F479366

General Info

Members Datasets Scaffolds Average Seq Length
756 562 1512 436

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0001805|Ga0501082_0001805_17244_18740
Length 498
Sequence MSSCSVRPRFAPRSPRPRAASRRRIARADTDARSVVESAASFHARGVPNVDNAISELLSIAAVFLLVFANGFFVAAEFSLVAVRRSRVTELVGEGRRNARALQHAVDRLDASLAATQLGITISSLALGWIGEPALAHLVEPLLAPLGAWAESASHGISVAIAFIVITALHIVLGELAPKSLALQRSEGTALVIVRPLALFLFVFRPAISLLNGLGNGVLRLFGLQPGSGEESLHSPDELKLLVAESRRAGLLQRAQQEVVERTFNLGARRVRDIMTTRPDVEWIDADDDRATMLAAIRRCGHEQMLVGRGSIDDVLGVLSKRDLLDRLLDGGDADPLALVAEPLILHEATPILKVLEQFRTRPVSMALVTDDYGTLGGILTRTDLLEAIAGELRDADDEDAEIVARDDGSFLIDGLTAVAGVFDRLGIRRWPDVRDFNTIAGFALQQFGRIPEVGEHVDWEGWRFEIVDRDGNRIDKMLVAKLPESRDESEDDADTSG

Samples

Sample ID Description Type Environment
1 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
91 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
99 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
160 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
163 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
248 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
249 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
250 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
254 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
255 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
256 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
257 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
258 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
261 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
271 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
283 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
284 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
285 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
286 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
287 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
291 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
292 2509276019 Ensifer aridi TW10 Isolate Nodule
293 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
294 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
295 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
296 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
297 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
298 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
299 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
300 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
301 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
302 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
303 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
304 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
305 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
306 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
307 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
308 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
309 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
310 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
311 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
312 2516143018 Ensifer sp. BR816 Isolate Nodule
313 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
314 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
315 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
316 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
317 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
318 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
319 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
320 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
321 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
322 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
323 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
324 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
325 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
326 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
327 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
328 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
329 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
330 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
331 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
332 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
333 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
334 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
335 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
336 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
337 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
338 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
339 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
340 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
341 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
342 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
343 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
344 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
345 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
346 2643221655 Ensifer sp. Root1252 Isolate Unclassified
347 2643221659 Ensifer sp. Root127 Isolate Unclassified
348 2643221698 Ensifer sp. Root142 Isolate Unclassified
349 2643221712 Ensifer sp. Root258 Isolate Unclassified
350 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
351 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
352 2718217882 Rhizobium sp. N741 Isolate Nodule
353 2718217927 Rhizobium sp. N324 Isolate Nodule
354 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
355 2718218009 Rhizobium sp. N561 Isolate Nodule
356 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
357 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
358 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
359 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
360 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
361 2718218363 Rhizobium sp. N113 Isolate Nodule
362 2718218365 Rhizobium sp. N731 Isolate Nodule
363 2718218366 Rhizobium sp. N621 Isolate Nodule
364 2718218423 Rhizobium sp. N941 Isolate Nodule
365 2721755514 Rhizobium sp. N6212 Isolate Nodule
366 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
367 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
368 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
369 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
