F479386

General Info

Members Datasets Scaffolds Average Seq Length
757 359 1514 405

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10095874|Ga0114129_100958742
Length 412
Sequence MRGMHFEHSEKAKDLQRRVQAFMDEHIYPNEATYHDQIAEGDRWQPIPIIEQLKPKARAAKLWNLFLPASEYGAGLTNVEYAPLCEIMGRVPGFAAEVFNCSAPDTGNMEVLVRYGTDAQRTQWLEPLLAGEIRSCFAMTEPDVASSDATNIRSSIARDVAHGDAYVINGCKWWISGAGDPRCKIAIFMGKSNPDAPKHQQQSMVLVPMETPGVTIRRLLPVFGYDDAPHGHAEITFENVRVPASNMLLGEGRGFEIAQGRLGPGRIHHCMRLIGVAERALEAMCARVTKRIAFGKPLAEQGTIRADIAESRMEIEQARLLTMKAAYLMDTVGNKAARGEIAMIKVVVPRMALRVLDRAIQAHGAAGVSADFPLAAAWAHTRTIRLADGPDEVHREAIAKLELGKSHWAEKR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
199 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
206 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
211 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
212 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
301 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
302 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
325 2643221731 Bacillus sp. Root147 Isolate Unclassified
326 2643221732 Bacillus sp. Root239 Isolate Unclassified
327 2738541295 Bacillus sp. OK085 Isolate Unclassified
328 2738543017 Bacillus sp. OV186 Isolate Unclassified
329 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
330 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
331 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
332 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
333 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
334 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
335 2842682962 Bacillus sp. R-72492 Isolate Unclassified
336 2842882022 Bacillus sp. R-71893 Isolate Unclassified
337 2849139964 Bacillus sp. R-71875 Isolate Unclassified
338 2857581216 Bacillus sp. R-71922 Isolate Unclassified
339 2857586860 Bacillus sp. R-71935 Isolate Unclassified
340 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
341 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
342 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
343 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
344 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
345 2919720352 Priestia megaterium 4340 Isolate Unclassified
346 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
347 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
348 2929004312 Priestia megaterium 1104 Isolate Unclassified
349 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
350 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
351 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
352 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
353 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
354 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
355 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
356 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
357 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
358 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
359 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.45
Metatranscriptomes 0.79
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0.13
Rhizoplane 4.49
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10095874 3300009147 Bacteria 4108
2 CNAas_1000010 3300000532 Bacteria 11171
3 JGI24740J21852_10033568 3300001979 Bacteria 1627
4 JGI24751J29686_10014474 3300002459 Bacteria 1627
5 JGI25151J46595_10020935 3300003187 Bacteria 2746
6 JGI25151J46595_10022122 3300003187 Bacteria 2645
7 JGI25406J46586_10021821 3300003203 Bacteria 2562
8 Ga0006562J51391_1001725 3300003578 Bacteria 6030
9 Ga0055532_1000161 3300003758 Bacteria 58318
10 Ga0055532_1006623 3300003758 Bacteria 1537
11 Ga0055528_1002488 3300003790 Bacteria 9840
12 Ga0065704_10162316 3300005289 Bacteria 1346
13 Ga0065712_10113323 3300005290 Bacteria 1785
14 Ga0065715_10095415 3300005293 Bacteria 4089
15 Ga0065715_10128269 3300005293 Bacteria 2069
16 Ga0065707_10001541 3300005295 Bacteria 8030
17 Ga0065707_10007309 3300005295 Bacteria 5913
18 Ga0070676_10050730 3300005328 Bacteria 2433
19 Ga0070676_10109923 3300005328 Bacteria 1715
20 Ga0070683_100001766 3300005329 Bacteria 16828
21 Ga0070683_100019945 3300005329 Bacteria 5959
22 Ga0070683_100020756 3300005329 Bacteria 5851
23 Ga0070690_100021663 3300005330 Bacteria 3926
24 Ga0070690_100031674 3300005330 Bacteria 3296
25 Ga0070670_100144767 3300005331 Bacteria 2056
26 Ga0070677_10033319 3300005333 Bacteria 1982
27 Ga0068869_100105335 3300005334 Bacteria 2139
28 Ga0070666_10113223 3300005335 Bacteria 1877
29 Ga0070680_100021211 3300005336 Bacteria 5162
30 Ga0070660_100000852 3300005339 Bacteria 20293
31 Ga0070660_100007755 3300005339 Bacteria 7486
32 Ga0070660_100029533 3300005339 Bacteria 4109
33 Ga0070689_100130669 3300005340 Bacteria 2013
34 Ga0070691_10041083 3300005341 Bacteria 2186
35 Ga0070661_100021039 3300005344 Bacteria 4657
36 Ga0070661_100187592 3300005344 Bacteria 1576
37 Ga0070692_10001526 3300005345 Bacteria 8489
38 Ga0070692_10005532 3300005345 Bacteria 5399
39 Ga0070692_10158828 3300005345 Bacteria 1294
40 Ga0070669_100000822 3300005353 Bacteria 22595
41 Ga0070669_100007179 3300005353 Bacteria 8001
42 Ga0070669_100016194 3300005353 Bacteria 5318
43 Ga0070669_100016421 3300005353 Bacteria 5281
44 Ga0070669_100034546 3300005353 Bacteria 3661
45 Ga0070669_100123040 3300005353 Bacteria 1982
46 Ga0070669_100165160 3300005353 Bacteria 1723
47 Ga0070669_100166238 3300005353 Bacteria 1717
48 Ga0070675_100000980 3300005354 Bacteria 20412
49 Ga0070675_100002714 3300005354 Bacteria 13302
50 Ga0070675_100080440 3300005354 Bacteria 2716
51 Ga0070671_100018300 3300005355 Bacteria 5689
52 Ga0070671_100193977 3300005355 Bacteria 1722
53 Ga0070688_100034767 3300005365 Bacteria 3056
54 Ga0070688_100174346 3300005365 Bacteria 1487
55 Ga0070659_100113013 3300005366 Bacteria 2193
56 Ga0070667_100173050 3300005367 Bacteria 1907
57 Ga0070703_10001638 3300005406 Bacteria 6653
58 Ga0070709_10100320 3300005434 Bacteria 1928
59 Ga0070714_100000042 3300005435 Bacteria 116805
60 Ga0070714_100008585 3300005435 Bacteria 7993
61 Ga0070714_100177776 3300005435 Bacteria 1935
62 Ga0070713_100010152 3300005436 Bacteria 6792
63 Ga0070713_100109994 3300005436 Bacteria 2401
64 Ga0070701_10032855 3300005438 Bacteria 2587
65 Ga0070711_100000004 3300005439 Bacteria 188789
66 Ga0070711_100006583 3300005439 Bacteria 7015
67 Ga0070711_100035721 3300005439 Bacteria 3325
68 Ga0070711_100165193 3300005439 Bacteria 1682
69 Ga0070705_100010022 3300005440 Bacteria 4732
70 Ga0070705_100019033 3300005440 Bacteria 3609
71 Ga0070705_100021714 3300005440 Bacteria 3418
72 Ga0070700_100008938 3300005441 Bacteria 5480
73 Ga0070700_100010357 3300005441 Bacteria 5145
74 Ga0070694_100001409 3300005444 Bacteria 14070
75 Ga0070694_100004370 3300005444 Bacteria 8502
76 Ga0070694_100078554 3300005444 Bacteria 2289
77 Ga0070694_100084431 3300005444 Bacteria 2215
78 Ga0070708_100002264 3300005445 Bacteria 14883
79 Ga0070708_100019835 3300005445 Bacteria 5657
80 Ga0070708_100090693 3300005445 Bacteria 2782
81 Ga0070663_100019691 3300005455 Bacteria 4455
82 Ga0070662_100074240 3300005457 Bacteria 2515
83 Ga0070662_100207054 3300005457 Bacteria 1559
84 Ga0070681_10040852 3300005458 Bacteria 4647
85 Ga0070681_10071298 3300005458 Bacteria 3439
86 Ga0068867_100073414 3300005459 Bacteria 2562
87 Ga0068867_100222474 3300005459 Bacteria 1522
88 Ga0070706_100009512 3300005467 Bacteria 9039
89 Ga0070706_100011203 3300005467 Bacteria 8326
90 Ga0070706_100021926 3300005467 Bacteria 5882
91 Ga0070706_100033217 3300005467 Bacteria 4762
92 Ga0070706_100281336 3300005467 Bacteria 1552
93 Ga0070707_100001003 3300005468 Bacteria 27969
94 Ga0070707_100017114 3300005468 Bacteria 6809
95 Ga0070698_100005359 3300005471 Bacteria 14030
96 Ga0070698_100042403 3300005471 Bacteria 4667
97 Ga0070698_100090922 3300005471 Bacteria 3035
98 Ga0070698_100245884 3300005471 Bacteria 1722
99 Ga0070699_100147674 3300005518 Bacteria 2078
100 Ga0070679_100188558 3300005530 Bacteria 2032
101 Ga0070679_100192532 3300005530 Bacteria 2008
102 Ga0070684_100009761 3300005535 Bacteria 7578
103 Ga0070684_100016587 3300005535 Bacteria 6023
104 Ga0070684_100113376 3300005535 Bacteria 2433
105 Ga0070697_100001166 3300005536 Bacteria 19926
