3300025937 | Bacteria | 4246 |
| 353 | Ga0207704_10016402 | 3300025938 | Bacteria | 3806 |
| 354 | Ga0207665_10005191 | 3300025939 | Bacteria | 8696 |
| 355 | Ga0207691_10007228 | 3300025940 | Bacteria | 10712 |
| 356 | Ga0207691_10016335 | 3300025940 | Bacteria | 7047 |
| 357 | Ga0207711_10053569 | 3300025941 | Bacteria | 3460 |
| 358 | Ga0207711_10067280 | 3300025941 | Bacteria | 3101 |
| 359 | Ga0207711_10166136 | 3300025941 | Bacteria | 2000 |
| 360 | Ga0207689_10059057 | 3300025942 | Bacteria | 3155 |
| 361 | Ga0207689_10065897 | 3300025942 | Bacteria | 2979 |
| 362 | Ga0207689_10099778 | 3300025942 | Bacteria | 2386 |
| 363 | Ga0207679_10020392 | 3300025945 | Bacteria | 4473 |
| 364 | Ga0207667_10010703 | 3300025949 | Bacteria | 10703 |
| 365 | Ga0207667_10186565 | 3300025949 | Bacteria | 2129 |
| 366 | Ga0207667_10261311 | 3300025949 | Bacteria | 1770 |
| 367 | Ga0207651_10161753 | 3300025960 | Bacteria | 1756 |
| 368 | Ga0207712_10153811 | 3300025961 | Bacteria | 1779 |
| 369 | Ga0207658_10133343 | 3300025986 | Bacteria | 1999 |
| 370 | Ga0207703_10010431 | 3300026035 | Bacteria | 7267 |
| 371 | Ga0207703_10026965 | 3300026035 | Bacteria | 4525 |
| 372 | Ga0207703_10094455 | 3300026035 | Bacteria | 2521 |
| 373 | Ga0207703_10209745 | 3300026035 | Bacteria | 1736 |
| 374 | Ga0207678_10003131 | 3300026067 | Bacteria | 14970 |
| 375 | Ga0207708_10002277 | 3300026075 | Bacteria | 14153 |
| 376 | Ga0207708_10002474 | 3300026075 | Bacteria | 13583 |
| 377 | Ga0207641_10001646 | 3300026088 | Bacteria | 21794 |
| 378 | Ga0207641_10073196 | 3300026088 | Bacteria | 2953 |
| 379 | Ga0207641_10150592 | 3300026088 | Bacteria | 2107 |
| 380 | Ga0207648_10010792 | 3300026089 | Bacteria | 8632 |
| 381 | Ga0207648_10013697 | 3300026089 | Bacteria | 7529 |
| 382 | Ga0207648_10219657 | 3300026089 | Bacteria | 1689 |
| 383 | Ga0207674_10017639 | 3300026116 | Bacteria | 7785 |
| 384 | Ga0207674_10104184 | 3300026116 | Bacteria | 2816 |
| 385 | Ga0207675_100000537 | 3300026118 | Bacteria | 36958 |
| 386 | Ga0207675_100003240 | 3300026118 | Bacteria | 15957 |
| 387 | Ga0207675_100005081 | 3300026118 | Bacteria | 12663 |
| 388 | Ga0207675_100123314 | 3300026118 | Bacteria | 2453 |
| 389 | Ga0207675_100193252 | 3300026118 | Bacteria | 1953 |
| 390 | Ga0209588_1002959 | 3300027671 | Bacteria | 4669 |
| 391 | Ga0207428_10001989 | 3300027907 | Bacteria | 20731 |
| 392 | Ga0207428_10002691 | 3300027907 | Bacteria | 17705 |
| 393 | Ga0207428_10003496 | 3300027907 | Bacteria | 15230 |
| 394 | Ga0207428_10003822 | 3300027907 | Bacteria | 14443 |
| 395 | Ga0207428_10034376 | 3300027907 | Bacteria | 4154 |
| 396 | Ga0265354_1000043 | 3300028016 | Bacteria | 20369 |
| 397 | Ga0265354_1002430 | 3300028016 | Bacteria | 2302 |
| 398 | Ga0268266_10008285 | 3300028379 | Bacteria | 9264 |
| 399 | Ga0268266_10073992 | 3300028379 | Bacteria | 2958 |
| 400 | Ga0268266_10074202 | 3300028379 | Bacteria | 2954 |
| 401 | Ga0268266_10210234 | 3300028379 | Bacteria | 1784 |
| 402 | Ga0268265_10018307 | 3300028380 | Bacteria | 4852 |
| 403 | Ga0268265_10068984 | 3300028380 | Bacteria | 2744 |
| 404 | Ga0268264_10029562 | 3300028381 | Bacteria | 4489 |
| 405 | Ga0268264_10150901 | 3300028381 | Bacteria | 2083 |
| 406 | Ga0265770_1000453 | 3300030878 | Bacteria | 5644 |
| 407 | Ga0265770_1001641 | 3300030878 | Bacteria | 3066 |
| 408 | Ga0265765_1001703 | 3300030879 | Bacteria | 2046 |
| 409 | Ga0265760_10002254 | 3300031090 | Bacteria | 5637 |
| 410 | Ga0265760_10012555 | 3300031090 | Bacteria | 2423 |
| 411 | Ga0307408_100064758 | 3300031548 | Bacteria | 2678 |
| 412 | Ga0307408_100069761 | 3300031548 | Bacteria | 2593 |
| 413 | Ga0307408_100131645 | 3300031548 | Bacteria | 1952 |
| 414 | Ga0307405_10012489 | 3300031731 | Bacteria | 4499 |
| 415 | Ga0307405_10014705 | 3300031731 | Bacteria | 4217 |
| 416 | Ga0307405_10032782 | 3300031731 | Bacteria | 3074 |
| 417 | Ga0307413_10000475 | 3300031824 | Bacteria | 13077 |
| 418 | Ga0307413_10034252 | 3300031824 | Bacteria | 2900 |
| 419 | Ga0307413_10035627 | 3300031824 | Bacteria | 2856 |
| 420 | Ga0307413_10072258 | 3300031824 | Bacteria | 2177 |
| 421 | Ga0307413_10114127 | 3300031824 | Bacteria | 1815 |
| 422 | Ga0307410_10002922 | 3300031852 | Bacteria | 8422 |
| 423 | Ga0307410_10011383 | 3300031852 | Bacteria | 5084 |
| 424 | Ga0307410_10030355 | 3300031852 | Bacteria | 3454 |
| 425 | Ga0307410_10137218 | 3300031852 | Bacteria | 1804 |
| 426 | Ga0307410_10210775 | 3300031852 | Bacteria | 1488 |
| 427 | Ga0307406_10049041 | 3300031901 | Bacteria | 2670 |
| 428 | Ga0307406_10065609 | 3300031901 | Bacteria | 2360 |
| 429 | Ga0307407_10000478 | 3300031903 | Bacteria | 12285 |
| 430 | Ga0307407_10130235 | 3300031903 | Bacteria | 1608 |
| 431 | Ga0307412_10028184 | 3300031911 | Bacteria | 3510 |
| 432 | Ga0307412_10029476 | 3300031911 | Bacteria | 3444 |
| 433 | Ga0307412_10209886 | 3300031911 | Bacteria | 1485 |
| 434 | Ga0307409_100003586 | 3300031995 | Bacteria | 8478 |
| 435 | Ga0307409_100007722 | 3300031995 | Bacteria | 6463 |
| 436 | Ga0307409_100065669 | 3300031995 | Bacteria | 2857 |
| 437 | Ga0307409_100138304 | 3300031995 | Bacteria | 2094 |
| 438 | Ga0307409_100172712 | 3300031995 | Bacteria | 1904 |
| 439 | Ga0307416_100022589 | 3300032002 | Bacteria | 4543 |
| 440 | Ga0307416_100066510 | 3300032002 | Bacteria | 2967 |
| 441 | Ga0307416_100080025 | 3300032002 | Bacteria | 2756 |
| 442 | Ga0307416_100083060 | 3300032002 | Bacteria | 2716 |
| 443 | Ga0307416_100100436 | 3300032002 | Bacteria | 2516 |
| 444 | Ga0307416_100101098 | 3300032002 | Bacteria | 2510 |
| 445 | Ga0307416_100106904 | 3300032002 | Bacteria | 2454 |
| 446 | Ga0307416_100134513 | 3300032002 | Bacteria | 2233 |
| 447 | Ga0307414_10007713 | 3300032004 | Bacteria | 6062 |
| 448 | Ga0307414_10014163 | 3300032004 | Bacteria | 4769 |
| 449 | Ga0307414_10068510 | 3300032004 | Bacteria | 2547 |
| 450 | Ga0307414_10191275 | 3300032004 | Bacteria | 1656 |
| 451 | Ga0307414_10245558 | 3300032004 | Bacteria | 1485 |
| 452 | Ga0307411_10001105 | 3300032005 | Bacteria | 10498 |
| 453 | Ga0307411_10017673 | 3300032005 | Bacteria | 4072 |
| 454 | Ga0307411_10020174 | 3300032005 | Bacteria | 3869 |
| 455 | Ga0307415_100002385 | 3300032126 | Bacteria | 9364 |
| 456 | Ga0307415_100015437 | 3300032126 | Bacteria | 4523 |
| 457 | Ga0307415_100026378 | 3300032126 | Bacteria | 3664 |
| 458 | Ga0307415_100099242 | 3300032126 | Bacteria | 2131 |