370 2721755809 Rhizobium sp. N541 Isolate Nodule
371 2721755810 Rhizobium sp. N871 Isolate Nodule
372 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
373 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
374 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
375 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
376 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
377 2728369365 Rhizobium sp. N1341 Isolate Nodule
378 2728369397 Rhizobium sp. N1314 Isolate Nodule
379 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
380 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
381 2738543024 Aminobacter sp. AP02 Isolate Unclassified
382 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
383 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
384 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
385 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
386 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
387 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
388 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
389 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
390 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
391 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
392 2791355256 Rhizobium sp. M10 Isolate Nodule
393 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
394 2791355260 Rhizobium sp. L9 Isolate Nodule
395 2791355261 Rhizobium sp. J15 Isolate Nodule
396 2791355262 Rhizobium sp. M1 Isolate Nodule
397 2791355263 Rhizobium chutanense C5 Isolate Nodule
398 2791355264 Rhizobium sp. S9 Isolate Nodule
399 2791355265 Rhizobium sp. H4 Isolate Nodule
400 2791355266 Rhizobium sp. L43 Isolate Nodule
401 2791355267 Rhizobium sp. L18 Isolate Nodule
402 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
403 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
404 2802429633 Rhizobium anhuiense J3 Isolate Nodule
405 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
406 2802429637 Rhizobium anhuiense C15 Isolate Nodule
407 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
408 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
409 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
410 2818991467 Bosea vestrisii 3192 Isolate Unclassified
411 2831426010 Nostoc sp. 106C Isolate Unclassified
412 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
413 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
414 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
415 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
416 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
417 2838048938 Rhizobium pisi 27/80 Isolate Nodule
418 2838061910 Rhizobium phaseoli L15 Isolate Nodule
419 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
420 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
421 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
422 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
423 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
424 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
425 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
426 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
427 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
428 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
429 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
430 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
431 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
432 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
433 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
434 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
435 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
436 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
437 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
438 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
439 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
440 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
441 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
442 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
443 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
444 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
445 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
446 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
447 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
448 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
449 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
450 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
451 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
452 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
453 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
454 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
455 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
456 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
457 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
458 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
459 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
460 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
461 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
462 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
463 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
464 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
465 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
466 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
467 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
468 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
469 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
470 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
471 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
472 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
473 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
474 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
475 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
476 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
477 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
478 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
479 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
480 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
481 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
482 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