106 Ga0070697_100001644 3300005536 Bacteria 17028
107 Ga0070697_100128153 3300005536 Bacteria 2126
108 Ga0070697_100267073 3300005536 Bacteria 1466
109 Ga0070672_100115797 3300005543 Bacteria 2189
110 Ga0070672_100128960 3300005543 Bacteria 2077
111 Ga0070686_100001011 3300005544 Bacteria 16192
112 Ga0070686_100019152 3300005544 Bacteria 4028
113 Ga0070695_100001409 3300005545 Bacteria 13321
114 Ga0070695_100021992 3300005545 Bacteria 3909
115 Ga0070695_100031006 3300005545 Bacteria 3331
116 Ga0070696_100002406 3300005546 Bacteria 12389
117 Ga0070696_100003432 3300005546 Bacteria 10562
118 Ga0070696_100019377 3300005546 Bacteria 4608
119 Ga0070693_100002801 3300005547 Bacteria 8021
120 Ga0070693_100004068 3300005547 Bacteria 6885
121 Ga0070693_100134512 3300005547 Bacteria 1549
122 Ga0070665_100013962 3300005548 Bacteria 8078
123 Ga0070665_100079688 3300005548 Bacteria 3280
124 Ga0070665_100182832 3300005548 Bacteria 2097
125 Ga0070665_100228844 3300005548 Bacteria 1859
126 Ga0070704_100081645 3300005549 Bacteria 2382
127 Ga0068855_100000860 3300005563 Bacteria 37683
128 Ga0068855_100147837 3300005563 Bacteria 2673
129 Ga0068855_100212169 3300005563 Bacteria 2175
130 Ga0070664_100000222 3300005564 Bacteria 40764
131 Ga0068857_100038977 3300005577 Bacteria 4207
132 Ga0068857_100151233 3300005577 Bacteria 2103
133 Ga0068857_100220036 3300005577 Bacteria 1734
134 Ga0070702_100022199 3300005615 Bacteria 3351
135 Ga0068859_100040718 3300005617 Bacteria 4666
136 Ga0068859_100065301 3300005617 Bacteria 3673
137 Ga0068859_100151055 3300005617 Bacteria 2398
138 Ga0068859_100154208 3300005617 Bacteria 2373
139 Ga0068859_100166921 3300005617 Bacteria 2281
140 Ga0068864_100011022 3300005618 Bacteria 7473
141 Ga0068864_100320119 3300005618 Bacteria 1456
142 Ga0068866_10012480 3300005718 Bacteria 3702
143 Ga0068861_100055707 3300005719 Bacteria 3016
144 Ga0068861_100058309 3300005719 Bacteria 2952
145 Ga0068861_100110009 3300005719 Bacteria 2206
146 Ga0068863_100001797 3300005841 Bacteria 21288
147 Ga0068863_100098514 3300005841 Bacteria 2777
148 Ga0068863_100115669 3300005841 Bacteria 2556
149 Ga0068858_100008882 3300005842 Bacteria 9634
150 Ga0068858_100012838 3300005842 Bacteria 7898
151 Ga0068858_100016085 3300005842 Bacteria 7027
152 Ga0068858_100225307 3300005842 Bacteria 1776
153 Ga0068860_100038658 3300005843 Bacteria 4565
154 Ga0068860_100066375 3300005843 Bacteria 3427
155 Ga0068860_100215385 3300005843 Bacteria 1864
156 Ga0068862_100091191 3300005844 Bacteria 2654
157 Ga0068862_100175256 3300005844 Bacteria 1922
158 Ga0081455_10106957 3300005937 Bacteria 2231
159 Ga0081538_10013858 3300005981 Bacteria 6358
160 Ga0081539_10000977 3300005985 Bacteria 53347
161 Ga0081539_10012072 3300005985 Bacteria 6716
162 Ga0070717_10097772 3300006028 Bacteria 2487
163 Ga0070715_10000005 3300006163 Bacteria 298716
164 Ga0070712_100048021 3300006175 Bacteria 2957
165 Ga0097621_100003251 3300006237 Bacteria 11173
166 Ga0097621_100135745 3300006237 Bacteria 2098
167 Ga0068871_100003400 3300006358 Bacteria 10935
168 Ga0068871_100011972 3300006358 Bacteria 6385
169 Ga0068871_100210148 3300006358 Bacteria 1683
170 Ga0075428_100024598 3300006844 Bacteria 6664
171 Ga0075428_100032701 3300006844 Bacteria 5745
172 Ga0075428_100034272 3300006844 Bacteria 5601
173 Ga0075428_100070521 3300006844 Bacteria 3820
174 Ga0075430_100013445 3300006846 Bacteria 6977
175 Ga0075430_100206833 3300006846 Bacteria 1629
176 Ga0075431_100007090 3300006847 Bacteria 11134
177 Ga0075431_100026761 3300006847 Bacteria 5916
178 Ga0075431_100135097 3300006847 Bacteria 2543
179 Ga0075433_10057621 3300006852 Bacteria 3396
180 Ga0075433_10066765 3300006852 Bacteria 3156
181 Ga0075433_10068543 3300006852 Bacteria 3115
182 Ga0075433_10201513 3300006852 Bacteria 1769
183 Ga0075433_10333143 3300006852 Bacteria 1342
184 Ga0075434_100000023 3300006871 Bacteria 68942
185 Ga0075434_100003264 3300006871 Bacteria 14498
186 Ga0075434_100020114 3300006871 Bacteria 6469
187 Ga0075434_100169912 3300006871 Bacteria 2200
188 Ga0075434_100305615 3300006871 Bacteria 1611
189 Ga0075429_100005407 3300006880 Bacteria 10991
190 Ga0075429_100081098 3300006880 Bacteria 2829
191 Ga0068865_100005219 3300006881 Bacteria 7854
192 Ga0075436_100000570 3300006914 Bacteria 24112
193 Ga0075436_100000624 3300006914 Bacteria 23244
194 Ga0075436_100010079 3300006914 Bacteria 6466
195 Ga0075436_100016434 3300006914 Bacteria 5064
196 Ga0075436_100057077 3300006914 Bacteria 2696
197 Ga0097620_100040718 3300006931 Bacteria 4666
198 Ga0097620_100065301 3300006931 Bacteria 3673
199 Ga0097620_100151064 3300006931 Bacteria 2398
200 Ga0097620_100154204 3300006931 Bacteria 2373
201 Ga0097620_100166919 3300006931 Bacteria 2281
202 Ga0075435_100000037 3300007076 Bacteria 68955
203 Ga0075435_100003062 3300007076 Bacteria 11277
204 Ga0075435_100196538 3300007076 Bacteria 1708
205 Ga0099794_10017963 3300007265 Bacteria 3162
206 Ga0099794_10023938 3300007265 Bacteria 2798
207 Ga0099794_10093358 3300007265 Bacteria 1496
208 Ga0099794_10102280 3300007265 Bacteria 1431
209 Ga0105240_10201803 3300009093 Bacteria 2330
210 Ga0105240_10301717 3300009093 Bacteria 1832
211 Ga0111539_10001215 3300009094 Bacteria 34303
212 Ga0111539_10005649 3300009094 Bacteria 16175
213 Ga0111539_10005752 3300009094 Bacteria 16034
214 Ga0111539_10007447 3300009094 Bacteria 14023
215 Ga0111539_10017186 3300009094 Bacteria 8954
216 Ga0111539_10031675 3300009094 Bacteria 6424
217 Ga0111539_10043759 3300009094 Bacteria 5367
218 Ga0111539_10103045 3300009094 Bacteria 3349
219 Ga0111539_10165371 3300009094 Bacteria 2587
220 Ga0111539_10208103 3300009094 Bacteria 2280
221 Ga0111539_10325843 3300009094 Bacteria 1788
222 Ga0105245_10241979 3300009098 Bacteria 1749
223 Ga0105245_10405480 3300009098 Bacteria 1363
224 Ga0114129_10000532 3300009147 Bacteria 46632
225 Ga0114129_10007870 3300009147 Bacteria 15163
226 Ga0114129_10008261 3300009147 Bacteria 14848
227 Ga0114129_10008651 3300009147 Bacteria 14513
228 Ga0114129_10010720 3300009147 Bacteria 13068
229 Ga0114129_10021723 3300009147 Bacteria 9107
230 Ga0114129_10030805 3300009147 Bacteria 7586
231 Ga0114129_10062240 3300009147 Bacteria 5214
232 Ga0114129_10094397 3300009147 Bacteria 4143
233 Ga0114129_10103681 3300009147 Bacteria 3932
234 Ga0114129_10302332 3300009147 Bacteria 2132
235 Ga0114129_10357466 3300009147 Bacteria 1933
236 Ga0105243_10001313 3300009148 Bacteria 22196
237 Ga0105243_10047886 3300009148 Bacteria 3368
238 Ga0105243_10156139 3300009148 Bacteria 1962
239 Ga0105241_10031532 3300009174 Bacteria 3969
240 Ga0105242_10000997 3300009176 Bacteria 22197
241 Ga0105242_10009632 3300009176 Bacteria 7404
242 Ga0105242_10271424 3300009176 Bacteria 1537
243 Ga0105248_10015013 3300009177 Bacteria 8525
244 Ga0105248_10057589 3300009177 Bacteria 4363
245 Ga0105248_10082497 3300009177 Bacteria 3615
246 Ga0105248_10115731 3300009177 Bacteria 3024
247 Ga0105248_10197391 3300009177 Bacteria 2267
248 Ga0105248_10222613 3300009177 Bacteria 2124
249 Ga0105248_10539129 3300009177 Bacteria 1316
250 Ga0105237_10151569 3300009545 Bacteria 2315
251 Ga0105238_10070537 3300009551 Bacteria 3493
252 Ga0105238_10108114 3300009551 Bacteria 2762
253 Ga0105249_10104503 3300009553 Bacteria 2669
254 Ga0099796_10025194 3300010159 Bacteria 1875
255 Ga0157371_10023407 3300013102 Bacteria 4517
256 Ga0157371_10033303 3300013102 Bacteria 3702
257 Ga0157370_10068492 3300013104 Bacteria 3354
258 Ga0157369_10005912 3300013105 Bacteria 14211
259 Ga0157369_10010082 3300013105 Bacteria 10790
260 Ga0157369_10233964 3300013105 Bacteria 1920
261 Ga0157374_10256241 3300013296 Bacteria 1722
262 Ga0163162_10023280 3300013306 Bacteria 6112
263 Ga0157372_10059428 3300013307 Bacteria 4276
264 Ga0157372_10360868 3300013307 Bacteria 1693
265 Ga0163163_10019122 3300014325 Bacteria 6428
266 Ga0163163_10077488 3300014325 Bacteria 3319
267 Ga0157380_10004771 3300014326 Bacteria 9443
268 Ga0157380_10021373 3300014326 Bacteria 4853
269 Ga0157380_10023408 3300014326 Bacteria 4659
270 Ga0157380_10038123 3300014326 Bacteria 3730
271 Ga0157377_10038323 3300014745 Bacteria 2645
272 Ga0157379_10001085 3300014968 Bacteria 22205
273 Ga0157379_10044723 3300014968 Bacteria 3953