| 459 | Ga0373950_0007628 | 3300034818 | Bacteria | 1685 |
| 460 | Ga0373938_0003512 | 3300034957 | Bacteria | 2574 |
| 461 | Ga0373926_0006393 | 3300035083 | Bacteria | 3915 |
| 462 | Ga0373926_0071066 | 3300035083 | Bacteria | 1279 |
| 463 | Ga0373928_0013148 | 3300035084 | Bacteria | 1659 |
| 464 | Ga0373934_0028713 | 3300035086 | Bacteria | 2170 |
| 465 | Ga0373940_0000100 | 3300035088 | Bacteria | 10437 |
| 466 | Ga0373949_0004862 | 3300035090 | Bacteria | 3042 |
| 467 | Ga0373951_0001096 | 3300035091 | Bacteria | 7231 |
| 468 | Ga0373952_0000066 | 3300035092 | Bacteria | 13199 |
| 469 | Ga0373923_0012504 | 3300035111 | Bacteria | 3139 |
| 470 | Ga0373932_0005597 | 3300035112 | Bacteria | 2955 |
| 471 | Ga0373939_0001899 | 3300035114 | Bacteria | 5003 |
| 472 | Ga0373941_0014160 | 3300035115 | Bacteria | 2125 |
| 473 | Ga0373945_0027709 | 3300035116 | Bacteria | 1980 |
| 474 | Ga0373953_0046195 | 3300035117 | Bacteria | 1748 |
| 475 | Ga0373960_0000575 | 3300035121 | Bacteria | 7472 |
| 476 | Ga0373943_0000346 | 3300035170 | Bacteria | 19503 |
| 477 | Ga0373943_0040201 | 3300035170 | Bacteria | 2257 |
| 478 | Ga0373946_0001109 | 3300035171 | Bacteria | 9303 |
| 479 | Ga0373955_0015102 | 3300035172 | Bacteria | 3773 |
| 480 | Ga0373942_0004904 | 3300035207 | Bacteria | 3102 |
| 481 | Ga0373961_0005994 | 3300035241 | Bacteria | 2918 |
| 482 | Ga0373962_0001444 | 3300035242 | Bacteria | 5619 |
| 483 | Ga0373924_0000090 | 3300035410 | Bacteria | 24971 |
| 484 | Ga0373924_0000745 | 3300035410 | Bacteria | 10145 |
| 485 | Ga0373924_0025464 | 3300035410 | Bacteria | 2340 |
| 486 | Ga0373924_0043785 | 3300035410 | Bacteria | 1839 |
| 487 | Ga0373931_0001298 | 3300035691 | Bacteria | 10691 |
| 488 | Ga0373931_0063533 | 3300035691 | Bacteria | 1996 |
| 489 | Ga0373935_0003926 | 3300035692 | Bacteria | 8684 |
| 490 | Ga0373935_0037132 | 3300035692 | Bacteria | 3047 |
| 491 | Ga0373927_0000206 | 3300035695 | Bacteria | 47251 |
| 492 | Ga0373927_0000276 | 3300035695 | Bacteria | 40262 |
| 493 | Ga0373927_0007405 | 3300035695 | Bacteria | 7429 |
| 494 | Ga0373927_0014703 | 3300035695 | Bacteria | 5174 |
| 495 | Ga0373927_0037217 | 3300035695 | Bacteria | 3164 |
| 496 | Ga0373927_0053782 | 3300035695 | Bacteria | 2605 |
| 497 | Ga0373933_0000301 | 3300035724 | Bacteria | 31938 |
| 498 | Ga0373933_0167662 | 3300035724 | Bacteria | 1397 |
| 499 | Ga0373947_0000122 | 3300035725 | Bacteria | 39100 |
| 500 | Ga0373947_0000282 | 3300035725 | Bacteria | 28758 |
| 501 | Ga0373947_0108408 | 3300035725 | Bacteria | 1752 |
| 502 | Ga0373937_0000288 | 3300036401 | Bacteria | 48158 |
| 503 | Ga0373937_0007732 | 3300036401 | Bacteria | 9319 |
| 504 | Ga0373937_0100131 | 3300036401 | Bacteria | 2689 |
| 505 | Ga0373937_0137368 | 3300036401 | Bacteria | 2286 |
| 506 | Ga0373937_0442713 | 3300036401 | Bacteria | 1234 |
| 507 | Ga0373925_0000103 | 3300037068 | Bacteria | 92575 |
| 508 | Ga0373925_0000934 | 3300037068 | Bacteria | 26622 |
| 509 | Ga0373925_0038257 | 3300037068 | Bacteria | 3546 |
| 510 | Ga0373925_0070966 | 3300037068 | Bacteria | 2634 |
| 511 | Ga0373925_0338171 | 3300037068 | Bacteria | 1221 |
| 512 | Ga0395899_0004515 | 3300037312 | Bacteria | 10849 |
| 513 | Ga0395899_0043639 | 3300037312 | Bacteria | 3344 |
| 514 | Ga0395900_0000777 | 3300037418 | Bacteria | 42484 |
| 515 | Ga0395898_0015202 | 3300037466 | Bacteria | 7902 |
| 516 | Ga0395898_0064107 | 3300037466 | Bacteria | 3564 |
| 517 | Ga0395905_0183418 | 3300037471 | Bacteria | 1965 |
| 518 | Ga0395905_0386107 | 3300037471 | Bacteria | 1294 |
| 519 | Ga0395901_0006976 | 3300038443 | Bacteria | 11414 |
| 520 | Ga0400483_137280 | 3300039062 | Bacteria | 2722 |
| 521 | Ga0400483_206430 | 3300039062 | Bacteria | 78978 |
| 522 | Ga0436365_1041616 | 3300039437 | Bacteria | 111595 |
| 523 | Ga0436365_1521843 | 3300039437 | Bacteria | 3653 |
| 524 | Ga0436365_1928925 | 3300039437 | Bacteria | 149126 |
| 525 | Ga0439433_0005733 | 3300041999 | Bacteria | 2669 |
| 526 | Ga0453683_0003399 | 3300044673 | Bacteria | 11750 |
| 527 | Ga0453683_0043010 | 3300044673 | Bacteria | 2836 |
| 528 | Ga0453683_0083804 | 3300044673 | Bacteria | 1998 |
| 529 | Ga0466963_0186800 | 3300044694 | Bacteria | 1448 |
| 530 | Ga0453684_0006038 | 3300044712 | Bacteria | 23425 |
| 531 | Ga0453684_0179507 | 3300044712 | Bacteria | 2486 |
| 532 | Ga0453684_0403315 | 3300044712 | Bacteria | 1531 |
| 533 | Ga0466957_0078266 | 3300044842 | Bacteria | 2056 |
| 534 | Ga0466959_0038379 | 3300045049 | Bacteria | 3539 |
| 535 | Ga0451576_0183014 | 3300045051 | Bacteria | 2188 |
| 536 | Ga0451576_0278924 | 3300045051 | Bacteria | 1747 |
| 537 | Ga0466967_0001131 | 3300045976 | Bacteria | 14854 |
| 538 | Ga0495629_0063427 | 3300046459 | Bacteria | 2581 |
| 539 | Ga0495651_0008643 | 3300046462 | Bacteria | 7811 |
| 540 | Ga0495580_0019767 | 3300046472 | Bacteria | 4999 |
| 541 | Ga0495580_0096140 | 3300046472 | Bacteria | 2060 |
| 542 | Ga0495580_0117149 | 3300046472 | Bacteria | 1850 |
| 543 | Ga0495580_0154089 | 3300046472 | Bacteria | 1592 |
| 544 | Ga0495582_0161517 | 3300046473 | Bacteria | 1274 |
| 545 | Ga0495664_0002852 | 3300046477 | Bacteria | 9314 |
| 546 | Ga0495664_0003856 | 3300046477 | Bacteria | 8180 |
| 547 | Ga0495585_0018584 | 3300046492 | Bacteria | 4008 |
| 548 | Ga0495608_0005145 | 3300046511 | Bacteria | 9348 |
| 549 | Ga0495608_0019436 | 3300046511 | Bacteria | 4675 |
| 550 | Ga0495618_0011895 | 3300046514 | Bacteria | 5281 |
| 551 | Ga0495618_0126032 | 3300046514 | Bacteria | 1640 |
| 552 | Ga0495628_0033769 | 3300046516 | Bacteria | 4120 |
| 553 | Ga0495628_0161114 | 3300046516 | Bacteria | 1705 |
| 554 | Ga0495628_0248046 | 3300046516 | Bacteria | 1330 |
| 555 | Ga0495630_0002908 | 3300046517 | Bacteria | 11899 |
| 556 | Ga0495630_0124808 | 3300046517 | Bacteria | 1953 |
| 557 | Ga0495630_0130827 | 3300046517 | Bacteria | 1906 |
| 558 | Ga0495663_0017588 | 3300046525 | Bacteria | 2030 |
| 559 | Ga0495652_0005051 | 3300046529 | Bacteria | 12489 |
| 560 | Ga0495665_0037808 | 3300046531 | Bacteria | 2575 |
| 561 | Ga0495640_0065239 | 3300046533 | Bacteria | 2459 |
| 562 | Ga0495640_0122168 | 3300046533 | Bacteria | 1692 |
| 563 | Ga0495586_0159106 | 3300046535 | Bacteria | 1273 |
| 564 | Ga0495587_0000157 | 3300046536 | Bacteria | 50388 |
| 565 | Ga0495587_0017031 | 3300046536 | Bacteria | 4519 |
| 566 | Ga0495598_0013761 | 3300046537 | Bacteria | 2012 |
| 567 | Ga0495645_0001995 | 3300046543 | Bacteria | 13878 |