483 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
484 2849660919 Nostoc sp. T09 Isolate Unclassified
485 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
486 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
487 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
488 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
489 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
490 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
491 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
492 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
493 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
494 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
495 2909042592 Labrys sp. LIt4 Isolate Nodule
496 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
497 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
498 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
499 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
500 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
501 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
502 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
503 2933599457 Rhizobium phaseoli M3 Isolate Nodule
504 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
505 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
506 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
507 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
508 2936381700 Rhizobium chutanense C16 Isolate Unclassified
509 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
510 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
511 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
512 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
513 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
514 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
515 2996893221 Rhizobium sp. R635 Isolate Nodule
516 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
517 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
518 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
519 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
520 641522639 Methylobacterium sp. 4-46 Isolate Nodule
521 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
522 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
523 8005275841 Rhizobium sp. N4311 Isolate Nodule
524 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
525 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
526 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
527 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
528 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
529 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
530 8005382845 Rhizobium sp. R634 Isolate Nodule
531 8005395548 Rhizobium sp. R339 Isolate Nodule
532 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
533 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
534 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
535 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
536 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
537 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
538 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
539 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
540 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
541 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
542 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
543 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
544 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
545 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
546 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
547 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
548 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
549 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
550 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
551 8018176218 Rhizobium sp. N122 Isolate Nodule
552 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
553 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
554 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
555 8024501048 Rhizobium sp. H4 Isolate Nodule
556 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
557 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
558 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
559 8056382006 Rhizobium croatiense 13T Isolate Nodule
560 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
561 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule
562 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 63.36
Metatranscriptomes 0.26
Isolates 36.38

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 9.92
Nodule 26.06
Rhizoplane 1.19
Rhizosphere 50.66
Stem 0
Stem Tuber 0
Unclassified 2.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501082_0001805 3300060353 Bacteria 18830
2 CNBas_1000573 3300000531 Bacteria 1664
3 JGI24740J21852_10001797 3300001979 Bacteria 9835
4 JGI25155J39150_1000006 3300002704 Bacteria 244109
5 JGI25156J39149_1000105 3300002705 Bacteria 61721
6 JGI25162J39368_1000266 3300002737 Bacteria 50234
7 JGI25162J39368_1000694 3300002737 Bacteria 23425
8 JGI25154J39366_1000055 3300002738 Bacteria 115597
9 JGI25154J39366_1000085 3300002738 Bacteria 87994
10 JGI25157J39369_1000782 3300002741 Bacteria 16312
11 JGI25157J39369_1001299 3300002741 Bacteria 10005
12 JGI25159J45721_1003157 3300002987 Bacteria 5930
13 JGI25151J46595_10000723 3300003187 Bacteria 27441
14 JGI25165J46597_1000028 3300003214 Bacteria 325146
15 JGI25165J46597_1000579 3300003214 Bacteria 32228
16 JGI25165J46597_1000786 3300003214 Bacteria 24098
17 JGI25165J46597_1005162 3300003214 Bacteria 2582
18 rootL2_10112396 3300003322 Bacteria 2429
19 rootH1_10013182 3300003323 Bacteria 4247
20 JGI25160J50197_1000053 3300003354 Bacteria 127632
21 JGI25160J50197_1000782 3300003354 Bacteria 17066
22 JGI25161J50226_1000039 3300003374 Bacteria 127632
23 JGI25161J50226_1004458 3300003374 Bacteria 2926
24 Ga0055535_1002072 3300003761 Bacteria 8013
25 Ga0055542_1000637 3300003762 Bacteria 29408
26 Ga0055526_1007484 3300003771 Bacteria 5660
27 Ga0055528_1000331 3300003790 Bacteria 39811
28 Ga0055540_1000508 3300003792 Bacteria 29469
29 Ga0055543_1000015 3300004625 Bacteria 177197
30 Ga0055543_1002085 3300004625 Bacteria 6961
31 Ga0065165_1000568 3300005262 Bacteria 54881
32 Ga0065712_10005803 3300005290 Bacteria 3873
33 Ga0065715_10144541 3300005293 Bacteria 1806