274 Ga0157376_10003868 3300014969 Bacteria 10350
275 Ga0157376_10029040 3300014969 Bacteria 4403
276 Ga0157376_10086649 3300014969 Bacteria 2701
277 Ga0157376_10097675 3300014969 Bacteria 2559
278 Ga0163161_10051920 3300017792 Bacteria 2972
279 Ga0213876_10000057 3300021384 Bacteria 134631
280 Ga0213876_10000172 3300021384 Bacteria 67291
281 Ga0228598_1000025 3300024227 Bacteria 20869
282 Ga0228598_1005065 3300024227 Bacteria 2768
283 Ga0209566_100189 3300025225 Bacteria 64931
284 Ga0209147_100222 3300025229 Bacteria 58370
285 Ga0209147_100408 3300025229 Bacteria 29102
286 Ga0209258_103941 3300025242 Bacteria 2983
287 Ga0209673_1012288 3300025273 Bacteria 3459
288 Ga0209025_1000127 3300025294 Bacteria 200766
289 Ga0209025_1000568 3300025294 Bacteria 67279
290 Ga0209025_1001477 3300025294 Bacteria 30602
291 Ga0209025_1003847 3300025294 Bacteria 13635
292 Ga0209025_1004999 3300025294 Bacteria 11081
293 Ga0209025_1011725 3300025294 Bacteria 5725
294 Ga0209025_1018270 3300025294 Bacteria 3991
295 Ga0209025_1019288 3300025294 Bacteria 3798
296 Ga0207697_10009622 3300025315 Bacteria 4165
297 Ga0207696_1008193 3300025711 Bacteria 4023
298 Ga0207653_10002016 3300025885 Bacteria 6481
299 Ga0207682_10024480 3300025893 Bacteria 2391
300 Ga0207680_10054194 3300025903 Bacteria 2412
301 Ga0207647_10018632 3300025904 Bacteria 4688
302 Ga0207647_10057778 3300025904 Bacteria 2378
303 Ga0207685_10000026 3300025905 Bacteria 109892
304 Ga0207699_10070043 3300025906 Bacteria 2140
305 Ga0207645_10001021 3300025907 Bacteria 23141
306 Ga0207645_10028529 3300025907 Bacteria 3602
307 Ga0207645_10173344 3300025907 Bacteria 1414
308 Ga0207705_10000648 3300025909 Bacteria 28951
309 Ga0207705_10001745 3300025909 Bacteria 17203
310 Ga0207705_10003867 3300025909 Bacteria 11391
311 Ga0207684_10015939 3300025910 Bacteria 6459
312 Ga0207684_10017140 3300025910 Bacteria 6217
313 Ga0207684_10024307 3300025910 Bacteria 5167
314 Ga0207684_10128245 3300025910 Bacteria 2177
315 Ga0207707_10325626 3300025912 Bacteria 1326
316 Ga0207695_10090405 3300025913 Bacteria 3077
317 Ga0207695_10098606 3300025913 Bacteria 2921
318 Ga0207693_10061849 3300025915 Bacteria 2933
319 Ga0207663_10000007 3300025916 Bacteria 208566
320 Ga0207663_10004341 3300025916 Bacteria 7040
321 Ga0207663_10011482 3300025916 Bacteria 4755
322 Ga0207663_10098338 3300025916 Bacteria 1959
323 Ga0207660_10179723 3300025917 Bacteria 1642
324 Ga0207662_10002970 3300025918 Bacteria 8632
325 Ga0207662_10037194 3300025918 Bacteria 2848
326 Ga0207657_10001247 3300025919 Bacteria 27200
327 Ga0207657_10001696 3300025919 Bacteria 23760
328 Ga0207657_10118582 3300025919 Bacteria 2178
329 Ga0207646_10000165 3300025922 Bacteria 89540
330 Ga0207646_10105599 3300025922 Bacteria 2526
331 Ga0207681_10016455 3300025923 Bacteria 4627
332 Ga0207681_10032205 3300025923 Bacteria 3431
333 Ga0207681_10095856 3300025923 Bacteria 2129
334 Ga0207681_10210456 3300025923 Bacteria 1498
335 Ga0207694_10119731 3300025924 Bacteria 2101
336 Ga0207650_10110218 3300025925 Bacteria 2130
337 Ga0207650_10125836 3300025925 Bacteria 2001
338 Ga0207659_10001618 3300025926 Bacteria 13342
339 Ga0207659_10138134 3300025926 Bacteria 1889
340 Ga0207700_10023389 3300025928 Bacteria 4259
341 Ga0207700_10057336 3300025928 Bacteria 2936
342 Ga0207664_10000037 3300025929 Bacteria 171467
343 Ga0207664_10153081 3300025929 Bacteria 1960
344 Ga0207644_10075116 3300025931 Bacteria 2483
345 Ga0207644_10142530 3300025931 Bacteria 1847
346 Ga0207690_10038910 3300025932 Bacteria 3099
347 Ga0207706_10095895 3300025933 Bacteria 2609
348 Ga0207686_10000208 3300025934 Bacteria 44632
349 Ga0207686_10070026 3300025934 Bacteria 2252
350 Ga0207686_10169196 3300025934 Bacteria 1539
351 Ga0207709_10000029 3300025935 Bacteria 333327
352 Ga0207669_10011976 3300025937 Bacteria 4246
353 Ga0207704_10016402 3300025938 Bacteria 3806
354 Ga0207665_10005191 3300025939 Bacteria 8696
355 Ga0207691_10007228 3300025940 Bacteria 10712
356 Ga0207691_10016335 3300025940 Bacteria 7047
357 Ga0207711_10053569 3300025941 Bacteria 3460
358 Ga0207711_10067280 3300025941 Bacteria 3101
359 Ga0207711_10166136 3300025941 Bacteria 2000
360 Ga0207689_10059057 3300025942 Bacteria 3155
361 Ga0207689_10065897 3300025942 Bacteria 2979
362 Ga0207689_10099778 3300025942 Bacteria 2386
363 Ga0207679_10020392 3300025945 Bacteria 4473
364 Ga0207667_10010703 3300025949 Bacteria 10703
365 Ga0207667_10186565 3300025949 Bacteria 2129
366 Ga0207667_10261311 3300025949 Bacteria 1770
367 Ga0207651_10161753 3300025960 Bacteria 1756
368 Ga0207712_10153811 3300025961 Bacteria 1779
369 Ga0207658_10133343 3300025986 Bacteria 1999
370 Ga0207703_10010431 3300026035 Bacteria 7267
371 Ga0207703_10026965 3300026035 Bacteria 4525
372 Ga0207703_10094455 3300026035 Bacteria 2521
373 Ga0207703_10209745 3300026035 Bacteria 1736
374 Ga0207678_10003131 3300026067 Bacteria 14970
375 Ga0207708_10002277 3300026075 Bacteria 14153
376 Ga0207708_10002474 3300026075 Bacteria 13583
377 Ga0207641_10001646 3300026088 Bacteria 21794
378 Ga0207641_10073196 3300026088 Bacteria 2953
379 Ga0207641_10150592 3300026088 Bacteria 2107
380 Ga0207648_10010792 3300026089 Bacteria 8632
381 Ga0207648_10013697 3300026089 Bacteria 7529
382 Ga0207648_10219657 3300026089 Bacteria 1689
383 Ga0207674_10017639 3300026116 Bacteria 7785
384 Ga0207674_10104184 3300026116 Bacteria 2816
385 Ga0207675_100000537 3300026118 Bacteria 36958
386 Ga0207675_100003240 3300026118 Bacteria 15957
387 Ga0207675_100005081 3300026118 Bacteria 12663
388 Ga0207675_100123314 3300026118 Bacteria 2453
389 Ga0207675_100193252 3300026118 Bacteria 1953
390 Ga0209588_1002959 3300027671 Bacteria 4669
391 Ga0207428_10001989 3300027907 Bacteria 20731
392 Ga0207428_10002691 3300027907 Bacteria 17705
393 Ga0207428_10003496 3300027907 Bacteria 15230
394 Ga0207428_10003822 3300027907 Bacteria 14443
395 Ga0207428_10034376 3300027907 Bacteria 4154
396 Ga0265354_1000043 3300028016 Bacteria 20369
397 Ga0265354_1002430 3300028016 Bacteria 2302
398 Ga0268266_10008285 3300028379 Bacteria 9264
399 Ga0268266_10073992 3300028379 Bacteria 2958
400 Ga0268266_10074202 3300028379 Bacteria 2954
401 Ga0268266_10210234 3300028379 Bacteria 1784
402 Ga0268265_10018307 3300028380 Bacteria 4852
403 Ga0268265_10068984 3300028380 Bacteria 2744
404 Ga0268264_10029562 3300028381 Bacteria 4489
405 Ga0268264_10150901 3300028381 Bacteria 2083
406 Ga0265770_1000453 3300030878 Bacteria 5644
407 Ga0265770_1001641 3300030878 Bacteria 3066
408 Ga0265765_1001703 3300030879 Bacteria 2046
409 Ga0265760_10002254 3300031090 Bacteria 5637
410 Ga0265760_10012555 3300031090 Bacteria 2423
411 Ga0307408_100064758 3300031548 Bacteria 2678
412 Ga0307408_100069761 3300031548 Bacteria 2593
413 Ga0307408_100131645 3300031548 Bacteria 1952
414 Ga0307405_10012489 3300031731 Bacteria 4499
415 Ga0307405_10014705 3300031731 Bacteria 4217
416 Ga0307405_10032782 3300031731 Bacteria 3074
417 Ga0307413_10000475 3300031824 Bacteria 13077
418 Ga0307413_10034252 3300031824 Bacteria 2900
419 Ga0307413_10035627 3300031824 Bacteria 2856
420 Ga0307413_10072258 3300031824 Bacteria 2177
421 Ga0307413_10114127 3300031824 Bacteria 1815
422 Ga0307410_10002922 3300031852 Bacteria 8422
423 Ga0307410_10011383 3300031852 Bacteria 5084
424 Ga0307410_10030355 3300031852 Bacteria 3454
425 Ga0307410_10137218 3300031852 Bacteria 1804
426 Ga0307410_10210775 3300031852 Bacteria 1488
427 Ga0307406_10049041 3300031901 Bacteria 2670
428 Ga0307406_10065609 3300031901 Bacteria 2360
429 Ga0307407_10000478 3300031903 Bacteria 12285
430 Ga0307407_10130235 3300031903 Bacteria 1608
431 Ga0307412_10028184 3300031911 Bacteria 3510
432 Ga0307412_10029476 3300031911 Bacteria 3444
433 Ga0307412_10209886 3300031911 Bacteria 1485
434 Ga0307409_100003586 3300031995 Bacteria 8478
435 Ga0307409_100007722 3300031995 Bacteria 6463
436 Ga0307409_100065669 3300031995 Bacteria 2857
437 Ga0307409_100138304 3300031995 Bacteria 2094
438 Ga0307409_100172712 3300031995 Bacteria 1904
439 Ga0307416_100022589 3300032002 Bacteria 4543
440 Ga0307416_100066510 3300032002 Bacteria 2967
441 Ga0307416_100080025 3300032002 Bacteria 2756
442 Ga0307416_100083060 3300032002 Bacteria 2716
443 Ga0307416_100100436 3300032002 Bacteria 2516