| 568 | Ga0495645_0009754 | 3300046543 | Bacteria | 6718 |
| 569 | Ga0495645_0098574 | 3300046543 | Bacteria | 2080 |
| 570 | Ga0495645_0176861 | 3300046543 | Bacteria | 1465 |
| 571 | Ga0495633_0012417 | 3300046558 | Bacteria | 4531 |
| 572 | Ga0495667_0010475 | 3300046559 | Bacteria | 6274 |
| 573 | Ga0495668_0109500 | 3300046616 | Bacteria | 1511 |
| 574 | Ga0495635_0040764 | 3300046663 | Bacteria | 3208 |
| 575 | Ga0495599_0015224 | 3300046678 | Bacteria | 4770 |
| 576 | Ga0495599_0022903 | 3300046678 | Bacteria | 3902 |
| 577 | Ga0495646_0038807 | 3300046680 | Bacteria | 2939 |
| 578 | Ga0495647_0031398 | 3300046681 | Bacteria | 1975 |
| 579 | Ga0495658_0044613 | 3300046683 | Bacteria | 2485 |
| 580 | Ga0495669_0029222 | 3300046684 | Bacteria | 2417 |
| 581 | Ga0495613_0000975 | 3300046689 | Bacteria | 21818 |
| 582 | Ga0495613_0072602 | 3300046689 | Bacteria | 2509 |
| 583 | Ga0495600_0066149 | 3300046809 | Bacteria | 2363 |
| 584 | Ga0495581_0026269 | 3300047315 | Bacteria | 3377 |
| 585 | Ga0495604_0030764 | 3300047317 | Bacteria | 4261 |
| 586 | Ga0495604_0037249 | 3300047317 | Bacteria | 3831 |
| 587 | Ga0495604_0069462 | 3300047317 | Bacteria | 2670 |
| 588 | Ga0495604_0127199 | 3300047317 | Bacteria | 1836 |
| 589 | Ga0495674_0044282 | 3300047319 | Bacteria | 3957 |
| 590 | Ga0495674_0067232 | 3300047319 | Bacteria | 3106 |
| 591 | Ga0495674_0107073 | 3300047319 | Bacteria | 2373 |
| 592 | Ga0495674_0111913 | 3300047319 | Bacteria | 2314 |
| 593 | Ga0495680_0097390 | 3300047322 | Bacteria | 2196 |
| 594 | Ga0495675_0000271 | 3300047444 | Bacteria | 37489 |
| 595 | Ga0495675_0075258 | 3300047444 | Bacteria | 2128 |
| 596 | Ga0495675_0126630 | 3300047444 | Bacteria | 1589 |
| 597 | Ga0495684_0000140 | 3300047471 | Bacteria | 53062 |
| 598 | Ga0495602_0000436 | 3300048088 | Bacteria | 39209 |
| 599 | Ga0495602_0197422 | 3300048088 | Bacteria | 1538 |
| 600 | Ga0496101_0001225 | 3300048904 | Bacteria | 15369 |
| 601 | Ga0496102_0003727 | 3300048905 | Bacteria | 12880 |
| 602 | Ga0496103_0034893 | 3300048906 | Bacteria | 3077 |
| 603 | Ga0496104_0001234 | 3300048907 | Bacteria | 22013 |
| 604 | Ga0496104_0016644 | 3300048907 | Bacteria | 6683 |
| 605 | Ga0496104_0017205 | 3300048907 | Bacteria | 6577 |
| 606 | Ga0496105_0000459 | 3300048908 | Bacteria | 26767 |
| 607 | Ga0496105_0001553 | 3300048908 | Bacteria | 16254 |
| 608 | Ga0496105_0030664 | 3300048908 | Bacteria | 4406 |
| 609 | Ga0496106_0078251 | 3300048909 | Bacteria | 2537 |
| 610 | Ga0496106_0253012 | 3300048909 | Bacteria | 1409 |
| 611 | Ga0496107_0000344 | 3300048910 | Bacteria | 25308 |
| 612 | Ga0496108_0003238 | 3300048911 | Bacteria | 13092 |
| 613 | Ga0496108_0016078 | 3300048911 | Bacteria | 6100 |
| 614 | Ga0496108_0032273 | 3300048911 | Bacteria | 4350 |
| 615 | Ga0496108_0173347 | 3300048911 | Bacteria | 1867 |
| 616 | Ga0496109_0000017 | 3300048912 | Bacteria | 200904 |
| 617 | Ga0496109_0002270 | 3300048912 | Bacteria | 15979 |
| 618 | Ga0496109_0006048 | 3300048912 | Bacteria | 10170 |
| 619 | Ga0496110_0000702 | 3300048913 | Bacteria | 23101 |
| 620 | Ga0496110_0001502 | 3300048913 | Bacteria | 16928 |
| 621 | Ga0496111_0000975 | 3300048914 | Bacteria | 15649 |
| 622 | Ga0496111_0065963 | 3300048914 | Bacteria | 2628 |
| 623 | Ga0496111_0116269 | 3300048914 | Bacteria | 1972 |
| 624 | Ga0496111_0182539 | 3300048914 | Bacteria | 1560 |
| 625 | Ga0496112_0045473 | 3300048915 | Bacteria | 4303 |
| 626 | Ga0496112_0048345 | 3300048915 | Bacteria | 4171 |
| 627 | Ga0496112_0266584 | 3300048915 | Bacteria | 1661 |
| 628 | Ga0496113_0002031 | 3300048916 | Bacteria | 11618 |
| 629 | Ga0496113_0013697 | 3300048916 | Bacteria | 5506 |
| 630 | Ga0496113_0037688 | 3300048916 | Bacteria | 3550 |
| 631 | Ga0496113_0043798 | 3300048916 | Bacteria | 3314 |
| 632 | Ga0496115_0069688 | 3300048918 | Bacteria | 2849 |
| 633 | Ga0496116_0074330 | 3300048919 | Bacteria | 2138 |
| 634 | Ga0496117_0024889 | 3300048920 | Bacteria | 4718 |
| 635 | Ga0496119_0014455 | 3300048922 | Bacteria | 6176 |
| 636 | Ga0496122_0095370 | 3300048925 | Bacteria | 2010 |
| 637 | Ga0496123_0064158 | 3300048926 | Bacteria | 2342 |
| 638 | Ga0496125_0006855 | 3300048928 | Bacteria | 12216 |
| 639 | Ga0496126_0022141 | 3300048929 | Bacteria | 6191 |
| 640 | Ga0501299_002955 | 3300049522 | Bacteria | 2409 |
| 641 | Ga0501034_0091519 | 3300049571 | Bacteria | 3039 |
| 642 | Ga0501040_0128101 | 3300049576 | Bacteria | 1784 |
| 643 | Ga0501043_0058263 | 3300049579 | Bacteria | 3032 |
| 644 | Ga0501046_0008079 | 3300049580 | Bacteria | 9197 |
| 645 | Ga0501046_0011500 | 3300049580 | Bacteria | 7567 |
| 646 | Ga0501069_0005025 | 3300049585 | Bacteria | 6860 |
| 647 | Ga0501070_0002408 | 3300049586 | Bacteria | 16402 |
| 648 | Ga0501070_0005681 | 3300049586 | Bacteria | 10636 |
| 649 | Ga0501217_011590 | 3300049661 | Bacteria | 1953 |
| 650 | Ga0501233_017831 | 3300049668 | Bacteria | 1486 |
| 651 | Ga0501239_004438 | 3300049672 | Bacteria | 1377 |
| 652 | Ga0501225_0025032 | 3300049705 | Bacteria | 1643 |
| 653 | Ga0501263_002074 | 3300049760 | Bacteria | 1999 |
| 654 | Ga0501044_0102179 | 3300049823 | Bacteria | 2883 |
| 655 | nmdc:mga05p37_10832_c1 | 3300050507 | Bacteria | 10827 |
| 656 | nmdc:mga05p37_11279_c1 | 3300050507 | Bacteria | 10628 |
| 657 | nmdc:mga05p37_1165_c1 | 3300050507 | Bacteria | 30287 |
| 658 | nmdc:mga05p37_117362_c1 | 3300050507 | Bacteria | 3270 |
| 659 | nmdc:mga05p37_132238_c1 | 3300050507 | Bacteria | 3061 |
| 660 | nmdc:mga05p37_27640_c2 | 3300050507 | Bacteria | 5351 |
| 661 | nmdc:mga05p37_338_c1 | 3300050507 | Bacteria | 50240 |
| 662 | nmdc:mga05p37_50113_c1 | 3300050507 | Bacteria | 5134 |
| 663 | nmdc:mga05p37_50822_c1 | 3300050507 | Bacteria | 3696 |
| 664 | nmdc:mga05p37_519542_c1 | 3300050507 | Bacteria | 1362 |
| 665 | nmdc:mga05p37_72964_c1 | 3300050507 | Bacteria | 4224 |
| 666 | nmdc:mga05p37_76966_c1 | 3300050507 | Bacteria | 4107 |
| 667 | nmdc:mga05p37_90747_c1 | 3300050507 | Bacteria | 3765 |
| 668 | nmdc:mga05p37_95439_c1 | 3300050507 | Bacteria | 3664 |
| 669 | nmdc:mga09592_130649_c1 | 3300050508 | Bacteria | 2161 |
| 670 | nmdc:mga09592_141707_c1 | 3300050508 | Bacteria | 2072 |
| 671 | nmdc:mga09592_17324_c1 | 3300050508 | Bacteria | 5902 |
| 672 | nmdc:mga0qj67_278446_c1 | 3300050509 | Bacteria | 1356 |
| 673 | nmdc:mga0qj67_89657_c1 | 3300050509 | Bacteria | 2470 |