34 Ga0070670_100012940 3300005331 Bacteria 7144
35 Ga0070670_100088723 3300005331 Bacteria 2658
36 Ga0068869_100164561 3300005334 Bacteria 1729
37 Ga0070660_100088287 3300005339 Unclassified 2442
38 Ga0070668_100068317 3300005347 Bacteria 2762
39 Ga0070673_100004801 3300005364 Bacteria 8593
40 Ga0070688_100041762 3300005365 Bacteria 2817
41 Ga0070714_100071416 3300005435 Bacteria 3001
42 Ga0070700_100066774 3300005441 Bacteria 2284
43 Ga0070694_100168259 3300005444 Bacteria 1613
44 Ga0070708_100264862 3300005445 Bacteria 1616
45 Ga0070678_100018012 3300005456 Bacteria 4566
46 Ga0070707_100000311 3300005468 Bacteria 47815
47 Ga0070698_100141780 3300005471 Bacteria 2354
48 Ga0070699_100117102 3300005518 Bacteria 2342
49 Ga0068853_100025963 3300005539 Bacteria 4916
50 Ga0070696_100032609 3300005546 Bacteria 3574
51 Ga0070696_100162136 3300005546 Bacteria 1648
52 Ga0070665_100000062 3300005548 Bacteria 220304
53 Ga0070665_100031499 3300005548 Bacteria 5338
54 Ga0070665_100058339 3300005548 Bacteria 3870
55 Ga0068856_100035355 3300005614 Bacteria 4896
56 Ga0068859_100047771 3300005617 Bacteria 4300
57 Ga0068864_100018691 3300005618 Bacteria 5792
58 Ga0068858_100035682 3300005842 Bacteria 4611
59 Ga0068860_100091604 3300005843 Bacteria 2896
60 Ga0068862_100130067 3300005844 Bacteria 2226
61 Ga0081455_10002201 3300005937 Bacteria 23206
62 Ga0081538_10000940 3300005981 Bacteria 31406
63 Ga0081538_10007360 3300005981 Bacteria 9533
64 Ga0081538_10027369 3300005981 Unclassified 3955
65 Ga0081540_1006757 3300005983 Bacteria 8294
66 Ga0081540_1012046 3300005983 Bacteria 5723
67 Ga0081539_10001282 3300005985 Bacteria 44233
68 Ga0081539_10014005 3300005985 Bacteria 5977
69 Ga0075365_10000388 3300006038 Bacteria 16068
70 Ga0070712_100113269 3300006175 Bacteria 2028
71 Ga0075367_10001308 3300006178 Bacteria 10547
72 Ga0075369_10000195 3300006186 Bacteria 17558
73 Ga0075369_10018748 3300006186 Bacteria 2820
74 Ga0075366_10026651 3300006195 Bacteria 3387
75 Ga0097621_100000830 3300006237 Bacteria 21817
76 Ga0075370_10005893 3300006353 Bacteria 6128
77 Ga0075370_10039003 3300006353 Bacteria 2675
78 Ga0068871_100013903 3300006358 Bacteria 5985
79 Ga0075428_100005413 3300006844 Bacteria 14191
80 Ga0075434_100053103 3300006871 Bacteria 4027
81 Ga0075434_100189570 3300006871 Bacteria 2076
82 Ga0075429_100020373 3300006880 Bacteria 5753
83 Ga0097620_100047772 3300006931 Bacteria 4300
84 Ga0075435_100247909 3300007076 Bacteria 1516
85 Ga0105251_10092498 3300009011 Bacteria 1388
86 Ga0105244_10001313 3300009036 Bacteria 20331
87 Ga0105244_10050599 3300009036 Bacteria 2119
88 Ga0105240_10000027 3300009093 Bacteria 348486
89 Ga0105240_10083097 3300009093 Bacteria 3931
90 Ga0111539_10018085 3300009094 Bacteria 8732
91 Ga0111539_10052837 3300009094 Unclassified 4836
92 Ga0111539_10125168 3300009094 Bacteria 3012
93 Ga0111539_10137172 3300009094 Bacteria 2865
94 Ga0105247_10037197 3300009101 Bacteria 2970
95 Ga0105241_10030333 3300009174 Bacteria 4040
96 Ga0105248_10234943 3300009177 Bacteria 2064
97 Ga0105237_10003395 3300009545 Bacteria 18937
98 Ga0105238_10028931 3300009551 Bacteria 5644
99 Ga0105249_10084241 3300009553 Bacteria 2960
100 Ga0105249_10144657 3300009553 Bacteria 2283
101 Ga0123341_1000576 3300009765 Bacteria 23339
102 Ga0105239_10006404 3300010375 Bacteria 13670
103 Ga0105239_10010405 3300010375 Bacteria 10406
104 Ga0105239_10066579 3300010375 Bacteria 3957
105 Ga0105239_10177236 3300010375 Unclassified 2384
106 Ga0105239_10334535 3300010375 Bacteria 1708
107 Ga0157370_10036186 3300013104 Bacteria 4792
108 Ga0157374_10219244 3300013296 Unclassified 1866
109 Ga0157378_10054267 3300013297 Bacteria 3568
110 Ga0163162_10076836 3300013306 Bacteria 3402
111 Ga0157372_10381673 3300013307 Bacteria 1642
112 Ga0157375_10162492 3300013308 Bacteria 2376
113 Ga0163163_10151820 3300014325 Bacteria 2360
114 Ga0157380_10367686 3300014326 Bacteria 1352
115 Ga0157379_10048711 3300014968 Bacteria 3782
116 Ga0182007_10003280 3300015262 Bacteria 7687
117 Ga0182005_1004517 3300015265 Bacteria 4484
118 Ga0182005_1006088 3300015265 Bacteria 3719
119 Ga0214542_1023097 3300021321 Bacteria 3815
120 Ga0214543_1000005 3300021327 Bacteria 454523
121 Ga0209435_100011 3300025206 Bacteria 413027
122 Ga0209672_102283 3300025228 Bacteria 4911
123 Ga0209672_104514 3300025228 Bacteria 2572
124 Ga0209437_100033 3300025233 Bacteria 512520
125 Ga0209437_100036 3300025233 Bacteria 469153
126 Ga0209258_100265 3300025242 Bacteria 90172
127 Ga0209646_1000024 3300025246 Bacteria 413027
128 Ga0209026_1000009 3300025250 Bacteria 531812
129 Ga0209026_1000081 3300025250 Bacteria 196861
130 Ga0209677_100188 3300025253 Bacteria 50341
131 Ga0209148_1000065 3300025254 Bacteria 344489
132 Ga0209759_1000011 3300025256 Bacteria 413027
133 Ga0209759_1000117 3300025256 Bacteria 141785
134 Ga0209233_1000056 3300025261 Bacteria 438104
135 Ga0209233_1000087 3300025261 Bacteria 325225
136 Ga0209233_1000152 3300025261 Bacteria 175910
137 Ga0209233_1000271 3300025261 Bacteria 73658
138 Ga0209455_1001167 3300025272 Bacteria 12638
139 Ga0209673_1000384 3300025273 Bacteria 79540
140 Ga0209673_1005485 3300025273 Bacteria 6359
141 Ga0209673_1005540 3300025273 Bacteria 6318
142 Ga0209130_1000038 3300025284 Bacteria 264226
143 Ga0209025_1000058 3300025294 Bacteria 311398
144 Ga0209564_1000388 3300025295 Bacteria 79331
145 Ga0209564_1000458 3300025295 Bacteria 68749
146 Ga0209758_1001805 3300025297 Bacteria 23641
147 Ga0209758_1007127 3300025297 Bacteria 7727
148 Ga0209256_1001984 3300025299 Bacteria 18424
149 Ga0209256_1016697 3300025299 Bacteria 2484
150 Ga0207426_1000081 3300025302 Bacteria 304502
151 Ga0207426_1001412 3300025302 Bacteria 20129
152 Ga0209051_1002798 3300025303 Bacteria 12036
153 Ga0209257_1001598 3300025304 Bacteria 25935
154 Ga0207697_10045151 3300025315 Bacteria 1813
155 Ga0207655_1000184 3300025728 Bacteria 111832
156 Ga0207647_10006297 3300025904 Bacteria 8640
157 Ga0207643_10019727 3300025908 Bacteria 3696
158 Ga0207695_10000024 3300025913 Bacteria 632311
159 Ga0207695_10154117 3300025913 Bacteria 2234
160 Ga0207671_10001033 3300025914 Bacteria 33897
161 Ga0207693_10126913 3300025915 Bacteria 2005
162 Ga0207660_10125726 3300025917 Bacteria 1947
163 Ga0207662_10080040 3300025918 Bacteria 1992
164 Ga0207646_10000581 3300025922 Bacteria 47822
165 Ga0207646_10015623 3300025922 Bacteria 7162
166 Ga0207650_10001778 3300025925 Bacteria 15244