444 Ga0307416_100101098 3300032002 Bacteria 2510
445 Ga0307416_100106904 3300032002 Bacteria 2454
446 Ga0307416_100134513 3300032002 Bacteria 2233
447 Ga0307414_10007713 3300032004 Bacteria 6062
448 Ga0307414_10014163 3300032004 Bacteria 4769
449 Ga0307414_10068510 3300032004 Bacteria 2547
450 Ga0307414_10191275 3300032004 Bacteria 1656
451 Ga0307414_10245558 3300032004 Bacteria 1485
452 Ga0307411_10001105 3300032005 Bacteria 10498
453 Ga0307411_10017673 3300032005 Bacteria 4072
454 Ga0307411_10020174 3300032005 Bacteria 3869
455 Ga0307415_100002385 3300032126 Bacteria 9364
456 Ga0307415_100015437 3300032126 Bacteria 4523
457 Ga0307415_100026378 3300032126 Bacteria 3664
458 Ga0307415_100099242 3300032126 Bacteria 2131
459 Ga0373950_0007628 3300034818 Bacteria 1685
460 Ga0373938_0003512 3300034957 Bacteria 2574
461 Ga0373926_0006393 3300035083 Bacteria 3915
462 Ga0373926_0071066 3300035083 Bacteria 1279
463 Ga0373928_0013148 3300035084 Bacteria 1659
464 Ga0373934_0028713 3300035086 Bacteria 2170
465 Ga0373940_0000100 3300035088 Bacteria 10437
466 Ga0373949_0004862 3300035090 Bacteria 3042
467 Ga0373951_0001096 3300035091 Bacteria 7231
468 Ga0373952_0000066 3300035092 Bacteria 13199
469 Ga0373923_0012504 3300035111 Bacteria 3139
470 Ga0373932_0005597 3300035112 Bacteria 2955
471 Ga0373939_0001899 3300035114 Bacteria 5003
472 Ga0373941_0014160 3300035115 Bacteria 2125
473 Ga0373945_0027709 3300035116 Bacteria 1980
474 Ga0373953_0046195 3300035117 Bacteria 1748
475 Ga0373960_0000575 3300035121 Bacteria 7472
476 Ga0373943_0000346 3300035170 Bacteria 19503
477 Ga0373943_0040201 3300035170 Bacteria 2257
478 Ga0373946_0001109 3300035171 Bacteria 9303
479 Ga0373955_0015102 3300035172 Bacteria 3773
480 Ga0373942_0004904 3300035207 Bacteria 3102
481 Ga0373961_0005994 3300035241 Bacteria 2918
482 Ga0373962_0001444 3300035242 Bacteria 5619
483 Ga0373924_0000090 3300035410 Bacteria 24971
484 Ga0373924_0000745 3300035410 Bacteria 10145
485 Ga0373924_0025464 3300035410 Bacteria 2340
486 Ga0373924_0043785 3300035410 Bacteria 1839
487 Ga0373931_0001298 3300035691 Bacteria 10691
488 Ga0373931_0063533 3300035691 Bacteria 1996
489 Ga0373935_0003926 3300035692 Bacteria 8684
490 Ga0373935_0037132 3300035692 Bacteria 3047
491 Ga0373927_0000206 3300035695 Bacteria 47251
492 Ga0373927_0000276 3300035695 Bacteria 40262
493 Ga0373927_0007405 3300035695 Bacteria 7429
494 Ga0373927_0014703 3300035695 Bacteria 5174
495 Ga0373927_0037217 3300035695 Bacteria 3164
496 Ga0373927_0053782 3300035695 Bacteria 2605
497 Ga0373933_0000301 3300035724 Bacteria 31938
498 Ga0373933_0167662 3300035724 Bacteria 1397
499 Ga0373947_0000122 3300035725 Bacteria 39100
500 Ga0373947_0000282 3300035725 Bacteria 28758
501 Ga0373947_0108408 3300035725 Bacteria 1752
502 Ga0373937_0000288 3300036401 Bacteria 48158
503 Ga0373937_0007732 3300036401 Bacteria 9319
504 Ga0373937_0100131 3300036401 Bacteria 2689
505 Ga0373937_0137368 3300036401 Bacteria 2286
506 Ga0373937_0442713 3300036401 Bacteria 1234
507 Ga0373925_0000103 3300037068 Bacteria 92575
508 Ga0373925_0000934 3300037068 Bacteria 26622
509 Ga0373925_0038257 3300037068 Bacteria 3546
510 Ga0373925_0070966 3300037068 Bacteria 2634
511 Ga0373925_0338171 3300037068 Bacteria 1221
512 Ga0395899_0004515 3300037312 Bacteria 10849
513 Ga0395899_0043639 3300037312 Bacteria 3344
514 Ga0395900_0000777 3300037418 Bacteria 42484
515 Ga0395898_0015202 3300037466 Bacteria 7902
516 Ga0395898_0064107 3300037466 Bacteria 3564
517 Ga0395905_0183418 3300037471 Bacteria 1965
518 Ga0395905_0386107 3300037471 Bacteria 1294
519 Ga0395901_0006976 3300038443 Bacteria 11414
520 Ga0400483_137280 3300039062 Bacteria 2722
521 Ga0400483_206430 3300039062 Bacteria 78978
522 Ga0436365_1041616 3300039437 Bacteria 111595
523 Ga0436365_1521843 3300039437 Bacteria 3653
524 Ga0436365_1928925 3300039437 Bacteria 149126
525 Ga0439433_0005733 3300041999 Bacteria 2669
526 Ga0453683_0003399 3300044673 Bacteria 11750
527 Ga0453683_0043010 3300044673 Bacteria 2836
528 Ga0453683_0083804 3300044673 Bacteria 1998
529 Ga0466963_0186800 3300044694 Bacteria 1448
530 Ga0453684_0006038 3300044712 Bacteria 23425
531 Ga0453684_0179507 3300044712 Bacteria 2486
532 Ga0453684_0403315 3300044712 Bacteria 1531
533 Ga0466957_0078266 3300044842 Bacteria 2056
534 Ga0466959_0038379 3300045049 Bacteria 3539
535 Ga0451576_0183014 3300045051 Bacteria 2188
536 Ga0451576_0278924 3300045051 Bacteria 1747
537 Ga0466967_0001131 3300045976 Bacteria 14854
538 Ga0495629_0063427 3300046459 Bacteria 2581
539 Ga0495651_0008643 3300046462 Bacteria 7811
540 Ga0495580_0019767 3300046472 Bacteria 4999
541 Ga0495580_0096140 3300046472 Bacteria 2060
542 Ga0495580_0117149 3300046472 Bacteria 1850
543 Ga0495580_0154089 3300046472 Bacteria 1592
544 Ga0495582_0161517 3300046473 Bacteria 1274
545 Ga0495664_0002852 3300046477 Bacteria 9314
546 Ga0495664_0003856 3300046477 Bacteria 8180
547 Ga0495585_0018584 3300046492 Bacteria 4008
548 Ga0495608_0005145 3300046511 Bacteria 9348
549 Ga0495608_0019436 3300046511 Bacteria 4675
550 Ga0495618_0011895 3300046514 Bacteria 5281
551 Ga0495618_0126032 3300046514 Bacteria 1640
552 Ga0495628_0033769 3300046516 Bacteria 4120
553 Ga0495628_0161114 3300046516 Bacteria 1705
554 Ga0495628_0248046 3300046516 Bacteria 1330
555 Ga0495630_0002908 3300046517 Bacteria 11899
556 Ga0495630_0124808 3300046517 Bacteria 1953
557 Ga0495630_0130827 3300046517 Bacteria 1906
558 Ga0495663_0017588 3300046525 Bacteria 2030
559 Ga0495652_0005051 3300046529 Bacteria 12489
560 Ga0495665_0037808 3300046531 Bacteria 2575
561 Ga0495640_0065239 3300046533 Bacteria 2459
562 Ga0495640_0122168 3300046533 Bacteria 1692
563 Ga0495586_0159106 3300046535 Bacteria 1273
564 Ga0495587_0000157 3300046536 Bacteria 50388
565 Ga0495587_0017031 3300046536 Bacteria 4519
566 Ga0495598_0013761 3300046537 Bacteria 2012
567 Ga0495645_0001995 3300046543 Bacteria 13878
568 Ga0495645_0009754 3300046543 Bacteria 6718
569 Ga0495645_0098574 3300046543 Bacteria 2080
570 Ga0495645_0176861 3300046543 Bacteria 1465
571 Ga0495633_0012417 3300046558 Bacteria 4531
572 Ga0495667_0010475 3300046559 Bacteria 6274
573 Ga0495668_0109500 3300046616 Bacteria 1511
574 Ga0495635_0040764 3300046663 Bacteria 3208
575 Ga0495599_0015224 3300046678 Bacteria 4770
576 Ga0495599_0022903 3300046678 Bacteria 3902
577 Ga0495646_0038807 3300046680 Bacteria 2939
578 Ga0495647_0031398 3300046681 Bacteria 1975
579 Ga0495658_0044613 3300046683 Bacteria 2485
580 Ga0495669_0029222 3300046684 Bacteria 2417
581 Ga0495613_0000975 3300046689 Bacteria 21818
582 Ga0495613_0072602 3300046689 Bacteria 2509
583 Ga0495600_0066149 3300046809 Bacteria 2363
584 Ga0495581_0026269 3300047315 Bacteria 3377
585 Ga0495604_0030764 3300047317 Bacteria 4261
586 Ga0495604_0037249 3300047317 Bacteria 3831
587 Ga0495604_0069462 3300047317 Bacteria 2670
588 Ga0495604_0127199 3300047317 Bacteria 1836
589 Ga0495674_0044282 3300047319 Bacteria 3957
590 Ga0495674_0067232 3300047319 Bacteria 3106
591 Ga0495674_0107073 3300047319 Bacteria 2373
592 Ga0495674_0111913 3300047319 Bacteria 2314
593 Ga0495680_0097390 3300047322 Bacteria 2196
594 Ga0495675_0000271 3300047444 Bacteria 37489
595 Ga0495675_0075258 3300047444 Bacteria 2128
596 Ga0495675_0126630 3300047444 Bacteria 1589
597 Ga0495684_0000140 3300047471 Bacteria 53062
598 Ga0495602_0000436 3300048088 Bacteria 39209
599 Ga0495602_0197422 3300048088 Bacteria 1538
600 Ga0496101_0001225 3300048904 Bacteria 15369
601 Ga0496102_0003727 3300048905 Bacteria 12880
602 Ga0496103_0034893 3300048906 Bacteria 3077
603 Ga0496104_0001234 3300048907 Bacteria 22013
604 Ga0496104_0016644 3300048907 Bacteria 6683
605 Ga0496104_0017205 3300048907 Bacteria 6577
606 Ga0496105_0000459 3300048908 Bacteria 26767
607 Ga0496105_0001553 3300048908 Bacteria 16254
608 Ga0496105_0030664 3300048908 Bacteria 4406
609 Ga0496106_0078251 3300048909 Bacteria 2537
610 Ga0496106_0253012 3300048909 Bacteria 1409
611 Ga0496107_0000344 3300048910 Bacteria 25308
612 Ga0496108_0003238 3300048911 Bacteria 13092
613 Ga0496108_0016078 3300048911 Bacteria 6100
614 Ga0496108_0032273 3300048911 Bacteria 4350
615 Ga0496108_0173347 3300048911 Bacteria 1867
616 Ga0496109_0000017 3300048912 Bacteria 200904