| 674 | nmdc:mga06r32_114934_c1 | 3300050510 | Bacteria | 2650 |
| 675 | nmdc:mga06r32_120606_c1 | 3300050510 | Bacteria | 2586 |
| 676 | nmdc:mga06r32_20679_c1 | 3300050510 | Bacteria | 6062 |
| 677 | nmdc:mga06r32_4544_c1 | 3300050510 | Bacteria | 12434 |
| 678 | nmdc:mga08y16_19347_c1 | 3300050511 | Bacteria | 7178 |
| 679 | nmdc:mga08y16_23314_c1 | 3300050511 | Bacteria | 6537 |
| 680 | nmdc:mga08y16_30254_c1 | 3300050511 | Bacteria | 5700 |
| 681 | nmdc:mga08y16_34585_c1 | 3300050511 | Bacteria | 5309 |
| 682 | nmdc:mga08y16_3503_c1 | 3300050511 | Bacteria | 16297 |
| 683 | nmdc:mga08y16_355230_c1 | 3300050511 | Bacteria | 1505 |
| 684 | nmdc:mga08y16_418427_c1 | 3300050511 | Bacteria | 1370 |
| 685 | nmdc:mga08y16_47753_c1 | 3300050511 | Bacteria | 4481 |
| 686 | nmdc:mga08y16_5471_c1 | 3300050511 | Bacteria | 13281 |
| 687 | nmdc:mga08y16_717_c1 | 3300050511 | Bacteria | 31525 |
| 688 | nmdc:mga0n895_217096_c1 | 3300050512 | Bacteria | 1942 |
| 689 | nmdc:mga0n895_24209_c1 | 3300050512 | Bacteria | 5720 |
| 690 | nmdc:mga0n895_4_c1 | 3300050512 | Bacteria | 133851 |
| 691 | nmdc:mga0n895_71952_c1 | 3300050512 | Bacteria | 3429 |
| 692 | nmdc:mga0rr50_103115_c1 | 3300050513 | Bacteria | 2245 |
| 693 | nmdc:mga0rr50_2498_c1 | 3300050513 | Bacteria | 10398 |
| 694 | nmdc:mga0rr50_4_c1 | 3300050513 | Bacteria | 338870 |
| 695 | nmdc:mga08x19_102_c1 | 3300050514 | Bacteria | 75432 |
| 696 | nmdc:mga08x19_1094_c1 | 3300050514 | Bacteria | 16900 |
| 697 | nmdc:mga08x19_27075_c1 | 3300050514 | Bacteria | 3584 |
| 698 | nmdc:mga08x19_2_c1 | 3300050514 | Bacteria | 741277 |
| 699 | nmdc:mga08x19_45195_c1 | 3300050514 | Bacteria | 2814 |
| 700 | nmdc:mga08x19_81513_c1 | 3300050514 | Bacteria | 2125 |
| 701 | nmdc:mga0a205_125441_c1 | 3300050515 | Bacteria | 2466 |
| 702 | nmdc:mga0a205_125803_c1 | 3300050515 | Bacteria | 2463 |
| 703 | nmdc:mga0a205_20752_c1 | 3300050515 | Bacteria | 6205 |
| 704 | nmdc:mga0a205_229867_c1 | 3300050515 | Bacteria | 1738 |
| 705 | nmdc:mga0a205_346275_c1 | 3300050515 | Bacteria | 1354 |
| 706 | nmdc:mga0a205_38567_c1 | 3300050515 | Bacteria | 4596 |
| 707 | nmdc:mga0a205_6003_c1 | 3300050515 | Bacteria | 10950 |
| 708 | nmdc:mga0a205_83503_c1 | 3300050515 | Bacteria | 3085 |
| 709 | nmdc:mga0a205_92060_c1 | 3300050515 | Bacteria | 2930 |
| 710 | Ga0495601_0013126 | 3300053077 | Bacteria | 4979 |
| 711 | Ga0495619_0028505 | 3300053085 | Bacteria | 3602 |
| 712 | Ga0495619_0033268 | 3300053085 | Bacteria | 3348 |
| 713 | Ga0500647_0127564 | 3300053091 | Bacteria | 1201 |
| 714 | Ga0500604_0024330 | 3300053151 | Bacteria | 1733 |
| 715 | Ga0501084_0036866 | 3300054114 | Bacteria | 4085 |
| 716 | Ga0590071_000051 | 3300059421 | Bacteria | 31026 |
| 717 | Ga0590071_015920 | 3300059421 | Bacteria | 1764 |
| 718 | Ga0590075_000109 | 3300059424 | Bacteria | 21268 |
| 719 | Ga0590077_000102 | 3300059426 | Bacteria | 22388 |
| 720 | Ga0501082_0178622 | 3300060353 | Bacteria | 1846 |
| 721 | Ga0501082_0208170 | 3300060353 | Bacteria | 1702 |
| 722 | 2595088534 | 2593339131 | Bacteria | 5116855 |
| 723 | 2644717953 | 2643221731 | Bacteria | 5623886 |
| 724 | 2644724851 | 2643221732 | Bacteria | 5756404 |
| 725 | 2738814634 | 2738541295 | Bacteria | 5730091 |
| 726 | 2739268226 | 2738543017 | Bacteria | 4271950 |
| 727 | 2753766419 | 2751185897 | Bacteria | 5322941 |
| 728 | 2757565387 | 2757320391 | Bacteria | 4746095 |
| 729 | 2777763833 | 2775507177 | Bacteria | 4384303 |
| 730 | 2777837087 | 2775507192 | Bacteria | 4622234 |
| 731 | 2816863749 | 2816332186 | Bacteria | 5331395 |
| 732 | 2819707113 | 2818991465 | Bacteria | 5388835 |
| 733 | 2842685362 | 2842682962 | Bacteria | 5589973 |
| 734 | 2842882575 | 2842882022 | Bacteria | 6158489 |
| 735 | 2849140653 | 2849139964 | Bacteria | 5613304 |
| 736 | 2857584500 | 2857581216 | Bacteria | 5522813 |
| 737 | 2857588295 | 2857586860 | Bacteria | 4354574 |
| 738 | 2874609184 | 2874604998 | Bacteria | 7834745 |
| 739 | 2898909718 | 2898907183 | Bacteria | 4067722 |
| 740 | 2904526759 | 2904524088 | Bacteria | 5887454 |
| 741 | 2919144649 | 2919143609 | Bacteria | 6219228 |
| 742 | 2919519840 | 2919517244 | Bacteria | 5858162 |
| 743 | 2919720980 | 2919720352 | Bacteria | 5986006 |
| 744 | 2928095272 | 2928093941 | Bacteria | 5965005 |
| 745 | 2928513619 | 2928510474 | Bacteria | 4815308 |
| 746 | 2929008988 | 2929004312 | Bacteria | 5678476 |
| 747 | 2936342808 | 2936340661 | Bacteria | 5139038 |
| 748 | 2936365794 | 2936361878 | Bacteria | 5632809 |
| 749 | 2960324930 | 2960319331 | Bacteria | 5502575 |
| 750 | 2960377526 | 2960375949 | Bacteria | 5361395 |
| 751 | 2977257139 | 2977254563 | Bacteria | 4828420 |
| 752 | 2990278034 | 2990275345 | Bacteria | 4887158 |
| 753 | 8022897305 | 8022893055 | Bacteria | 5300455 |
| 754 | 8022919043 | 8022914991 | Bacteria | 5584517 |
| 755 | 8054280766 | 8054280661 | Bacteria | 4232245 |
| 756 | 8057634355 | 8057632132 | Bacteria | 4726859 |
| 757 | 8057736365 | 8057733483 | Bacteria | 6578323 |
| 758 | Ga0114129_10095874 | |||
| 759 | CNAas_1000010 | |||
| 760 | JGI24740J21852_10033568 | |||
| 761 | JGI24751J29686_10014474 | |||
| 762 | JGI25151J46595_10020935 | |||
| 763 | JGI25151J46595_10022122 | |||
| 764 | JGI25406J46586_10021821 | |||
| 765 | Ga0006562J51391_1001725 | |||
| 766 | Ga0055532_1000161 | |||
| 767 | Ga0055532_1006623 | |||
| 768 | Ga0055528_1002488 | |||
| 769 | Ga0065704_10162316 | |||
| 770 | Ga0065712_10113323 | |||
| 771 | Ga0065715_10095415 | |||
| 772 | Ga0065715_10128269 | |||
| 773 | Ga0065707_10001541 | |||
| 774 | Ga0065707_10007309 | |||
| 775 | Ga0070676_10050730 | |||
| 776 | Ga0070676_10109923 | |||
| 777 | Ga0070683_100001766 | |||
| 778 | Ga0070683_100019945 | |||
| 779 | Ga0070683_100020756 | |||
| 780 | Ga0070690_100021663 | |||
| 781 | Ga0070690_100031674 | |||
| 782 | Ga0070670_100144767 | |||
| 783 | Ga0070677_10033319 | |||
| 784 | Ga0068869_100105335 | |||
| 785 | Ga0070666_10113223 | |||
| 786 | Ga0070680_100021211 | |||
| 787 | Ga0070660_100000852 | |||
| 788 | Ga0070660_100007755 | |||
| 789 | Ga0070660_100029533 | |||
| 790 | Ga0070689_100130669 | |||
| 791 | Ga0070691_10041083 | |||
| 792 | Ga0070661_100021039 | |||
| 793 | Ga0070661_100187592 | |||
| 794 | Ga0070692_10001526 | |||
| 795 | Ga0070692_10005532 | |||
| 796 | Ga0070692_10158828 | |||
| 797 | Ga0070669_100000822 | |||
| 798 | Ga0070669_100007179 | |||
| 799 | Ga0070669_100016194 | |||
| 800 | Ga0070669_100016421 | |||