167 Ga0207706_10191256 3300025933 Bacteria 1796
168 Ga0207704_10059725 3300025938 Bacteria 2355
169 Ga0207691_10052459 3300025940 Bacteria 3724
170 Ga0207689_10246350 3300025942 Bacteria 1478
171 Ga0207651_10046768 3300025960 Bacteria 2913
172 Ga0207651_10054172 3300025960 Bacteria 2747
173 Ga0207677_10162928 3300026023 Bacteria 1735
174 Ga0207639_10196110 3300026041 Bacteria 1728
175 Ga0207708_10053629 3300026075 Bacteria 3073
176 Ga0207702_10060372 3300026078 Bacteria 3232
177 Ga0207648_10044647 3300026089 Bacteria 3889
178 Ga0207676_10068903 3300026095 Bacteria 2831
179 Ga0207683_10024976 3300026121 Bacteria 5151
180 Ga0207698_10149033 3300026142 Bacteria 2028
181 Ga0209371_1002612 3300027312 Bacteria 9883
182 Ga0207428_10023006 3300027907 Bacteria 5248
183 Ga0268266_10000001 3300028379 Bacteria 4040580
184 Ga0268266_10099091 3300028379 Bacteria 2565
185 Ga0268266_10227133 3300028379 Bacteria 1718
186 Ga0268264_10078150 3300028381 Bacteria 2820
187 Ga0265318_10034433 3300028577 Unclassified 1953
188 Ga0307515_10005688 3300028794 Bacteria 25165
189 Ga0307515_10083019 3300028794 Bacteria 4135
190 Ga0268256_1002306 3300030500 Bacteria 9883
191 Ga0307513_10046157 3300031456 Bacteria 4755
192 Ga0307408_100002979 3300031548 Bacteria 11725
193 Ga0307408_100066548 3300031548 Bacteria 2647
194 Ga0307508_10031735 3300031616 Bacteria 4774
195 Ga0307405_10005397 3300031731 Bacteria 6163
196 Ga0307406_10001179 3300031901 Bacteria 14621
197 Ga0307406_10181632 3300031901 Bacteria 1532
198 Ga0307412_10006822 3300031911 Bacteria 6479
199 Ga0307412_10117185 3300031911 Bacteria 1912
200 Ga0307416_100167753 3300032002 Bacteria 2039
201 Ga0307414_10002528 3300032004 Bacteria 9600
202 Ga0307414_10143445 3300032004 Bacteria 1873
203 Ga0307415_100000420 3300032126 Bacteria 18169
204 Ga0307415_100181588 3300032126 Bacteria 1651
205 Ga0373937_0017691 3300036401 Bacteria 6358
206 Ga0373925_0142571 3300037068 Bacteria 1876
207 Ga0395899_0000047 3300037312 Bacteria 233482
208 Ga0395900_0000011 3300037418 Bacteria 421926
209 Ga0395898_0000058 3300037466 Bacteria 277701
210 Ga0439436_0009316 3300041404 Bacteria 3010
211 Ga0439465_0010016 3300041413 Bacteria 2982
212 Ga0451787_044841 3300041441 Bacteria 2281
213 Ga0451835_0278968 3300041492 Bacteria 3904
214 Ga0451847_0193794 3300041503 Bacteria 1763
215 Ga0451851_0998667 3300041507 Bacteria 1468
216 Ga0451853_1774076 3300041512 Bacteria 1753
217 Ga0439432_017708 3300042006 Bacteria 2389
218 Ga0439449_0000817 3300042007 Bacteria 12008
219 Ga0439449_0002007 3300042007 Bacteria 8002
220 Ga0451577_0000001 3300042876 Bacteria 2461803
221 Ga0453683_0147470 3300044673 Bacteria 1486
222 Ga0466966_0002414 3300044684 Bacteria 12207
223 Ga0466966_0006828 3300044684 Bacteria 7561
224 Ga0466966_0114037 3300044684 Bacteria 1664
225 Ga0466961_0001713 3300044693 Bacteria 13646
226 Ga0466963_0013795 3300044694 Bacteria 4973
227 Ga0453684_0090396 3300044712 Bacteria 3783
228 Ga0453684_0106391 3300044712 Unclassified 3419
229 Ga0453684_0126109 3300044712 Bacteria 3081
230 Ga0466970_0002744 3300044765 Bacteria 8502
231 Ga0466970_0005938 3300044765 Bacteria 6087
232 Ga0466959_0001599 3300045049 Bacteria 13976
233 Ga0451576_0003396 3300045051 Bacteria 21953
234 Ga0451576_0029706 3300045051 Bacteria 5847
235 Ga0451576_0121220 3300045051 Bacteria 2723
236 Ga0466967_0273145 3300045976 Bacteria 1620
237 Ga0495617_007029 3300046452 Bacteria 3924
238 Ga0495617_024020 3300046452 Bacteria 2058
239 Ga0495638_0000032 3300046460 Bacteria 293796
240 Ga0495638_0000037 3300046460 Bacteria 261778
241 Ga0495638_0000163 3300046460 Bacteria 103363
242 Ga0495651_0018760 3300046462 Bacteria 5359
243 Ga0495605_0001143 3300046474 Bacteria 17609
244 Ga0495605_0041683 3300046474 Bacteria 2286
245 Ga0495585_0006766 3300046492 Bacteria 7076
246 Ga0495585_0058989 3300046492 Bacteria 2116
247 Ga0495607_0052311 3300046501 Bacteria 2366
248 Ga0495607_0064827 3300046501 Bacteria 2062
249 Ga0495583_0003636 3300046506 Bacteria 11518
250 Ga0495583_0011102 3300046506 Bacteria 5191
251 Ga0495620_0032172 3300046515 Bacteria 2393
252 Ga0495631_0005088 3300046518 Bacteria 6925
253 Ga0495631_0035123 3300046518 Bacteria 2244
254 Ga0495631_0067618 3300046518 Bacteria 1546
255 Ga0495632_0005665 3300046519 Bacteria 8213
256 Ga0495632_0041211 3300046519 Bacteria 2321
257 Ga0495643_0001423 3300046522 Bacteria 22153
258 Ga0495643_0037042 3300046522 Bacteria 2677
259 Ga0495643_0048962 3300046522 Bacteria 2281
260 Ga0495643_0104562 3300046522 Bacteria 1447
261 Ga0495654_0025092 3300046530 Bacteria 3073
262 Ga0495609_0002759 3300046538 Bacteria 10572
263 Ga0495633_0000232 3300046558 Bacteria 67995
264 Ga0495633_0010450 3300046558 Bacteria 5062
265 Ga0495656_0031338 3300046615 Bacteria 2156
266 Ga0495668_0004661 3300046616 Bacteria 9625
267 Ga0495625_0000118 3300046660 Bacteria 121755
268 Ga0495625_0000326 3300046660 Bacteria 72590
269 Ga0495625_0011026 3300046660 Bacteria 7412
270 Ga0495625_0028356 3300046660 Bacteria 4200
271 Ga0495625_0047676 3300046660 Bacteria 3088
272 Ga0495661_0077909 3300046665 Bacteria 1919
273 Ga0495670_0029727 3300046691 Bacteria 2713
274 Ga0495589_0029632 3300046794 Bacteria 2760
275 Ga0495660_0000001 3300046810 Bacteria 1431121
276 Ga0495660_0018736 3300046810 Bacteria 3975
277 Ga0495660_0019203 3300046810 Bacteria 3925
278 Ga0495660_0046569 3300046810 Bacteria 2378
279 Ga0495636_0045053 3300047318 Bacteria 1838
280 Ga0495674_0132445 3300047319 Bacteria 2100
281 Ga0495672_0019828 3300047320 Bacteria 4424
282 Ga0495687_059714 3300047443 Bacteria 1576
283 Ga0495681_0000091 3300047470 Bacteria 79305
284 Ga0495681_0033089 3300047470 Bacteria 2594
285 Ga0495686_0002874 3300047472 Bacteria 15476
286 Ga0495626_0012791 3300048091 Bacteria 4384
287 Ga0496100_0044484 3300048903 Bacteria 2844
288 Ga0496102_0141689 3300048905 Bacteria 2254
289 Ga0496103_0021165 3300048906 Bacteria 3913
290 Ga0496106_0054828 3300048909 Bacteria 3012
291 Ga0496107_0057780 3300048910 Bacteria 2804
292 Ga0496112_0304270 3300048915 Bacteria 1540
293 Ga0496117_0033596 3300048920 Bacteria 3876
294 Ga0496117_0109064 3300048920 Bacteria 1729
295 Ga0496118_0001729 3300048921 Bacteria 31774
296 Ga0496118_0008530 3300048921 Bacteria 10578
297 Ga0496119_0014796 3300048922 Bacteria 6071
298 Ga0496121_0003867 3300048924 Bacteria 20816
299 Ga0496121_0004297 3300048924 Bacteria 19312
300 Ga0496121_0014859 3300048924 Bacteria 8214
301 Ga0496122_0008923 3300048925 Bacteria 10668