617 Ga0496109_0002270 3300048912 Bacteria 15979
618 Ga0496109_0006048 3300048912 Bacteria 10170
619 Ga0496110_0000702 3300048913 Bacteria 23101
620 Ga0496110_0001502 3300048913 Bacteria 16928
621 Ga0496111_0000975 3300048914 Bacteria 15649
622 Ga0496111_0065963 3300048914 Bacteria 2628
623 Ga0496111_0116269 3300048914 Bacteria 1972
624 Ga0496111_0182539 3300048914 Bacteria 1560
625 Ga0496112_0045473 3300048915 Bacteria 4303
626 Ga0496112_0048345 3300048915 Bacteria 4171
627 Ga0496112_0266584 3300048915 Bacteria 1661
628 Ga0496113_0002031 3300048916 Bacteria 11618
629 Ga0496113_0013697 3300048916 Bacteria 5506
630 Ga0496113_0037688 3300048916 Bacteria 3550
631 Ga0496113_0043798 3300048916 Bacteria 3314
632 Ga0496115_0069688 3300048918 Bacteria 2849
633 Ga0496116_0074330 3300048919 Bacteria 2138
634 Ga0496117_0024889 3300048920 Bacteria 4718
635 Ga0496119_0014455 3300048922 Bacteria 6176
636 Ga0496122_0095370 3300048925 Bacteria 2010
637 Ga0496123_0064158 3300048926 Bacteria 2342
638 Ga0496125_0006855 3300048928 Bacteria 12216
639 Ga0496126_0022141 3300048929 Bacteria 6191
640 Ga0501299_002955 3300049522 Bacteria 2409
641 Ga0501034_0091519 3300049571 Bacteria 3039
642 Ga0501040_0128101 3300049576 Bacteria 1784
643 Ga0501043_0058263 3300049579 Bacteria 3032
644 Ga0501046_0008079 3300049580 Bacteria 9197
645 Ga0501046_0011500 3300049580 Bacteria 7567
646 Ga0501069_0005025 3300049585 Bacteria 6860
647 Ga0501070_0002408 3300049586 Bacteria 16402
648 Ga0501070_0005681 3300049586 Bacteria 10636
649 Ga0501217_011590 3300049661 Bacteria 1953
650 Ga0501233_017831 3300049668 Bacteria 1486
651 Ga0501239_004438 3300049672 Bacteria 1377
652 Ga0501225_0025032 3300049705 Bacteria 1643
653 Ga0501263_002074 3300049760 Bacteria 1999
654 Ga0501044_0102179 3300049823 Bacteria 2883
655 nmdc:mga05p37_10832_c1 3300050507 Bacteria 10827
656 nmdc:mga05p37_11279_c1 3300050507 Bacteria 10628
657 nmdc:mga05p37_1165_c1 3300050507 Bacteria 30287
658 nmdc:mga05p37_117362_c1 3300050507 Bacteria 3270
659 nmdc:mga05p37_132238_c1 3300050507 Bacteria 3061
660 nmdc:mga05p37_27640_c2 3300050507 Bacteria 5351
661 nmdc:mga05p37_338_c1 3300050507 Bacteria 50240
662 nmdc:mga05p37_50113_c1 3300050507 Bacteria 5134
663 nmdc:mga05p37_50822_c1 3300050507 Bacteria 3696
664 nmdc:mga05p37_519542_c1 3300050507 Bacteria 1362
665 nmdc:mga05p37_72964_c1 3300050507 Bacteria 4224
666 nmdc:mga05p37_76966_c1 3300050507 Bacteria 4107
667 nmdc:mga05p37_90747_c1 3300050507 Bacteria 3765
668 nmdc:mga05p37_95439_c1 3300050507 Bacteria 3664
669 nmdc:mga09592_130649_c1 3300050508 Bacteria 2161
670 nmdc:mga09592_141707_c1 3300050508 Bacteria 2072
671 nmdc:mga09592_17324_c1 3300050508 Bacteria 5902
672 nmdc:mga0qj67_278446_c1 3300050509 Bacteria 1356
673 nmdc:mga0qj67_89657_c1 3300050509 Bacteria 2470
674 nmdc:mga06r32_114934_c1 3300050510 Bacteria 2650
675 nmdc:mga06r32_120606_c1 3300050510 Bacteria 2586
676 nmdc:mga06r32_20679_c1 3300050510 Bacteria 6062
677 nmdc:mga06r32_4544_c1 3300050510 Bacteria 12434
678 nmdc:mga08y16_19347_c1 3300050511 Bacteria 7178
679 nmdc:mga08y16_23314_c1 3300050511 Bacteria 6537
680 nmdc:mga08y16_30254_c1 3300050511 Bacteria 5700
681 nmdc:mga08y16_34585_c1 3300050511 Bacteria 5309
682 nmdc:mga08y16_3503_c1 3300050511 Bacteria 16297
683 nmdc:mga08y16_355230_c1 3300050511 Bacteria 1505
684 nmdc:mga08y16_418427_c1 3300050511 Bacteria 1370
685 nmdc:mga08y16_47753_c1 3300050511 Bacteria 4481
686 nmdc:mga08y16_5471_c1 3300050511 Bacteria 13281
687 nmdc:mga08y16_717_c1 3300050511 Bacteria 31525
688 nmdc:mga0n895_217096_c1 3300050512 Bacteria 1942
689 nmdc:mga0n895_24209_c1 3300050512 Bacteria 5720
690 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
691 nmdc:mga0n895_71952_c1 3300050512 Bacteria 3429
692 nmdc:mga0rr50_103115_c1 3300050513 Bacteria 2245
693 nmdc:mga0rr50_2498_c1 3300050513 Bacteria 10398
694 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
695 nmdc:mga08x19_102_c1 3300050514 Bacteria 75432
696 nmdc:mga08x19_1094_c1 3300050514 Bacteria 16900
697 nmdc:mga08x19_27075_c1 3300050514 Bacteria 3584
698 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
699 nmdc:mga08x19_45195_c1 3300050514 Bacteria 2814
700 nmdc:mga08x19_81513_c1 3300050514 Bacteria 2125
701 nmdc:mga0a205_125441_c1 3300050515 Bacteria 2466
702 nmdc:mga0a205_125803_c1 3300050515 Bacteria 2463
703 nmdc:mga0a205_20752_c1 3300050515 Bacteria 6205
704 nmdc:mga0a205_229867_c1 3300050515 Bacteria 1738
705 nmdc:mga0a205_346275_c1 3300050515 Bacteria 1354
706 nmdc:mga0a205_38567_c1 3300050515 Bacteria 4596
707 nmdc:mga0a205_6003_c1 3300050515 Bacteria 10950
708 nmdc:mga0a205_83503_c1 3300050515 Bacteria 3085
709 nmdc:mga0a205_92060_c1 3300050515 Bacteria 2930
710 Ga0495601_0013126 3300053077 Bacteria 4979
711 Ga0495619_0028505 3300053085 Bacteria 3602
712 Ga0495619_0033268 3300053085 Bacteria 3348
713 Ga0500647_0127564 3300053091 Bacteria 1201
714 Ga0500604_0024330 3300053151 Bacteria 1733
715 Ga0501084_0036866 3300054114 Bacteria 4085
716 Ga0590071_000051 3300059421 Bacteria 31026
717 Ga0590071_015920 3300059421 Bacteria 1764
718 Ga0590075_000109 3300059424 Bacteria 21268
719 Ga0590077_000102 3300059426 Bacteria 22388
720 Ga0501082_0178622 3300060353 Bacteria 1846
721 Ga0501082_0208170 3300060353 Bacteria 1702
722 2595088534 2593339131 Bacteria 5116855
723 2644717953 2643221731 Bacteria 5623886
724 2644724851 2643221732 Bacteria 5756404
725 2738814634 2738541295 Bacteria 5730091
726 2739268226 2738543017 Bacteria 4271950
727 2753766419 2751185897 Bacteria 5322941
728 2757565387 2757320391 Bacteria 4746095
729 2777763833 2775507177 Bacteria 4384303
730 2777837087 2775507192 Bacteria 4622234
731 2816863749 2816332186 Bacteria 5331395
732 2819707113 2818991465 Bacteria 5388835
733 2842685362 2842682962 Bacteria 5589973
734 2842882575 2842882022 Bacteria 6158489
735 2849140653 2849139964 Bacteria 5613304
736 2857584500 2857581216 Bacteria 5522813
737 2857588295 2857586860 Bacteria 4354574
738 2874609184 2874604998 Bacteria 7834745
739 2898909718 2898907183 Bacteria 4067722
740 2904526759 2904524088 Bacteria 5887454
741 2919144649 2919143609 Bacteria 6219228
742 2919519840 2919517244 Bacteria 5858162
743 2919720980 2919720352 Bacteria 5986006
744 2928095272 2928093941 Bacteria 5965005
745 2928513619 2928510474 Bacteria 4815308
746 2929008988 2929004312 Bacteria 5678476
747 2936342808 2936340661 Bacteria 5139038
748 2936365794 2936361878 Bacteria 5632809
749 2960324930 2960319331 Bacteria 5502575
750 2960377526 2960375949 Bacteria 5361395
751 2977257139 2977254563 Bacteria 4828420
752 2990278034 2990275345 Bacteria 4887158
753 8022897305 8022893055 Bacteria 5300455
754 8022919043 8022914991 Bacteria 5584517
755 8054280766 8054280661 Bacteria 4232245
756 8057634355 8057632132 Bacteria 4726859
757 8057736365 8057733483 Bacteria 6578323
758 Ga0114129_10095874
759 CNAas_1000010
760 JGI24740J21852_10033568
761 JGI24751J29686_10014474
762 JGI25151J46595_10020935
763 JGI25151J46595_10022122
764 JGI25406J46586_10021821
765 Ga0006562J51391_1001725
766 Ga0055532_1000161
767 Ga0055532_1006623
768 Ga0055528_1002488
769 Ga0065704_10162316
770 Ga0065712_10113323
771 Ga0065715_10095415
772 Ga0065715_10128269
773 Ga0065707_10001541
774 Ga0065707_10007309
775 Ga0070676_10050730
776 Ga0070676_10109923
777 Ga0070683_100001766
778 Ga0070683_100019945
779 Ga0070683_100020756
780 Ga0070690_100021663
781 Ga0070690_100031674
782 Ga0070670_100144767
783 Ga0070677_10033319
784 Ga0068869_100105335
785 Ga0070666_10113223
786 Ga0070680_100021211
787 Ga0070660_100000852
788 Ga0070660_100007755
789 Ga0070660_100029533
790 Ga0070689_100130669
791 Ga0070691_10041083
792 Ga0070661_100021039
793 Ga0070661_100187592
794 Ga0070692_10001526
795 Ga0070692_10005532
796 Ga0070692_10158828
797 Ga0070669_100000822
798 Ga0070669_100007179
799 Ga0070669_100016194
800 Ga0070669_100016421
801 Ga0070669_100034546
802 Ga0070669_100123040
803 Ga0070669_100165160
804 Ga0070669_100166238
805 Ga0070675_100000980
806 Ga0070675_100002714
807 Ga0070675_100080440
808 Ga0070671_100018300
809 Ga0070671_100193977
810 Ga0070688_100034767
811 Ga0070688_100174346
812 Ga0070659_100113013
813 Ga0070667_100173050
814 Ga0070703_10001638
815 Ga0070709_10100320
816 Ga0070714_100000042