| 801 | Ga0070669_100034546 | |||
| 802 | Ga0070669_100123040 | |||
| 803 | Ga0070669_100165160 | |||
| 804 | Ga0070669_100166238 | |||
| 805 | Ga0070675_100000980 | |||
| 806 | Ga0070675_100002714 | |||
| 807 | Ga0070675_100080440 | |||
| 808 | Ga0070671_100018300 | |||
| 809 | Ga0070671_100193977 | |||
| 810 | Ga0070688_100034767 | |||
| 811 | Ga0070688_100174346 | |||
| 812 | Ga0070659_100113013 | |||
| 813 | Ga0070667_100173050 | |||
| 814 | Ga0070703_10001638 | |||
| 815 | Ga0070709_10100320 | |||
| 816 | Ga0070714_100000042 | |||
| 817 | Ga0070714_100008585 | |||
| 818 | Ga0070714_100177776 | |||
| 819 | Ga0070713_100010152 | |||
| 820 | Ga0070713_100109994 | |||
| 821 | Ga0070701_10032855 | |||
| 822 | Ga0070711_100000004 | |||
| 823 | Ga0070711_100006583 | |||
| 824 | Ga0070711_100035721 | |||
| 825 | Ga0070711_100165193 | |||
| 826 | Ga0070705_100010022 | |||
| 827 | Ga0070705_100019033 | |||
| 828 | Ga0070705_100021714 | |||
| 829 | Ga0070700_100008938 | |||
| 830 | Ga0070700_100010357 | |||
| 831 | Ga0070694_100001409 | |||
| 832 | Ga0070694_100004370 | |||
| 833 | Ga0070694_100078554 | |||
| 834 | Ga0070694_100084431 | |||
| 835 | Ga0070708_100002264 | |||
| 836 | Ga0070708_100019835 | |||
| 837 | Ga0070708_100090693 | |||
| 838 | Ga0070663_100019691 | |||
| 839 | Ga0070662_100074240 | |||
| 840 | Ga0070662_100207054 | |||
| 841 | Ga0070681_10040852 | |||
| 842 | Ga0070681_10071298 | |||
| 843 | Ga0068867_100073414 | |||
| 844 | Ga0068867_100222474 | |||
| 845 | Ga0070706_100009512 | |||
| 846 | Ga0070706_100011203 | |||
| 847 | Ga0070706_100021926 | |||
| 848 | Ga0070706_100033217 | |||
| 849 | Ga0070706_100281336 | |||
| 850 | Ga0070707_100001003 | |||
| 851 | Ga0070707_100017114 | |||
| 852 | Ga0070698_100005359 | |||
| 853 | Ga0070698_100042403 | |||
| 854 | Ga0070698_100090922 | |||
| 855 | Ga0070698_100245884 | |||
| 856 | Ga0070699_100147674 | |||
| 857 | Ga0070679_100188558 | |||
| 858 | Ga0070679_100192532 | |||
| 859 | Ga0070684_100009761 | |||
| 860 | Ga0070684_100016587 | |||
| 861 | Ga0070684_100113376 | |||
| 862 | Ga0070697_100001166 | |||
| 863 | Ga0070697_100001644 | |||
| 864 | Ga0070697_100128153 | |||
| 865 | Ga0070697_100267073 | |||
| 866 | Ga0070672_100115797 | |||
| 867 | Ga0070672_100128960 | |||
| 868 | Ga0070686_100001011 | |||
| 869 | Ga0070686_100019152 | |||
| 870 | Ga0070695_100001409 | |||
| 871 | Ga0070695_100021992 | |||
| 872 | Ga0070695_100031006 | |||
| 873 | Ga0070696_100002406 | |||
| 874 | Ga0070696_100003432 | |||
| 875 | Ga0070696_100019377 | |||
| 876 | Ga0070693_100002801 | |||
| 877 | Ga0070693_100004068 | |||
| 878 | Ga0070693_100134512 | |||
| 879 | Ga0070665_100013962 | |||
| 880 | Ga0070665_100079688 | |||
| 881 | Ga0070665_100182832 | |||
| 882 | Ga0070665_100228844 | |||
| 883 | Ga0070704_100081645 | |||
| 884 | Ga0068855_100000860 | |||
| 885 | Ga0068855_100147837 | |||
| 886 | Ga0068855_100212169 | |||
| 887 | Ga0070664_100000222 | |||
| 888 | Ga0068857_100038977 | |||
| 889 | Ga0068857_100151233 | |||
| 890 | Ga0068857_100220036 | |||
| 891 | Ga0070702_100022199 | |||
| 892 | Ga0068859_100040718 | |||
| 893 | Ga0068859_100065301 | |||
| 894 | Ga0068859_100151055 | |||
| 895 | Ga0068859_100154208 | |||
| 896 | Ga0068859_100166921 | |||
| 897 | Ga0068864_100011022 | |||
| 898 | Ga0068864_100320119 | |||
| 899 | Ga0068866_10012480 | |||
| 900 | Ga0068861_100055707 | |||
| 901 | Ga0068861_100058309 | |||
| 902 | Ga0068861_100110009 | |||
| 903 | Ga0068863_100001797 | |||
| 904 | Ga0068863_100098514 | |||
| 905 | Ga0068863_100115669 | |||
| 906 | Ga0068858_100008882 | |||
| 907 | Ga0068858_100012838 | |||
| 908 | Ga0068858_100016085 | |||
| 909 | Ga0068858_100225307 | |||
| 910 | Ga0068860_100038658 | |||
| 911 | Ga0068860_100066375 | |||
| 912 | Ga0068860_100215385 | |||
| 913 | Ga0068862_100091191 | |||
| 914 | Ga0068862_100175256 | |||
| 915 | Ga0081455_10106957 | |||
| 916 | Ga0081538_10013858 | |||
| 917 | Ga0081539_10000977 | |||
| 918 | Ga0081539_10012072 | |||
| 919 | Ga0070717_10097772 | |||
| 920 | Ga0070715_10000005 | |||
| 921 | Ga0070712_100048021 | |||
| 922 | Ga0097621_100003251 | |||
| 923 | Ga0097621_100135745 | |||
| 924 | Ga0068871_100003400 | |||
| 925 | Ga0068871_100011972 | |||
| 926 | Ga0068871_100210148 | |||
| 927 | Ga0075428_100024598 | |||
| 928 | Ga0075428_100032701 | |||
| 929 | Ga0075428_100034272 | |||
| 930 | Ga0075428_100070521 | |||
| 931 | Ga0075430_100013445 | |||
| 932 | Ga0075430_100206833 | |||
| 933 | Ga0075431_100007090 | |||
| 934 | Ga0075431_100026761 | |||
| 935 | Ga0075431_100135097 | |||
| 936 | Ga0075433_10057621 | |||
| 937 | Ga0075433_10066765 | |||
| 938 | Ga0075433_10068543 | |||
| 939 | Ga0075433_10201513 | |||
| 940 | Ga0075433_10333143 | |||
| 941 | Ga0075434_100000023 | |||
| 942 | Ga0075434_100003264 | |||
| 943 | Ga0075434_100020114 | |||
| 944 | Ga0075434_100169912 | |||
| 945 | Ga0075434_100305615 | |||
| 946 | Ga0075429_100005407 | |||
| 947 | Ga0075429_100081098 | |||
| 948 | Ga0068865_100005219 | |||
| 949 | Ga0075436_100000570 | |||
| 950 | Ga0075436_100000624 | |||
| 951 | Ga0075436_100010079 | |||
| 952 | Ga0075436_100016434 | |||
| 953 | Ga0075436_100057077 | |||
| 954 | Ga0097620_100040718 | |||
| 955 | Ga0097620_100065301 | |||
| 956 | Ga0097620_100151064 | |||
| 957 | Ga0097620_100154204 | |||
| 958 | Ga0097620_100166919 | |||
| 959 | Ga0075435_100000037 | |||
| 960 | Ga0075435_100003062 | |||
| 961 | Ga0075435_100196538 | |||
| 962 | Ga0099794_10017963 | |||
| 963 | Ga0099794_10023938 | |||
| 964 | Ga0099794_10093358 | |||
| 965 | Ga0099794_10102280 | |||
| 966 | Ga0105240_10201803 | |||
| 967 | Ga0105240_10301717 | |||
| 968 | Ga0111539_10001215 | |||
| 969 | Ga0111539_10005649 | |||
| 970 | Ga0111539_10005752 | |||
| 971 | Ga0111539_10007447 | |||
| 972 | Ga0111539_10017186 | |||
| 973 | Ga0111539_10031675 | |||
| 974 | Ga0111539_10043759 | |||
| 975 | Ga0111539_10103045 | |||
| 976 | Ga0111539_10165371 | |||
| 977 | Ga0111539_10208103 | |||
| 978 | Ga0111539_10325843 | |||
| 979 | Ga0105245_10241979 | |||
| 980 | Ga0105245_10405480 | |||
| 981 | Ga0114129_10000532 | |||
| 982 | Ga0114129_10007870 | |||
| 983 | Ga0114129_10008261 | |||
| 984 | Ga0114129_10008651 | |||
| 985 | Ga0114129_10010720 | |||
| 986 | Ga0114129_10021723 | |||
| 987 | Ga0114129_10030805 | |||
| 988 | Ga0114129_10062240 | |||
| 989 | Ga0114129_10094397 | |||
| 990 | Ga0114129_10103681 | |||
| 991 | Ga0114129_10302332 | |||