302 Ga0496122_0034273 3300048925 Bacteria 4157
303 Ga0496122_0091061 3300048925 Bacteria 2078
304 Ga0496123_0048314 3300048926 Bacteria 2863
305 Ga0496124_0003113 3300048927 Bacteria 20580
306 Ga0496124_0134119 3300048927 Bacteria 1963
307 Ga0496125_0087396 3300048928 Bacteria 2355
308 Ga0496126_0066081 3300048929 Bacteria 3234
309 Ga0496126_0135211 3300048929 Bacteria 2127
310 Ga0496126_0158160 3300048929 Bacteria 1938
311 Ga0501306_006815 3300049127 Bacteria 1352
312 Ga0495682_0000105 3300049460 Bacteria 74328
313 Ga0501292_005106 3300049515 Bacteria 1819
314 Ga0501299_002807 3300049522 Bacteria 2455
315 Ga0501031_0000254 3300049568 Bacteria 29927
316 Ga0501031_0011187 3300049568 Bacteria 5848
317 Ga0501031_0031830 3300049568 Bacteria 3440
318 Ga0501031_0035156 3300049568 Bacteria 3268
319 Ga0501032_0006240 3300049569 Bacteria 8773
320 Ga0501032_0007946 3300049569 Bacteria 7728
321 Ga0501032_0085951 3300049569 Bacteria 2090
322 Ga0501032_0097438 3300049569 Bacteria 1949
323 Ga0501033_0000147 3300049570 Bacteria 68141
324 Ga0501033_0005918 3300049570 Bacteria 9603
325 Ga0501033_0017068 3300049570 Bacteria 5487
326 Ga0501033_0018899 3300049570 Bacteria 5208
327 Ga0501034_0004515 3300049571 Bacteria 15475
328 Ga0501034_0012819 3300049571 Bacteria 8645
329 Ga0501034_0086042 3300049571 Bacteria 3145
330 Ga0501034_0141850 3300049571 Bacteria 2381
331 Ga0501036_0011061 3300049572 Bacteria 7462
332 Ga0501036_0049139 3300049572 Bacteria 3571
333 Ga0501036_0126188 3300049572 Bacteria 2161
334 Ga0501036_0188906 3300049572 Bacteria 1733
335 Ga0501036_0204982 3300049572 Bacteria 1658
336 Ga0501037_0004182 3300049573 Bacteria 10464
337 Ga0501037_0008122 3300049573 Bacteria 7691
338 Ga0501037_0031967 3300049573 Bacteria 3885
339 Ga0501037_0063585 3300049573 Bacteria 2689
340 Ga0501037_0081216 3300049573 Bacteria 2351
341 Ga0501037_0121761 3300049573 Bacteria 1875
342 Ga0501038_0002884 3300049574 Bacteria 16039
343 Ga0501038_0013415 3300049574 Bacteria 7469
344 Ga0501038_0014198 3300049574 Bacteria 7256
345 Ga0501038_0028110 3300049574 Bacteria 4996
346 Ga0501038_0032375 3300049574 Bacteria 4613
347 Ga0501038_0052654 3300049574 Bacteria 3508
348 Ga0501039_0012121 3300049575 Bacteria 6572
349 Ga0501039_0013065 3300049575 Bacteria 6349
350 Ga0501039_0015836 3300049575 Bacteria 5774
351 Ga0501039_0022849 3300049575 Bacteria 4797
352 Ga0501039_0029331 3300049575 Bacteria 4237
353 Ga0501039_0029830 3300049575 Bacteria 4202
354 Ga0501039_0121207 3300049575 Bacteria 2049
355 Ga0501039_0134542 3300049575 Bacteria 1940
356 Ga0501040_0031122 3300049576 Unclassified 3605
357 Ga0501040_0052172 3300049576 Bacteria 2799
358 Ga0501040_0064982 3300049576 Bacteria 2512
359 Ga0501040_0066294 3300049576 Bacteria 2488
360 Ga0501041_0060586 3300049577 Bacteria 2316
361 Ga0501041_0119351 3300049577 Bacteria 1638
362 Ga0501042_0026436 3300049578 Bacteria 4078
363 Ga0501042_0036468 3300049578 Bacteria 3488
364 Ga0501043_0020482 3300049579 Bacteria 5189
365 Ga0501043_0033056 3300049579 Bacteria 4068
366 Ga0501046_0003445 3300049580 Bacteria 14513
367 Ga0501046_0011544 3300049580 Bacteria 7553
368 Ga0501046_0033653 3300049580 Bacteria 4139
369 Ga0501046_0182192 3300049580 Bacteria 1570
370 Ga0501047_0009302 3300049581 Bacteria 9279
371 Ga0501047_0012894 3300049581 Bacteria 7918
372 Ga0501048_0025351 3300049582 Bacteria 4322
373 Ga0501048_0034078 3300049582 Bacteria 3676
374 Ga0501048_0068141 3300049582 Bacteria 2514
375 Ga0501048_0207296 3300049582 Unclassified 1390
376 Ga0501067_0015702 3300049583 Bacteria 4189
377 Ga0501067_0023598 3300049583 Bacteria 3409
378 Ga0501068_0012675 3300049584 Bacteria 4784
379 Ga0501068_0035096 3300049584 Bacteria 2992
380 Ga0501069_0006698 3300049585 Bacteria 6032
381 Ga0501070_0082130 3300049586 Bacteria 2667
382 Ga0501070_0144354 3300049586 Bacteria 1965
383 Ga0501071_0014376 3300049587 Bacteria 5412
384 Ga0501071_0041321 3300049587 Bacteria 3302
385 Ga0501072_0025696 3300049588 Bacteria 4587
386 Ga0501072_0030100 3300049588 Bacteria 4243
387 Ga0501073_0008086 3300049589 Bacteria 7802
388 Ga0501073_0015938 3300049589 Bacteria 5446
389 Ga0501073_0106321 3300049589 Bacteria 1947
390 Ga0501073_0132844 3300049589 Bacteria 1725
391 Ga0501074_0011152 3300049590 Bacteria 6529
392 Ga0501074_0043589 3300049590 Bacteria 3247
393 Ga0501075_0094855 3300049591 Bacteria 2264
394 Ga0501075_0119491 3300049591 Bacteria 2005
395 Ga0501076_0023036 3300049592 Bacteria 4795
396 Ga0501076_0046158 3300049592 Bacteria 3441
397 Ga0501077_0082391 3300049593 Bacteria 2038
398 Ga0501198_000362 3300049649 Bacteria 5706
399 Ga0501202_000781 3300049652 Bacteria 4773
400 Ga0501207_000403 3300049654 Bacteria 4781
401 Ga0501216_000695 3300049660 Bacteria 4143
402 Ga0501217_000196 3300049661 Bacteria 9024
403 Ga0501217_009173 3300049661 Bacteria 2147
404 Ga0501223_000642 3300049663 Bacteria 8388
405 Ga0501224_000087 3300049664 Bacteria 9872
406 Ga0501233_000366 3300049668 Bacteria 7116
407 Ga0501235_001486 3300049669 Bacteria 5020
408 Ga0501236_007996 3300049670 Unclassified 1335
409 Ga0501243_002548 3300049675 Unclassified 2678
410 Ga0501243_006920 3300049675 Bacteria 1727
411 Ga0501259_002323 3300049688 Unclassified 3112
412 Ga0501225_0005946 3300049705 Bacteria 3572
413 Ga0501229_001771 3300049706 Unclassified 2530
414 Ga0501234_000618 3300049707 Bacteria 5464
415 Ga0501079_0009768 3300049741 Bacteria 7274
416 Ga0501079_0054608 3300049741 Bacteria 3081
417 Ga0501079_0055190 3300049741 Bacteria 3066
418 Ga0501079_0099704 3300049741 Bacteria 2251
419 Ga0501079_0169585 3300049741 Bacteria 1702
420 Ga0501080_0013377 3300049742 Bacteria 7545
421 Ga0501080_0063780 3300049742 Bacteria 3428
422 Ga0501080_0072291 3300049742 Bacteria 3209
423 Ga0501081_0012433 3300049743 Bacteria 5595
424 Ga0501081_0160323 3300049743 Unclassified 1621
425 Ga0501083_0001116 3300049744 Bacteria 17988
426 Ga0501083_0021602 3300049744 Bacteria 4470
427 Ga0501083_0074377 3300049744 Bacteria 2257
428 Ga0501283_000179 3300049779 Bacteria 8305
429 Ga0501035_0011289 3300049822 Bacteria 8277
430 Ga0501035_0064900 3300049822 Bacteria 3244
431 Ga0501035_0104174 3300049822 Bacteria 2488
432 Ga0501035_0117345 3300049822 Bacteria 2329
433 Ga0501035_0148844 3300049822 Bacteria 2032
434 Ga0501044_0006247 3300049823 Bacteria 13173
435 Ga0501044_0096339 3300049823 Bacteria 2980
436 Ga0501044_0178994 3300049823 Bacteria 2088