817 Ga0070714_100008585
818 Ga0070714_100177776
819 Ga0070713_100010152
820 Ga0070713_100109994
821 Ga0070701_10032855
822 Ga0070711_100000004
823 Ga0070711_100006583
824 Ga0070711_100035721
825 Ga0070711_100165193
826 Ga0070705_100010022
827 Ga0070705_100019033
828 Ga0070705_100021714
829 Ga0070700_100008938
830 Ga0070700_100010357
831 Ga0070694_100001409
832 Ga0070694_100004370
833 Ga0070694_100078554
834 Ga0070694_100084431
835 Ga0070708_100002264
836 Ga0070708_100019835
837 Ga0070708_100090693
838 Ga0070663_100019691
839 Ga0070662_100074240
840 Ga0070662_100207054
841 Ga0070681_10040852
842 Ga0070681_10071298
843 Ga0068867_100073414
844 Ga0068867_100222474
845 Ga0070706_100009512
846 Ga0070706_100011203
847 Ga0070706_100021926
848 Ga0070706_100033217
849 Ga0070706_100281336
850 Ga0070707_100001003
851 Ga0070707_100017114
852 Ga0070698_100005359
853 Ga0070698_100042403
854 Ga0070698_100090922
855 Ga0070698_100245884
856 Ga0070699_100147674
857 Ga0070679_100188558
858 Ga0070679_100192532
859 Ga0070684_100009761
860 Ga0070684_100016587
861 Ga0070684_100113376
862 Ga0070697_100001166
863 Ga0070697_100001644
864 Ga0070697_100128153
865 Ga0070697_100267073
866 Ga0070672_100115797
867 Ga0070672_100128960
868 Ga0070686_100001011
869 Ga0070686_100019152
870 Ga0070695_100001409
871 Ga0070695_100021992
872 Ga0070695_100031006
873 Ga0070696_100002406
874 Ga0070696_100003432
875 Ga0070696_100019377
876 Ga0070693_100002801
877 Ga0070693_100004068
878 Ga0070693_100134512
879 Ga0070665_100013962
880 Ga0070665_100079688
881 Ga0070665_100182832
882 Ga0070665_100228844
883 Ga0070704_100081645
884 Ga0068855_100000860
885 Ga0068855_100147837
886 Ga0068855_100212169
887 Ga0070664_100000222
888 Ga0068857_100038977
889 Ga0068857_100151233
890 Ga0068857_100220036
891 Ga0070702_100022199
892 Ga0068859_100040718
893 Ga0068859_100065301
894 Ga0068859_100151055
895 Ga0068859_100154208
896 Ga0068859_100166921
897 Ga0068864_100011022
898 Ga0068864_100320119
899 Ga0068866_10012480
900 Ga0068861_100055707
901 Ga0068861_100058309
902 Ga0068861_100110009
903 Ga0068863_100001797
904 Ga0068863_100098514
905 Ga0068863_100115669
906 Ga0068858_100008882
907 Ga0068858_100012838
908 Ga0068858_100016085
909 Ga0068858_100225307
910 Ga0068860_100038658
911 Ga0068860_100066375
912 Ga0068860_100215385
913 Ga0068862_100091191
914 Ga0068862_100175256
915 Ga0081455_10106957
916 Ga0081538_10013858
917 Ga0081539_10000977
918 Ga0081539_10012072
919 Ga0070717_10097772
920 Ga0070715_10000005
921 Ga0070712_100048021
922 Ga0097621_100003251
923 Ga0097621_100135745
924 Ga0068871_100003400
925 Ga0068871_100011972
926 Ga0068871_100210148
927 Ga0075428_100024598
928 Ga0075428_100032701
929 Ga0075428_100034272
930 Ga0075428_100070521
931 Ga0075430_100013445
932 Ga0075430_100206833
933 Ga0075431_100007090
934 Ga0075431_100026761
935 Ga0075431_100135097
936 Ga0075433_10057621
937 Ga0075433_10066765
938 Ga0075433_10068543
939 Ga0075433_10201513
940 Ga0075433_10333143
941 Ga0075434_100000023
942 Ga0075434_100003264
943 Ga0075434_100020114
944 Ga0075434_100169912
945 Ga0075434_100305615
946 Ga0075429_100005407
947 Ga0075429_100081098
948 Ga0068865_100005219
949 Ga0075436_100000570
950 Ga0075436_100000624
951 Ga0075436_100010079
952 Ga0075436_100016434
953 Ga0075436_100057077
954 Ga0097620_100040718
955 Ga0097620_100065301
956 Ga0097620_100151064
957 Ga0097620_100154204
958 Ga0097620_100166919
959 Ga0075435_100000037
960 Ga0075435_100003062
961 Ga0075435_100196538
962 Ga0099794_10017963
963 Ga0099794_10023938
964 Ga0099794_10093358
965 Ga0099794_10102280
966 Ga0105240_10201803
967 Ga0105240_10301717
968 Ga0111539_10001215
969 Ga0111539_10005649
970 Ga0111539_10005752
971 Ga0111539_10007447
972 Ga0111539_10017186
973 Ga0111539_10031675
974 Ga0111539_10043759
975 Ga0111539_10103045
976 Ga0111539_10165371
977 Ga0111539_10208103
978 Ga0111539_10325843
979 Ga0105245_10241979
980 Ga0105245_10405480
981 Ga0114129_10000532
982 Ga0114129_10007870
983 Ga0114129_10008261
984 Ga0114129_10008651
985 Ga0114129_10010720
986 Ga0114129_10021723
987 Ga0114129_10030805
988 Ga0114129_10062240
989 Ga0114129_10094397
990 Ga0114129_10103681
991 Ga0114129_10302332
992 Ga0114129_10357466
993 Ga0105243_10001313
994 Ga0105243_10047886
995 Ga0105243_10156139
996 Ga0105241_10031532
997 Ga0105242_10000997
998 Ga0105242_10009632
999 Ga0105242_10271424
1000 Ga0105248_10015013
1001 Ga0105248_10057589
1002 Ga0105248_10082497
1003 Ga0105248_10115731
1004 Ga0105248_10197391
1005 Ga0105248_10222613
1006 Ga0105248_10539129
1007 Ga0105237_10151569
1008 Ga0105238_10070537
1009 Ga0105238_10108114
1010 Ga0105249_10104503
1011 Ga0099796_10025194
1012 Ga0157371_10023407
1013 Ga0157371_10033303
1014 Ga0157370_10068492
1015 Ga0157369_10005912
1016 Ga0157369_10010082
1017 Ga0157369_10233964
1018 Ga0157374_10256241
1019 Ga0163162_10023280
1020 Ga0157372_10059428
1021 Ga0157372_10360868
1022 Ga0163163_10019122
1023 Ga0163163_10077488
1024 Ga0157380_10004771
1025 Ga0157380_10021373
1026 Ga0157380_10023408
1027 Ga0157380_10038123
1028 Ga0157377_10038323
1029 Ga0157379_10001085
1030 Ga0157379_10044723
1031 Ga0157376_10003868
1032 Ga0157376_10029040
1033 Ga0157376_10086649
1034 Ga0157376_10097675
1035 Ga0163161_10051920
1036 Ga0213876_10000057
1037 Ga0213876_10000172
1038 Ga0228598_1000025
1039 Ga0228598_1005065
1040 Ga0209566_100189
1041 Ga0209147_100222
1042 Ga0209147_100408
1043 Ga0209258_103941
1044 Ga0209673_1012288
1045 Ga0209025_1000127
1046 Ga0209025_1000568
1047 Ga0209025_1001477
1048 Ga0209025_1003847
1049 Ga0209025_1004999
1050 Ga0209025_1011725
1051 Ga0209025_1018270
1052 Ga0209025_1019288
1053 Ga0207697_10009622
1054 Ga0207696_1008193
1055 Ga0207653_10002016
1056 Ga0207682_10024480
1057 Ga0207680_10054194
1058 Ga0207647_10018632
1059 Ga0207647_10057778
1060 Ga0207685_10000026
1061 Ga0207699_10070043
1062 Ga0207645_10001021
1063 Ga0207645_10028529
1064 Ga0207645_10173344
1065 Ga0207705_10000648
1066 Ga0207705_10001745
1067 Ga0207705_10003867
1068 Ga0207684_10015939
1069 Ga0207684_10017140
1070 Ga0207684_10024307
1071 Ga0207684_10128245
1072 Ga0207707_10325626
1073 Ga0207695_10090405
1074 Ga0207695_10098606
1075 Ga0207693_10061849
1076 Ga0207663_10000007
1077 Ga0207663_10004341
1078 Ga0207663_10011482
1079 Ga0207663_10098338
1080 Ga0207660_10179723
1081 Ga0207662_10002970
1082 Ga0207662_10037194
1083 Ga0207657_10001247
1084 Ga0207657_10001696
1085 Ga0207657_10118582
1086 Ga0207646_10000165
1087 Ga0207646_10105599
1088 Ga0207681_10016455
1089 Ga0207681_10032205
1090 Ga0207681_10095856
1091 Ga0207681_10210456
1092 Ga0207694_10119731
1093 Ga0207650_10110218
1094 Ga0207650_10125836
1095 Ga0207659_10001618
1096 Ga0207659_10138134
1097 Ga0207700_10023389
1098 Ga0207700_10057336
1099 Ga0207664_10000037
1100 Ga0207664_10153081
1101 Ga0207644_10075116
1102 Ga0207644_10142530
1103 Ga0207690_10038910
1104 Ga0207706_10095895
1105 Ga0207686_10000208
1106 Ga0207686_10070026
1107 Ga0207686_10169196
1108 Ga0207709_10000029
1109 Ga0207669_10011976
1110 Ga0207704_10016402
1111 Ga0207665_10005191
1112 Ga0207691_10007228
1113 Ga0207691_10016335
1114 Ga0207711_10053569
1115 Ga0207711_10067280
1116 Ga0207711_10166136
1117 Ga0207689_10059057
1118 Ga0207689_10065897
1119 Ga0207689_10099778
1120 Ga0207679_10020392
1121 Ga0207667_10010703
1122 Ga0207667_10186565
1123 Ga0207667_10261311
1124 Ga0207651_10161753
1125 Ga0207712_10153811
1126 Ga0207658_10133343
1127 Ga0207703_10010431
1128 Ga0207703_10026965
1129 Ga0207703_10094455
1130 Ga0207703_10209745
1131 Ga0207678_10003131
1132 Ga0207708_10002277
1133 Ga0207708_10002474
1134 Ga0207641_10001646
1135 Ga0207641_10073196
1136 Ga0207641_10150592
1137 Ga0207648_10010792
1138 Ga0207648_10013697
1139 Ga0207648_10219657
1140 Ga0207674_10017639
1141 Ga0207674_10104184
1142 Ga0207675_100000537
1143 Ga0207675_100003240
1144 Ga0207675_100005081
1145 Ga0207675_100123314
1146 Ga0207675_100193252
1147 Ga0209588_1002959
1148 Ga0207428_10001989
1149 Ga0207428_10002691
1150 Ga0207428_10003496
1151 Ga0207428_10003822
1152 Ga0207428_10034376
1153 Ga0265354_1000043
1154 Ga0265354_1002430
1155 Ga0268266_10008285
1156 Ga0268266_10073992
1157 Ga0268266_10074202
1158 Ga0268266_10210234
1159 Ga0268265_10018307
1160 Ga0268265_10068984
1161 Ga0268264_10029562