| 992 | Ga0114129_10357466 | |||
| 993 | Ga0105243_10001313 | |||
| 994 | Ga0105243_10047886 | |||
| 995 | Ga0105243_10156139 | |||
| 996 | Ga0105241_10031532 | |||
| 997 | Ga0105242_10000997 | |||
| 998 | Ga0105242_10009632 | |||
| 999 | Ga0105242_10271424 | |||
| 1000 | Ga0105248_10015013 | |||
| 1001 | Ga0105248_10057589 | |||
| 1002 | Ga0105248_10082497 | |||
| 1003 | Ga0105248_10115731 | |||
| 1004 | Ga0105248_10197391 | |||
| 1005 | Ga0105248_10222613 | |||
| 1006 | Ga0105248_10539129 | |||
| 1007 | Ga0105237_10151569 | |||
| 1008 | Ga0105238_10070537 | |||
| 1009 | Ga0105238_10108114 | |||
| 1010 | Ga0105249_10104503 | |||
| 1011 | Ga0099796_10025194 | |||
| 1012 | Ga0157371_10023407 | |||
| 1013 | Ga0157371_10033303 | |||
| 1014 | Ga0157370_10068492 | |||
| 1015 | Ga0157369_10005912 | |||
| 1016 | Ga0157369_10010082 | |||
| 1017 | Ga0157369_10233964 | |||
| 1018 | Ga0157374_10256241 | |||
| 1019 | Ga0163162_10023280 | |||
| 1020 | Ga0157372_10059428 | |||
| 1021 | Ga0157372_10360868 | |||
| 1022 | Ga0163163_10019122 | |||
| 1023 | Ga0163163_10077488 | |||
| 1024 | Ga0157380_10004771 | |||
| 1025 | Ga0157380_10021373 | |||
| 1026 | Ga0157380_10023408 | |||
| 1027 | Ga0157380_10038123 | |||
| 1028 | Ga0157377_10038323 | |||
| 1029 | Ga0157379_10001085 | |||
| 1030 | Ga0157379_10044723 | |||
| 1031 | Ga0157376_10003868 | |||
| 1032 | Ga0157376_10029040 | |||
| 1033 | Ga0157376_10086649 | |||
| 1034 | Ga0157376_10097675 | |||
| 1035 | Ga0163161_10051920 | |||
| 1036 | Ga0213876_10000057 | |||
| 1037 | Ga0213876_10000172 | |||
| 1038 | Ga0228598_1000025 | |||
| 1039 | Ga0228598_1005065 | |||
| 1040 | Ga0209566_100189 | |||
| 1041 | Ga0209147_100222 | |||
| 1042 | Ga0209147_100408 | |||
| 1043 | Ga0209258_103941 | |||
| 1044 | Ga0209673_1012288 | |||
| 1045 | Ga0209025_1000127 | |||
| 1046 | Ga0209025_1000568 | |||
| 1047 | Ga0209025_1001477 | |||
| 1048 | Ga0209025_1003847 | |||
| 1049 | Ga0209025_1004999 | |||
| 1050 | Ga0209025_1011725 | |||
| 1051 | Ga0209025_1018270 | |||
| 1052 | Ga0209025_1019288 | |||
| 1053 | Ga0207697_10009622 | |||
| 1054 | Ga0207696_1008193 | |||
| 1055 | Ga0207653_10002016 | |||
| 1056 | Ga0207682_10024480 | |||
| 1057 | Ga0207680_10054194 | |||
| 1058 | Ga0207647_10018632 | |||
| 1059 | Ga0207647_10057778 | |||
| 1060 | Ga0207685_10000026 | |||
| 1061 | Ga0207699_10070043 | |||
| 1062 | Ga0207645_10001021 | |||
| 1063 | Ga0207645_10028529 | |||
| 1064 | Ga0207645_10173344 | |||
| 1065 | Ga0207705_10000648 | |||
| 1066 | Ga0207705_10001745 | |||
| 1067 | Ga0207705_10003867 | |||
| 1068 | Ga0207684_10015939 | |||
| 1069 | Ga0207684_10017140 | |||
| 1070 | Ga0207684_10024307 | |||
| 1071 | Ga0207684_10128245 | |||
| 1072 | Ga0207707_10325626 | |||
| 1073 | Ga0207695_10090405 | |||
| 1074 | Ga0207695_10098606 | |||
| 1075 | Ga0207693_10061849 | |||
| 1076 | Ga0207663_10000007 | |||
| 1077 | Ga0207663_10004341 | |||
| 1078 | Ga0207663_10011482 | |||
| 1079 | Ga0207663_10098338 | |||
| 1080 | Ga0207660_10179723 | |||
| 1081 | Ga0207662_10002970 | |||
| 1082 | Ga0207662_10037194 | |||
| 1083 | Ga0207657_10001247 | |||
| 1084 | Ga0207657_10001696 | |||
| 1085 | Ga0207657_10118582 | |||
| 1086 | Ga0207646_10000165 | |||
| 1087 | Ga0207646_10105599 | |||
| 1088 | Ga0207681_10016455 | |||
| 1089 | Ga0207681_10032205 | |||
| 1090 | Ga0207681_10095856 | |||
| 1091 | Ga0207681_10210456 | |||
| 1092 | Ga0207694_10119731 | |||
| 1093 | Ga0207650_10110218 | |||
| 1094 | Ga0207650_10125836 | |||
| 1095 | Ga0207659_10001618 | |||
| 1096 | Ga0207659_10138134 | |||
| 1097 | Ga0207700_10023389 | |||
| 1098 | Ga0207700_10057336 | |||
| 1099 | Ga0207664_10000037 | |||
| 1100 | Ga0207664_10153081 | |||
| 1101 | Ga0207644_10075116 | |||
| 1102 | Ga0207644_10142530 | |||
| 1103 | Ga0207690_10038910 | |||
| 1104 | Ga0207706_10095895 | |||
| 1105 | Ga0207686_10000208 | |||
| 1106 | Ga0207686_10070026 | |||
| 1107 | Ga0207686_10169196 | |||
| 1108 | Ga0207709_10000029 | |||
| 1109 | Ga0207669_10011976 | |||
| 1110 | Ga0207704_10016402 | |||
| 1111 | Ga0207665_10005191 | |||
| 1112 | Ga0207691_10007228 | |||
| 1113 | Ga0207691_10016335 | |||
| 1114 | Ga0207711_10053569 | |||
| 1115 | Ga0207711_10067280 | |||
| 1116 | Ga0207711_10166136 | |||
| 1117 | Ga0207689_10059057 | |||
| 1118 | Ga0207689_10065897 | |||
| 1119 | Ga0207689_10099778 | |||
| 1120 | Ga0207679_10020392 | |||
| 1121 | Ga0207667_10010703 | |||
| 1122 | Ga0207667_10186565 | |||
| 1123 | Ga0207667_10261311 | |||
| 1124 | Ga0207651_10161753 | |||
| 1125 | Ga0207712_10153811 | |||
| 1126 | Ga0207658_10133343 | |||
| 1127 | Ga0207703_10010431 | |||
| 1128 | Ga0207703_10026965 | |||
| 1129 | Ga0207703_10094455 | |||
| 1130 | Ga0207703_10209745 | |||
| 1131 | Ga0207678_10003131 | |||
| 1132 | Ga0207708_10002277 | |||
| 1133 | Ga0207708_10002474 | |||
| 1134 | Ga0207641_10001646 | |||
| 1135 | Ga0207641_10073196 | |||
| 1136 | Ga0207641_10150592 | |||
| 1137 | Ga0207648_10010792 | |||
| 1138 | Ga0207648_10013697 | |||
| 1139 | Ga0207648_10219657 | |||
| 1140 | Ga0207674_10017639 | |||
| 1141 | Ga0207674_10104184 | |||
| 1142 | Ga0207675_100000537 | |||
| 1143 | Ga0207675_100003240 | |||
| 1144 | Ga0207675_100005081 | |||
| 1145 | Ga0207675_100123314 | |||
| 1146 | Ga0207675_100193252 | |||
| 1147 | Ga0209588_1002959 | |||
| 1148 | Ga0207428_10001989 | |||
| 1149 | Ga0207428_10002691 | |||
| 1150 | Ga0207428_10003496 | |||
| 1151 | Ga0207428_10003822 | |||
| 1152 | Ga0207428_10034376 | |||
| 1153 | Ga0265354_1000043 | |||
| 1154 | Ga0265354_1002430 | |||
| 1155 | Ga0268266_10008285 | |||
| 1156 | Ga0268266_10073992 | |||
| 1157 | Ga0268266_10074202 | |||
| 1158 | Ga0268266_10210234 | |||
| 1159 | Ga0268265_10018307 | |||
| 1160 | Ga0268265_10068984 | |||
| 1161 | Ga0268264_10029562 | |||
| 1162 | Ga0268264_10150901 | |||
| 1163 | Ga0265770_1000453 | |||
| 1164 | Ga0265770_1001641 | |||
| 1165 | Ga0265765_1001703 | |||
| 1166 | Ga0265760_10002254 | |||
| 1167 | Ga0265760_10012555 | |||
| 1168 | Ga0307408_100064758 | |||
| 1169 | Ga0307408_100069761 | |||
| 1170 | Ga0307408_100131645 | |||
| 1171 | Ga0307405_10012489 | |||
| 1172 | Ga0307405_10014705 | |||
| 1173 | Ga0307405_10032782 | |||
| 1174 | Ga0307413_10000475 | |||
| 1175 | Ga0307413_10034252 | |||
| 1176 | Ga0307413_10035627 | |||
| 1177 | Ga0307413_10072258 | |||
| 1178 | Ga0307413_10114127 | |||
| 1179 | Ga0307410_10002922 | |||
| 1180 | Ga0307410_10011383 | |||
| 1181 | Ga0307410_10030355 | |||