437 Ga0501045_0004167 3300049824 Bacteria 9991
438 Ga0501045_0072116 3300049824 Bacteria 2542
439 Ga0501045_0109976 3300049824 Unclassified 2043
440 Ga0501212_000171 3300049851 Bacteria 5516
441 Ga0501226_000297 3300049853 Bacteria 7463
442 nmdc:mga0yw44_11624_c1 3300050492 Bacteria 4555
443 nmdc:mga0yw44_152151_c1 3300050492 Bacteria 1510
444 nmdc:mga06z11_42766_c1 3300050494 Bacteria 2275
445 nmdc:mga06z11_44862_c1 3300050494 Bacteria 2232
446 nmdc:mga07m45_6637_c1 3300050496 Bacteria 5866
447 nmdc:mga07m45_928_c1 3300050496 Bacteria 12810
448 nmdc:mga05p37_131287_c1 3300050507 Bacteria 3073
449 nmdc:mga05p37_54660_c1 3300050507 Unclassified 4912
450 nmdc:mga09592_126857_c1 3300050508 Bacteria 2194
451 nmdc:mga06r32_239516_c1 3300050510 Bacteria 1802
452 nmdc:mga08y16_143666_c1 3300050511 Unclassified 2480
453 nmdc:mga08y16_176790_c1 3300050511 Bacteria 2216
454 nmdc:mga08y16_28915_c1 3300050511 Bacteria 5843
455 nmdc:mga0n895_83253_c1 3300050512 Bacteria 3190
456 nmdc:mga0sz30_1704_c1 3300050516 Bacteria 7804
457 nmdc:mga0sz30_22355_c1 3300050516 Bacteria 2566
458 Ga0495655_0008577 3300053083 Bacteria 1948
459 Ga0500658_0000578 3300053134 Bacteria 15417
460 Ga0500658_0064159 3300053134 Bacteria 1536
461 Ga0500568_0000210 3300053139 Bacteria 50927
462 Ga0500568_0000366 3300053139 Bacteria 34998
463 Ga0500616_0001017 3300053153 Bacteria 29900
464 Ga0500616_0002649 3300053153 Bacteria 14567
465 Ga0500616_0005135 3300053153 Bacteria 9005
466 Ga0500616_0006752 3300053153 Bacteria 7439
467 Ga0500622_0042881 3300053156 Bacteria 2348
468 Ga0500622_0056464 3300053156 Bacteria 2010
469 Ga0500634_0024095 3300053161 Bacteria 3310
470 Ga0500634_0077016 3300053161 Bacteria 1729
471 Ga0500636_0001753 3300053177 Bacteria 11889
472 Ga0501084_0054207 3300054114 Bacteria 3354
473 Ga0501084_0087607 3300054114 Bacteria 2614
474 Ga0587111_0011353 3300060346 Bacteria 1551
475 Ga0501082_0004421 3300060353 Bacteria 12275
476 Ga0501082_0019820 3300060353 Bacteria 5800
477 Ga0501082_0078860 3300060353 Bacteria 2840
478 Ga0530510_0015055 3300061734 Bacteria 5462
479 Ga0530510_0056470 3300061734 Bacteria 2836
480 Ga0530510_0091250 3300061734 Bacteria 2222
481 Ga0530510_0118205 3300061734 Unclassified 1945
482 2509110296 2508501122 Bacteria 6292184
483 2509377262 2509276019 Bacteria 6802256
484 2509392194 2509276021 Bacteria 7634384
485 2509445840 2509276033 Bacteria 7180565
486 2509446856 2509276033 Bacteria 7180565
487 2510133807 2510065019 Bacteria 6903379
488 2510895236 2510461076 Bacteria 8618824
489 2511133899 2510917022 Bacteria 6504556
490 2513574153 2513237084 Bacteria 7231967
491 2513576811 2513237085 Bacteria 7695351
492 2513629541 2513237093 Bacteria 7545552
493 2513708183 2513237103 Bacteria 7647401
494 2513871026 2513237138 Bacteria 7368160
495 2513910687 2513237144 Bacteria 7530820
496 2513927293 2513237146 Bacteria 7166346
497 2514020144 2513237162 Bacteria 7468464
498 2514592536 2513237351 Bacteria 6968952
499 2515112852 2515075009 Bacteria 7288508
500 2515636460 2515154113 Bacteria 7807172
501 2515640824 2515154114 Bacteria 7848616
502 2515655492 2515154116 Bacteria 7552979
503 2515739349 2515154134 Bacteria 7220242
504 2516206748 2516143018 Bacteria 6951533
505 2517036560 2516653077 Bacteria 7555578
506 2517076930 2516653085 Bacteria 7346596
507 2517095692 2517093000 Bacteria 7412387
508 2517407253 2517287029 Bacteria 6905599
509 2524457759 2524023209 Bacteria 6679728
510 2530646151 2529292951 Bacteria 6916614
511 2535518410 2534681796 Bacteria 7146037
512 2545679348 2545555834 Bacteria 8130841
513 2558862213 2558860100 Bacteria 8458965
514 2585205878 2582581294 Bacteria 6626667
515 2585231701 2582581299 Bacteria 6518058
516 2585256051 2582581304 Bacteria 5831370
517 2585276671 2582581307 Bacteria 6597605
518 2585278642 2582581308 Bacteria 7413247
519 2585325742 2582581315 Bacteria 7318924
520 2585329911 2582581316 Bacteria 7774528
521 2585404387 2582581867 Bacteria 7184437
522 2585527307 2585427526 Bacteria 7258840
523 2585536292 2585427527 Bacteria 7273426
524 2585538045 2585427528 Bacteria 6842387
525 2585554166 2585427530 Bacteria 7383882
526 2585560357 2585427531 Bacteria 6992870
527 2585824705 2585427590 Bacteria 6824633
528 2585835993 2585427593 Bacteria 7141551
529 2585901369 2585427608 Bacteria 6544331
530 2585905457 2585427609 Bacteria 6667127
531 2587979427 2585428125 Bacteria 6662905
532 2599415265 2599185170 Bacteria 7295545
533 2616293513 2615840624 Bacteria 6557588
534 2616306083 2615840626 Bacteria 7921970
535 2616553663 2615840698 Bacteria 7319877
536 2617382066 2617270742 Bacteria 6808054
537 2644193467 2643221634 Bacteria 6705461
538 2644307374 2643221655 Bacteria 7722067
539 2644331390 2643221659 Bacteria 7890716
540 2644541406 2643221698 Bacteria 7756764
541 2644613463 2643221712 Bacteria 7729434
542 2671112608 2667528174 Bacteria 6435400
543 2692319148 2690316117 Bacteria 6800650
544 2719181663 2718217882 Bacteria 6556348
545 2719386195 2718217927 Bacteria 6972593
546 2719666004 2718217997 Bacteria 6740740
547 2719732327 2718218009 Bacteria 6478651
548 2720492424 2718218199 Bacteria 6740745
549 2720613779 2718218232 Bacteria 6720332
550 2720620567 2718218233 Bacteria 6662049
551 2720631992 2718218235 Bacteria 6630699
552 2720775720 2718218269 Bacteria 6906114
553 2721147755 2718218363 Bacteria 6524337
554 2721159202 2718218365 Bacteria 6274507
555 2721164590 2718218366 Bacteria 6425255
556 2721399977 2718218423 Bacteria 6438183
557 2722840760 2721755514 Bacteria 6424414
558 2723027327 2721755556 Bacteria 6745503
559 2723560946 2721755684 Bacteria 6859907
560 2723567539 2721755685 Bacteria 6704835
561 2723845644 2721755755 Bacteria 8322773
562 2724038790 2721755809 Bacteria 6438790
563 2724045083 2721755810 Bacteria 6479005
564 2724090327 2721755819 Bacteria 6906405
565 2724104804 2721755822 Bacteria 6726041
566 2724110606 2721755823 Bacteria 6752556
567 2725952701 2724679232 Bacteria 7646494
568 2730108263 2728369352 Bacteria 6745171
569 2730164898 2728369365 Bacteria 6555560
570 2730298834 2728369397 Bacteria 6274511
571 2738743262 2738541281 Bacteria 5112672
572 2739032702 2738541333 Bacteria 7106503
573 2739310318 2738543024 Bacteria 5603683
574 2739352879 2738543032 Bacteria 5115625
575 2753463855 2751185821 Bacteria 6189929
576 2757571154 2757320392 Bacteria 3737298
577 2766065729 2765235942 Bacteria 7445910
578 2770200427 2767802442 Bacteria 5747986
579 2778174406 2775507266 Bacteria 7392367