1162 Ga0268264_10150901
1163 Ga0265770_1000453
1164 Ga0265770_1001641
1165 Ga0265765_1001703
1166 Ga0265760_10002254
1167 Ga0265760_10012555
1168 Ga0307408_100064758
1169 Ga0307408_100069761
1170 Ga0307408_100131645
1171 Ga0307405_10012489
1172 Ga0307405_10014705
1173 Ga0307405_10032782
1174 Ga0307413_10000475
1175 Ga0307413_10034252
1176 Ga0307413_10035627
1177 Ga0307413_10072258
1178 Ga0307413_10114127
1179 Ga0307410_10002922
1180 Ga0307410_10011383
1181 Ga0307410_10030355
1182 Ga0307410_10137218
1183 Ga0307410_10210775
1184 Ga0307406_10049041
1185 Ga0307406_10065609
1186 Ga0307407_10000478
1187 Ga0307407_10130235
1188 Ga0307412_10028184
1189 Ga0307412_10029476
1190 Ga0307412_10209886
1191 Ga0307409_100003586
1192 Ga0307409_100007722
1193 Ga0307409_100065669
1194 Ga0307409_100138304
1195 Ga0307409_100172712
1196 Ga0307416_100022589
1197 Ga0307416_100066510
1198 Ga0307416_100080025
1199 Ga0307416_100083060
1200 Ga0307416_100100436
1201 Ga0307416_100101098
1202 Ga0307416_100106904
1203 Ga0307416_100134513
1204 Ga0307414_10007713
1205 Ga0307414_10014163
1206 Ga0307414_10068510
1207 Ga0307414_10191275
1208 Ga0307414_10245558
1209 Ga0307411_10001105
1210 Ga0307411_10017673
1211 Ga0307411_10020174
1212 Ga0307415_100002385
1213 Ga0307415_100015437
1214 Ga0307415_100026378
1215 Ga0307415_100099242
1216 Ga0373950_0007628
1217 Ga0373938_0003512
1218 Ga0373926_0006393
1219 Ga0373926_0071066
1220 Ga0373928_0013148
1221 Ga0373934_0028713
1222 Ga0373940_0000100
1223 Ga0373949_0004862
1224 Ga0373951_0001096
1225 Ga0373952_0000066
1226 Ga0373923_0012504
1227 Ga0373932_0005597
1228 Ga0373939_0001899
1229 Ga0373941_0014160
1230 Ga0373945_0027709
1231 Ga0373953_0046195
1232 Ga0373960_0000575
1233 Ga0373943_0000346
1234 Ga0373943_0040201
1235 Ga0373946_0001109
1236 Ga0373955_0015102
1237 Ga0373942_0004904
1238 Ga0373961_0005994
1239 Ga0373962_0001444
1240 Ga0373924_0000090
1241 Ga0373924_0000745
1242 Ga0373924_0025464
1243 Ga0373924_0043785
1244 Ga0373931_0001298
1245 Ga0373931_0063533
1246 Ga0373935_0003926
1247 Ga0373935_0037132
1248 Ga0373927_0000206
1249 Ga0373927_0000276
1250 Ga0373927_0007405
1251 Ga0373927_0014703
1252 Ga0373927_0037217
1253 Ga0373927_0053782
1254 Ga0373933_0000301
1255 Ga0373933_0167662
1256 Ga0373947_0000122
1257 Ga0373947_0000282
1258 Ga0373947_0108408
1259 Ga0373937_0000288
1260 Ga0373937_0007732
1261 Ga0373937_0100131
1262 Ga0373937_0137368
1263 Ga0373937_0442713
1264 Ga0373925_0000103
1265 Ga0373925_0000934
1266 Ga0373925_0038257
1267 Ga0373925_0070966
1268 Ga0373925_0338171
1269 Ga0395899_0004515
1270 Ga0395899_0043639
1271 Ga0395900_0000777
1272 Ga0395898_0015202
1273 Ga0395898_0064107
1274 Ga0395905_0183418
1275 Ga0395905_0386107
1276 Ga0395901_0006976
1277 Ga0400483_137280
1278 Ga0400483_206430
1279 Ga0436365_1041616
1280 Ga0436365_1521843
1281 Ga0436365_1928925
1282 Ga0439433_0005733
1283 Ga0453683_0003399
1284 Ga0453683_0043010
1285 Ga0453683_0083804
1286 Ga0466963_0186800
1287 Ga0453684_0006038
1288 Ga0453684_0179507
1289 Ga0453684_0403315
1290 Ga0466957_0078266
1291 Ga0466959_0038379
1292 Ga0451576_0183014
1293 Ga0451576_0278924
1294 Ga0466967_0001131
1295 Ga0495629_0063427
1296 Ga0495651_0008643
1297 Ga0495580_0019767
1298 Ga0495580_0096140
1299 Ga0495580_0117149
1300 Ga0495580_0154089
1301 Ga0495582_0161517
1302 Ga0495664_0002852
1303 Ga0495664_0003856
1304 Ga0495585_0018584
1305 Ga0495608_0005145
1306 Ga0495608_0019436
1307 Ga0495618_0011895
1308 Ga0495618_0126032
1309 Ga0495628_0033769
1310 Ga0495628_0161114
1311 Ga0495628_0248046
1312 Ga0495630_0002908
1313 Ga0495630_0124808
1314 Ga0495630_0130827
1315 Ga0495663_0017588
1316 Ga0495652_0005051
1317 Ga0495665_0037808
1318 Ga0495640_0065239
1319 Ga0495640_0122168
1320 Ga0495586_0159106
1321 Ga0495587_0000157
1322 Ga0495587_0017031
1323 Ga0495598_0013761
1324 Ga0495645_0001995
1325 Ga0495645_0009754
1326 Ga0495645_0098574
1327 Ga0495645_0176861
1328 Ga0495633_0012417
1329 Ga0495667_0010475
1330 Ga0495668_0109500
1331 Ga0495635_0040764
1332 Ga0495599_0015224
1333 Ga0495599_0022903
1334 Ga0495646_0038807
1335 Ga0495647_0031398
1336 Ga0495658_0044613
1337 Ga0495669_0029222
1338 Ga0495613_0000975
1339 Ga0495613_0072602
1340 Ga0495600_0066149
1341 Ga0495581_0026269
1342 Ga0495604_0030764
1343 Ga0495604_0037249
1344 Ga0495604_0069462
1345 Ga0495604_0127199
1346 Ga0495674_0044282
1347 Ga0495674_0067232
1348 Ga0495674_0107073
1349 Ga0495674_0111913
1350 Ga0495680_0097390
1351 Ga0495675_0000271
1352 Ga0495675_0075258
1353 Ga0495675_0126630
1354 Ga0495684_0000140
1355 Ga0495602_0000436
1356 Ga0495602_0197422
1357 Ga0496101_0001225
1358 Ga0496102_0003727
1359 Ga0496103_0034893
1360 Ga0496104_0001234
1361 Ga0496104_0016644
1362 Ga0496104_0017205
1363 Ga0496105_0000459
1364 Ga0496105_0001553
1365 Ga0496105_0030664
1366 Ga0496106_0078251
1367 Ga0496106_0253012
1368 Ga0496107_0000344
1369 Ga0496108_0003238
1370 Ga0496108_0016078
1371 Ga0496108_0032273
1372 Ga0496108_0173347
1373 Ga0496109_0000017
1374 Ga0496109_0002270
1375 Ga0496109_0006048
1376 Ga0496110_0000702
1377 Ga0496110_0001502
1378 Ga0496111_0000975
1379 Ga0496111_0065963
1380 Ga0496111_0116269
1381 Ga0496111_0182539
1382 Ga0496112_0045473
1383 Ga0496112_0048345
1384 Ga0496112_0266584
1385 Ga0496113_0002031
1386 Ga0496113_0013697
1387 Ga0496113_0037688
1388 Ga0496113_0043798
1389 Ga0496115_0069688
1390 Ga0496116_0074330
1391 Ga0496117_0024889
1392 Ga0496119_0014455
1393 Ga0496122_0095370
1394 Ga0496123_0064158
1395 Ga0496125_0006855
1396 Ga0496126_0022141
1397 Ga0501299_002955
1398 Ga0501034_0091519
1399 Ga0501040_0128101
1400 Ga0501043_0058263
1401 Ga0501046_0008079
1402 Ga0501046_0011500
1403 Ga0501069_0005025
1404 Ga0501070_0002408
1405 Ga0501070_0005681
1406 Ga0501217_011590
1407 Ga0501233_017831
1408 Ga0501239_004438
1409 Ga0501225_0025032
1410 Ga0501263_002074
1411 Ga0501044_0102179
1412 nmdc:mga05p37_10832_c1
1413 nmdc:mga05p37_11279_c1
1414 nmdc:mga05p37_1165_c1
1415 nmdc:mga05p37_117362_c1
1416 nmdc:mga05p37_132238_c1
1417 nmdc:mga05p37_27640_c2
1418 nmdc:mga05p37_338_c1
1419 nmdc:mga05p37_50113_c1
1420 nmdc:mga05p37_50822_c1
1421 nmdc:mga05p37_519542_c1
1422 nmdc:mga05p37_72964_c1
1423 nmdc:mga05p37_76966_c1
1424 nmdc:mga05p37_90747_c1
1425 nmdc:mga05p37_95439_c1
1426 nmdc:mga09592_130649_c1
1427 nmdc:mga09592_141707_c1
1428 nmdc:mga09592_17324_c1
1429 nmdc:mga0qj67_278446_c1
1430 nmdc:mga0qj67_89657_c1
1431 nmdc:mga06r32_114934_c1
1432 nmdc:mga06r32_120606_c1
1433 nmdc:mga06r32_20679_c1
1434 nmdc:mga06r32_4544_c1
1435 nmdc:mga08y16_19347_c1
1436 nmdc:mga08y16_23314_c1
1437 nmdc:mga08y16_30254_c1
1438 nmdc:mga08y16_34585_c1
1439 nmdc:mga08y16_3503_c1
1440 nmdc:mga08y16_355230_c1
1441 nmdc:mga08y16_418427_c1
1442 nmdc:mga08y16_47753_c1
1443 nmdc:mga08y16_5471_c1
1444 nmdc:mga08y16_717_c1
1445 nmdc:mga0n895_217096_c1
1446 nmdc:mga0n895_24209_c1
1447 nmdc:mga0n895_4_c1
1448 nmdc:mga0n895_71952_c1
1449 nmdc:mga0rr50_103115_c1
1450 nmdc:mga0rr50_2498_c1
1451 nmdc:mga0rr50_4_c1
1452 nmdc:mga08x19_102_c1
1453 nmdc:mga08x19_1094_c1
1454 nmdc:mga08x19_27075_c1
1455 nmdc:mga08x19_2_c1
1456 nmdc:mga08x19_45195_c1
1457 nmdc:mga08x19_81513_c1
1458 nmdc:mga0a205_125441_c1
1459 nmdc:mga0a205_125803_c1
1460 nmdc:mga0a205_20752_c1
1461 nmdc:mga0a205_229867_c1
1462 nmdc:mga0a205_346275_c1
1463 nmdc:mga0a205_38567_c1
1464 nmdc:mga0a205_6003_c1
1465 nmdc:mga0a205_83503_c1
1466 nmdc:mga0a205_92060_c1
1467 Ga0495601_0013126
1468 Ga0495619_0028505
1469 Ga0495619_0033268
1470 Ga0500647_0127564
1471 Ga0500604_0024330
1472 Ga0501084_0036866
1473 Ga0590071_000051
1474 Ga0590071_015920
1475 Ga0590075_000109
1476 Ga0590077_000102
1477 Ga0501082_0178622
1478 Ga0501082_0208170
1479 2595088534
1480 2644717953
1481 2644724851
1482 2738814634
1483 2739268226
1484 2753766419
1485 2757565387
1486 2777763833
1487 2777837087
1488 2816863749
1489 2819707113
1490 2842685362
1491 2842882575
1492 2849140653
1493 2857584500
1494 2857588295
1495 2874609184
1496 2898909718
1497 2904526759
1498 2919144649
1499 2919519840
1500 2919720980
1501 2928095272
1502 2928513619
1503 2929008988
1504 2936342808
1505 2936365794
1506 2960324930
1507 2960377526
1508 2977257139
1509 2990278034
1510 8022897305
1511 8022919043
1512 8054280766
1513 8057634355
1514 8057736365