| 1182 | Ga0307410_10137218 | |||
| 1183 | Ga0307410_10210775 | |||
| 1184 | Ga0307406_10049041 | |||
| 1185 | Ga0307406_10065609 | |||
| 1186 | Ga0307407_10000478 | |||
| 1187 | Ga0307407_10130235 | |||
| 1188 | Ga0307412_10028184 | |||
| 1189 | Ga0307412_10029476 | |||
| 1190 | Ga0307412_10209886 | |||
| 1191 | Ga0307409_100003586 | |||
| 1192 | Ga0307409_100007722 | |||
| 1193 | Ga0307409_100065669 | |||
| 1194 | Ga0307409_100138304 | |||
| 1195 | Ga0307409_100172712 | |||
| 1196 | Ga0307416_100022589 | |||
| 1197 | Ga0307416_100066510 | |||
| 1198 | Ga0307416_100080025 | |||
| 1199 | Ga0307416_100083060 | |||
| 1200 | Ga0307416_100100436 | |||
| 1201 | Ga0307416_100101098 | |||
| 1202 | Ga0307416_100106904 | |||
| 1203 | Ga0307416_100134513 | |||
| 1204 | Ga0307414_10007713 | |||
| 1205 | Ga0307414_10014163 | |||
| 1206 | Ga0307414_10068510 | |||
| 1207 | Ga0307414_10191275 | |||
| 1208 | Ga0307414_10245558 | |||
| 1209 | Ga0307411_10001105 | |||
| 1210 | Ga0307411_10017673 | |||
| 1211 | Ga0307411_10020174 | |||
| 1212 | Ga0307415_100002385 | |||
| 1213 | Ga0307415_100015437 | |||
| 1214 | Ga0307415_100026378 | |||
| 1215 | Ga0307415_100099242 | |||
| 1216 | Ga0373950_0007628 | |||
| 1217 | Ga0373938_0003512 | |||
| 1218 | Ga0373926_0006393 | |||
| 1219 | Ga0373926_0071066 | |||
| 1220 | Ga0373928_0013148 | |||
| 1221 | Ga0373934_0028713 | |||
| 1222 | Ga0373940_0000100 | |||
| 1223 | Ga0373949_0004862 | |||
| 1224 | Ga0373951_0001096 | |||
| 1225 | Ga0373952_0000066 | |||
| 1226 | Ga0373923_0012504 | |||
| 1227 | Ga0373932_0005597 | |||
| 1228 | Ga0373939_0001899 | |||
| 1229 | Ga0373941_0014160 | |||
| 1230 | Ga0373945_0027709 | |||
| 1231 | Ga0373953_0046195 | |||
| 1232 | Ga0373960_0000575 | |||
| 1233 | Ga0373943_0000346 | |||
| 1234 | Ga0373943_0040201 | |||
| 1235 | Ga0373946_0001109 | |||
| 1236 | Ga0373955_0015102 | |||
| 1237 | Ga0373942_0004904 | |||
| 1238 | Ga0373961_0005994 | |||
| 1239 | Ga0373962_0001444 | |||
| 1240 | Ga0373924_0000090 | |||
| 1241 | Ga0373924_0000745 | |||
| 1242 | Ga0373924_0025464 | |||
| 1243 | Ga0373924_0043785 | |||
| 1244 | Ga0373931_0001298 | |||
| 1245 | Ga0373931_0063533 | |||
| 1246 | Ga0373935_0003926 | |||
| 1247 | Ga0373935_0037132 | |||
| 1248 | Ga0373927_0000206 | |||
| 1249 | Ga0373927_0000276 | |||
| 1250 | Ga0373927_0007405 | |||
| 1251 | Ga0373927_0014703 | |||
| 1252 | Ga0373927_0037217 | |||
| 1253 | Ga0373927_0053782 | |||
| 1254 | Ga0373933_0000301 | |||
| 1255 | Ga0373933_0167662 | |||
| 1256 | Ga0373947_0000122 | |||
| 1257 | Ga0373947_0000282 | |||
| 1258 | Ga0373947_0108408 | |||
| 1259 | Ga0373937_0000288 | |||
| 1260 | Ga0373937_0007732 | |||
| 1261 | Ga0373937_0100131 | |||
| 1262 | Ga0373937_0137368 | |||
| 1263 | Ga0373937_0442713 | |||
| 1264 | Ga0373925_0000103 | |||
| 1265 | Ga0373925_0000934 | |||
| 1266 | Ga0373925_0038257 | |||
| 1267 | Ga0373925_0070966 | |||
| 1268 | Ga0373925_0338171 | |||
| 1269 | Ga0395899_0004515 | |||
| 1270 | Ga0395899_0043639 | |||
| 1271 | Ga0395900_0000777 | |||
| 1272 | Ga0395898_0015202 | |||
| 1273 | Ga0395898_0064107 | |||
| 1274 | Ga0395905_0183418 | |||
| 1275 | Ga0395905_0386107 | |||
| 1276 | Ga0395901_0006976 | |||
| 1277 | Ga0400483_137280 | |||
| 1278 | Ga0400483_206430 | |||
| 1279 | Ga0436365_1041616 | |||
| 1280 | Ga0436365_1521843 | |||
| 1281 | Ga0436365_1928925 | |||
| 1282 | Ga0439433_0005733 | |||
| 1283 | Ga0453683_0003399 | |||
| 1284 | Ga0453683_0043010 | |||
| 1285 | Ga0453683_0083804 | |||
| 1286 | Ga0466963_0186800 | |||
| 1287 | Ga0453684_0006038 | |||
| 1288 | Ga0453684_0179507 | |||
| 1289 | Ga0453684_0403315 | |||
| 1290 | Ga0466957_0078266 | |||
| 1291 | Ga0466959_0038379 | |||
| 1292 | Ga0451576_0183014 | |||
| 1293 | Ga0451576_0278924 | |||
| 1294 | Ga0466967_0001131 | |||
| 1295 | Ga0495629_0063427 | |||
| 1296 | Ga0495651_0008643 | |||
| 1297 | Ga0495580_0019767 | |||
| 1298 | Ga0495580_0096140 | |||
| 1299 | Ga0495580_0117149 | |||
| 1300 | Ga0495580_0154089 | |||
| 1301 | Ga0495582_0161517 | |||
| 1302 | Ga0495664_0002852 | |||
| 1303 | Ga0495664_0003856 | |||
| 1304 | Ga0495585_0018584 | |||
| 1305 | Ga0495608_0005145 | |||
| 1306 | Ga0495608_0019436 | |||
| 1307 | Ga0495618_0011895 | |||
| 1308 | Ga0495618_0126032 | |||
| 1309 | Ga0495628_0033769 | |||
| 1310 | Ga0495628_0161114 | |||
| 1311 | Ga0495628_0248046 | |||
| 1312 | Ga0495630_0002908 | |||
| 1313 | Ga0495630_0124808 | |||
| 1314 | Ga0495630_0130827 | |||
| 1315 | Ga0495663_0017588 | |||
| 1316 | Ga0495652_0005051 | |||
| 1317 | Ga0495665_0037808 | |||
| 1318 | Ga0495640_0065239 | |||
| 1319 | Ga0495640_0122168 | |||
| 1320 | Ga0495586_0159106 | |||
| 1321 | Ga0495587_0000157 | |||
| 1322 | Ga0495587_0017031 | |||
| 1323 | Ga0495598_0013761 | |||
| 1324 | Ga0495645_0001995 | |||
| 1325 | Ga0495645_0009754 | |||
| 1326 | Ga0495645_0098574 | |||
| 1327 | Ga0495645_0176861 | |||
| 1328 | Ga0495633_0012417 | |||
| 1329 | Ga0495667_0010475 | |||
| 1330 | Ga0495668_0109500 | |||
| 1331 | Ga0495635_0040764 | |||
| 1332 | Ga0495599_0015224 | |||
| 1333 | Ga0495599_0022903 | |||
| 1334 | Ga0495646_0038807 | |||
| 1335 | Ga0495647_0031398 | |||
| 1336 | Ga0495658_0044613 | |||
| 1337 | Ga0495669_0029222 | |||
| 1338 | Ga0495613_0000975 | |||
| 1339 | Ga0495613_0072602 | |||
| 1340 | Ga0495600_0066149 | |||
| 1341 | Ga0495581_0026269 | |||
| 1342 | Ga0495604_0030764 | |||
| 1343 | Ga0495604_0037249 | |||
| 1344 | Ga0495604_0069462 | |||
| 1345 | Ga0495604_0127199 | |||
| 1346 | Ga0495674_0044282 | |||
| 1347 | Ga0495674_0067232 | |||
| 1348 | Ga0495674_0107073 | |||
| 1349 | Ga0495674_0111913 | |||
| 1350 | Ga0495680_0097390 | |||
| 1351 | Ga0495675_0000271 | |||
| 1352 | Ga0495675_0075258 | |||
| 1353 | Ga0495675_0126630 | |||
| 1354 | Ga0495684_0000140 | |||
| 1355 | Ga0495602_0000436 | |||
| 1356 | Ga0495602_0197422 | |||
| 1357 | Ga0496101_0001225 | |||
| 1358 | Ga0496102_0003727 | |||
| 1359 | Ga0496103_0034893 | |||
| 1360 | Ga0496104_0001234 | |||
| 1361 | Ga0496104_0016644 | |||
| 1362 | Ga0496104_0017205 | |||
| 1363 | Ga0496105_0000459 | |||
| 1364 | Ga0496105_0001553 | |||
| 1365 | Ga0496105_0030664 | |||
| 1366 | Ga0496106_0078251 | |||
| 1367 | Ga0496106_0253012 | |||
| 1368 | Ga0496107_0000344 | |||
| 1369 | Ga0496108_0003238 | |||
| 1370 | Ga0496108_0016078 | |||
| 1371 | Ga0496108_0032273 | |||
| 1372 | Ga0496108_0173347 | |||
| 1373 | Ga0496109_0000017 | |||
| 1374 | Ga0496109_0002270 | |||
| 1375 | Ga0496109_0006048 | |||
| 1376 | Ga0496110_0000702 | |||
| 1377 | Ga0496110_0001502 | |||
| 1378 | Ga0496111_0000975 | |||
| 1379 | Ga0496111_0065963 | |||
| 1380 | Ga0496111_0116269 | |||
| 1381 | Ga0496111_0182539 | |||
| 1382 | Ga0496112_0045473 | |||
| 1383 | Ga0496112_0048345 | |||
| 1384 | Ga0496112_0266584 | |||
| 1385 | Ga0496113_0002031 | |||
| 1386 | Ga0496113_0013697 | |||
| 1387 | Ga0496113_0037688 | |||
| 1388 | Ga0496113_0043798 | |||
| 1389 | Ga0496115_0069688 | |||
| 1390 | Ga0496116_0074330 | |||
| 1391 | Ga0496117_0024889 | |||
| 1392 | Ga0496119_0014455 | |||
| 1393 | Ga0496122_0095370 | |||
| 1394 | Ga0496123_0064158 | |||
| 1395 | Ga0496125_0006855 | |||
| 1396 | Ga0496126_0022141 | |||
| 1397 | Ga0501299_002955 | |||
| 1398 | Ga0501034_0091519 | |||
| 1399 | Ga0501040_0128101 | |||
| 1400 | Ga0501043_0058263 | |||
| 1401 | Ga0501046_0008079 | |||
| 1402 | Ga0501046_0011500 | |||
| 1403 | Ga0501069_0005025 | |||
| 1404 | Ga0501070_0002408 | |||
| 1405 | Ga0501070_0005681 | |||
| 1406 | Ga0501217_011590 | |||
| 1407 | Ga0501233_017831 | |||
| 1408 | Ga0501239_004438 | |||
| 1409 | Ga0501225_0025032 | |||
| 1410 | Ga0501263_002074 | |||
| 1411 | Ga0501044_0102179 | |||
| 1412 | nmdc:mga05p37_10832_c1 | |||
| 1413 | nmdc:mga05p37_11279_c1 | |||
| 1414 | nmdc:mga05p37_1165_c1 | |||
| 1415 | nmdc:mga05p37_117362_c1 | |||
| 1416 | nmdc:mga05p37_132238_c1 | |||
| 1417 | nmdc:mga05p37_27640_c2 | |||
| 1418 | nmdc:mga05p37_338_c1 | |||
| 1419 | nmdc:mga05p37_50113_c1 | |||
| 1420 | nmdc:mga05p37_50822_c1 | |||
| 1421 | nmdc:mga05p37_519542_c1 | |||
| 1422 | nmdc:mga05p37_72964_c1 | |||
| 1423 | nmdc:mga05p37_76966_c1 | |||
| 1424 | nmdc:mga05p37_90747_c1 | |||
| 1425 | nmdc:mga05p37_95439_c1 | |||
| 1426 | nmdc:mga09592_130649_c1 | |||
| 1427 | nmdc:mga09592_141707_c1 | |||
| 1428 | nmdc:mga09592_17324_c1 | |||
| 1429 | nmdc:mga0qj67_278446_c1 | |||
| 1430 | nmdc:mga0qj67_89657_c1 | |||
| 1431 | nmdc:mga06r32_114934_c1 | |||
| 1432 | nmdc:mga06r32_120606_c1 | |||
| 1433 | nmdc:mga06r32_20679_c1 | |||
| 1434 | nmdc:mga06r32_4544_c1 | |||
| 1435 | nmdc:mga08y16_19347_c1 | |||
| 1436 | nmdc:mga08y16_23314_c1 | |||
| 1437 | nmdc:mga08y16_30254_c1 | |||
| 1438 | nmdc:mga08y16_34585_c1 | |||
| 1439 | nmdc:mga08y16_3503_c1 | |||
| 1440 | nmdc:mga08y16_355230_c1 | |||
| 1441 | nmdc:mga08y16_418427_c1 | |||
| 1442 | nmdc:mga08y16_47753_c1 | |||
| 1443 | nmdc:mga08y16_5471_c1 | |||
| 1444 | nmdc:mga08y16_717_c1 | |||
| 1445 | nmdc:mga0n895_217096_c1 | |||
| 1446 | nmdc:mga0n895_24209_c1 | |||
| 1447 | nmdc:mga0n895_4_c1 | |||
| 1448 | nmdc:mga0n895_71952_c1 | |||
| 1449 | nmdc:mga0rr50_103115_c1 | |||
| 1450 | nmdc:mga0rr50_2498_c1 | |||
| 1451 | nmdc:mga0rr50_4_c1 | |||
| 1452 | nmdc:mga08x19_102_c1 | |||
| 1453 | nmdc:mga08x19_1094_c1 | |||
| 1454 | nmdc:mga08x19_27075_c1 | |||
| 1455 | nmdc:mga08x19_2_c1 | |||
| 1456 | nmdc:mga08x19_45195_c1 | |||
| 1457 | nmdc:mga08x19_81513_c1 | |||
| 1458 | nmdc:mga0a205_125441_c1 | |||
| 1459 | nmdc:mga0a205_125803_c1 | |||
| 1460 | nmdc:mga0a205_20752_c1 | |||
| 1461 | nmdc:mga0a205_229867_c1 | |||
| 1462 | nmdc:mga0a205_346275_c1 | |||
| 1463 | nmdc:mga0a205_38567_c1 | |||
| 1464 | nmdc:mga0a205_6003_c1 | |||
| 1465 | nmdc:mga0a205_83503_c1 | |||
| 1466 | nmdc:mga0a205_92060_c1 | |||
| 1467 | Ga0495601_0013126 | |||
| 1468 | Ga0495619_0028505 | |||
| 1469 | Ga0495619_0033268 | |||
| 1470 | Ga0500647_0127564 | |||
| 1471 | Ga0500604_0024330 | |||
| 1472 | Ga0501084_0036866 | |||
| 1473 | Ga0590071_000051 | |||
| 1474 | Ga0590071_015920 | |||
| 1475 | Ga0590075_000109 | |||
| 1476 | Ga0590077_000102 | |||
| 1477 | Ga0501082_0178622 | |||
| 1478 | Ga0501082_0208170 | |||
| 1479 | 2595088534 | |||
| 1480 | 2644717953 | |||
| 1481 | 2644724851 | |||
| 1482 | 2738814634 | |||
| 1483 | 2739268226 | |||
| 1484 | 2753766419 | |||
| 1485 | 2757565387 | |||
| 1486 | 2777763833 | |||
| 1487 | 2777837087 | |||
| 1488 | 2816863749 | |||
| 1489 | 2819707113 | |||
| 1490 | 2842685362 | |||
| 1491 | 2842882575 | |||
| 1492 | 2849140653 | |||
| 1493 | 2857584500 | |||
| 1494 | 2857588295 | |||
| 1495 | 2874609184 | |||
| 1496 | 2898909718 | |||
| 1497 | 2904526759 | |||
| 1498 | 2919144649 | |||
| 1499 | 2919519840 | |||
| 1500 | 2919720980 | |||
| 1501 | 2928095272 | |||
| 1502 | 2928513619 | |||
| 1503 | 2929008988 | |||
| 1504 | 2936342808 | |||
| 1505 | 2936365794 | |||
| 1506 | 2960324930 | |||
| 1507 | 2960377526 | |||
| 1508 | 2977257139 | |||
| 1509 | 2990278034 | |||
| 1510 | 8022897305 | |||
| 1511 | 8022919043 | |||
| 1512 | 8054280766 | |||
| 1513 | 8057634355 | |||
| 1514 | 8057736365 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hr3-assembly1.cif.gz_A | structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus | 0.9695 | 2 | 397 |
| 2wbi-assembly1.cif.gz_A-2 | crystal structure of human acyl-coa dehydrogenase 11 | 0.9666 | 4 | 400 |
| 4hr3-assembly1.cif.gz_A | structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus | 0.9576 | 2 | 397 |
| 2wbi-assembly1.cif.gz_A-2 | crystal structure of human acyl-coa dehydrogenase 11 | 0.957 | 4 | 400 |
| 2wbi-assembly1.cif.gz_B-2 | crystal structure of human acyl-coa dehydrogenase 11 | 0.9514 | 4 | 400 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96831_241_401_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9917 | 246 | 394 | 1.20.140.10 |
| af_Q8K370_905_1064_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9827 | 244 | 399 | 1.20.140.10 |
| af_Q6JQN1_657_789_1.10.540.10 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9797 | 3 | 128 | 1.10.540.10 |
| af_P96808_263_418_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9745 | 249 | 397 | 1.20.140.10 |
| af_B3DMA2_618_779_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9735 | 244 | 400 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E4VLD0-F1-model_v4 | deleted | 0.994 | 263 | 397 |
|
| AF-A0A3B9BL99-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9893 | 259 | 400 |
GO:0003995
GO:0005737 GO:0033539 |
| AF-A0A2D7ALT0-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9887 | 1 | 397 |
GO:0003995
GO:0005737 GO:0033539 GO:0050660 |
| AF-H2Z028-F1-model_v4 | Acyl-CoA dehydrogenase family member 11 | 0.9879 | 4 | 395 |
GO:0003995
GO:0005777 GO:0031966 GO:0033539 GO:0050660 |
| AF-A0A840N4I1-F1-model_v4 | Alkylation response protein AidB-like acyl-CoA dehydrogenase | 0.9876 | 263 | 399 |
GO:0003995
GO:0005737 GO:0033539 |