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

252

403

0.99

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

267

386

0.91

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

136

240

0.87

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

9

132

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr3-assembly1.cif.gz_A structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus 0.9695 2 397
2wbi-assembly1.cif.gz_A-2 crystal structure of human acyl-coa dehydrogenase 11 0.9666 4 400
4hr3-assembly1.cif.gz_A structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus 0.9576 2 397
2wbi-assembly1.cif.gz_A-2 crystal structure of human acyl-coa dehydrogenase 11 0.957 4 400
2wbi-assembly1.cif.gz_B-2 crystal structure of human acyl-coa dehydrogenase 11 0.9514 4 400
ID Description Score Start End Superfamily
af_P96831_241_401_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9917 246 394 1.20.140.10
af_Q8K370_905_1064_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9827 244 399 1.20.140.10
af_Q6JQN1_657_789_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9797 3 128 1.10.540.10
af_P96808_263_418_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9745 249 397 1.20.140.10
af_B3DMA2_618_779_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9735 244 400 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2E4VLD0-F1-model_v4 deleted 0.994 263 397
AF-A0A3B9BL99-F1-model_v4 Acyl-CoA dehydrogenase 0.9893 259 400 GO:0003995
GO:0005737
GO:0033539
AF-A0A2D7ALT0-F1-model_v4 Acyl-CoA dehydrogenase 0.9887 1 397 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-H2Z028-F1-model_v4 Acyl-CoA dehydrogenase family member 11 0.9879 4 395 GO:0003995
GO:0005777
GO:0031966
GO:0033539
GO:0050660
AF-A0A840N4I1-F1-model_v4 Alkylation response protein AidB-like acyl-CoA dehydrogenase 0.9876 263 399 GO:0003995
GO:0005737
GO:0033539

Map