580 2792621576 2791355091 Bacteria 6135441
581 2792627737 2791355092 Bacteria 6248105
582 2792640303 2791355094 Bacteria 7011481
583 2792746114 2791355123 Bacteria 8049106
584 2793298706 2791355256 Bacteria 6798008
585 2793314677 2791355259 Bacteria 7254731
586 2793320512 2791355260 Bacteria 6598818
587 2793330447 2791355261 Bacteria 6661293
588 2793338329 2791355262 Bacteria 6774204
589 2793339067 2791355263 Bacteria 6872478
590 2793348735 2791355264 Bacteria 6429314
591 2793351973 2791355265 Bacteria 6539969
592 2793363851 2791355266 Bacteria 7116587
593 2793370327 2791355267 Bacteria 7222458
594 2805930996 2802429605 Bacteria 6875453
595 2805937990 2802429606 Bacteria 6346811
596 2806043682 2802429633 Bacteria 7341974
597 2806064585 2802429636 Bacteria 7597525
598 2806071852 2802429637 Bacteria 7067217
599 2819551974 2818991438 Bacteria 5793701
600 2819608156 2818991448 Bacteria 6772224
601 2819639514 2818991453 Bacteria 7181617
602 2819717846 2818991467 Bacteria 5893227
603 2831433069 2831426010 Bacteria 8662725
604 2838017808 2838016132 Bacteria 6577831
605 2838028597 2838022645 Bacteria 6494267
606 2838031161 2838029111 Bacteria 6603031
607 2838039010 2838035591 Bacteria 7166484
608 2838043831 2838042994 Bacteria 6046894
609 2838051901 2838048938 Bacteria 6044578
610 2838068321 2838061910 Bacteria 6794874
611 2838070297 2838068647 Bacteria 6208656
612 2838077731 2838074704 Bacteria 6785777
613 2838664398 2838661181 Bacteria 7385261
614 2838674149 2838668709 Bacteria 6671819
615 2838681749 2838680041 Bacteria 6545511
616 2838687190 2838686498 Bacteria 7807632
617 2838696321 2838694306 Bacteria 6853137
618 2838706605 2838701080 Bacteria 6669771
619 2838710440 2838707686 Bacteria 6619912
620 2838729838 2838729681 Bacteria 7400765
621 2838743147 2838742623 Bacteria 7396178
622 2841852633 2841851746 Bacteria 7532261
623 2841869935 2841864319 Bacteria 6742987
624 2842078614 2842077413 Bacteria 6508645
625 2842114840 2842110456 Bacteria 7656360
626 2842118877 2842118031 Bacteria 7033875
627 2842151340 2842146304 Bacteria 5957337
628 2842157907 2842156927 Bacteria 6894975
629 2842167545 2842163707 Bacteria 6916235
630 2842181526 2842180545 Bacteria 6888678
631 2842198412 2842192696 Bacteria 6147454
632 2842204625 2842198810 Bacteria 6608673
633 2842205626 2842205361 Bacteria 6340321
634 2842217790 2842217011 Bacteria 7497767
635 2842230423 2842229732 Bacteria 7475766
636 2842239852 2842237096 Bacteria 6620661
637 2842244325 2842243621 Bacteria 7421798
638 2842256343 2842250916 Bacteria 6579627
639 2842257589 2842257432 Bacteria 7401195
640 2842266110 2842264693 Bacteria 6472963
641 2842271272 2842271015 Bacteria 7807131
642 2842279083 2842278818 Bacteria 6340002
643 2842285749 2842285085 Bacteria 6011953
644 2842292276 2842291075 Bacteria 7076806
645 2842300626 2842298080 Bacteria 6123127
646 2842304900 2842304105 Bacteria 7023636
647 2842315063 2842311132 Bacteria 6616990
648 2842320561 2842317721 Bacteria 6793725
649 2842346318 2842341865 Bacteria 7003929
650 2842358256 2842357229 Bacteria 6485165
651 2842369102 2842363717 Bacteria 6844742
652 2842372316 2842370503 Bacteria 7038661
653 2842378673 2842377471 Bacteria 7140707
654 2842385387 2842384541 Bacteria 7057858
655 2842401930 2842395702 Bacteria 6780583
656 2842403108 2842402390 Bacteria 6681310
657 2842409519 2842409023 Bacteria 6687331
658 2842416171 2842415677 Bacteria 6596907
659 2842423911 2842422224 Bacteria 6239196
660 2842430573 2842428310 Bacteria 6767288
661 2842437440 2842434925 Bacteria 6502746
662 2842443810 2842441272 Bacteria 6769273
663 2842454466 2842447887 Bacteria 6754142
664 2842464716 2842462802 Bacteria 6588055
665 2842472058 2842469257 Bacteria 6752936
666 2842478244 2842475841 Bacteria 6603183
667 2842482598 2842482326 Bacteria 7212537
668 2842490433 2842489311 Bacteria 6620893
669 2842496975 2842495871 Bacteria 6820686
670 2842505053 2842502639 Bacteria 6604161
671 2842509447 2842509118 Bacteria 6850950
672 2844458556 2844454524 Bacteria 7952546
673 2847422346 2847417321 Bacteria 6913799
674 2848699671 2848694841 Bacteria 9205737
675 2848998205 2848992105 Bacteria 6810864
676 2849666616 2849660919 Bacteria 8251853
677 2850085400 2850079185 Bacteria 6848280
678 2852388780 2852387548 Bacteria 8025568
679 2855875728 2855872281 Bacteria 6964271
680 2857517577 2857516855 Bacteria 7787325
681 2865005763 2865002811 Bacteria 6333767
682 2886632548 2886627955 Bacteria 7618130
683 2888580666 2888578766 Bacteria 6743310
684 2889050679 2889049205 Bacteria 7524325
685 2896391845 2896384573 Bacteria 7700774
686 2904115186 2904113452 Bacteria 7796941
687 2909045654 2909042592 Bacteria 6499737
688 2919409043 2919408235 Bacteria 6149349
689 2920765015 2920760137 Bacteria 7427611
690 2923559900 2923556063 Bacteria 6793593
691 2929201880 2929199973 Bacteria 7260745
692 2933017894 2933016740 Bacteria 6355406
693 2933570708 2933570622 Bacteria 7023390
694 2933591212 2933586486 Bacteria 7667493
695 2933601102 2933599457 Bacteria 5858799
696 2935900674 2935894831 Bacteria 6620579
697 2935902094 2935901341 Bacteria 7341747
698 2936372185 2936367885 Bacteria 7324495
699 2936381012 2936375103 Bacteria 6652732
700 2936383033 2936381700 Bacteria 7006523
701 2939670501 2939669807 Bacteria 5028511
702 2941502880 2941499720 Bacteria 7599444
703 2958065540 2958064165 Bacteria 7158582
704 2980187551 2980182181 Bacteria 9454109
705 2990266115 2990265787 Bacteria 3943888
706 2993696091 2993693658 Bacteria 4040749
707 2996896495 2996893221 Bacteria 5823108
708 3003670394 3003665799 Bacteria 7279786
709 3005413524 3005409236 Bacteria 7188837
710 3005417584 3005416602 Bacteria 7064308
711 639649056 639633055 Bacteria 7751309
712 641644567 641522639 Bacteria 7737025
713 643601583 643348564 Bacteria 8839022
714 643601816 643348564 Bacteria 8839022
715 643605169 643348564 Bacteria 8839022
716 643823730 643692032 Bacteria 6891900
717 8005280985 8005275841 Bacteria 6929066
718 8005283412 8005282627 Bacteria 6675747
719 8005293494 8005289223 Bacteria 6634003
720 8005302967 8005301065 Bacteria 6614431
721 8005312694 8005307578 Bacteria 7395396
722 8005314939 8005314921 Bacteria 7072929
723 8005380784 8005376324 Bacteria 6590079
724 8005385355 8005382845 Bacteria 6732062
725 8005396274 8005395548 Bacteria 6806915
726 8005434999 8005430974 Bacteria 6689030
727 8005463527 8005460587 Bacteria 7157962
728 8005485893 8005484373 Bacteria 6297373
729 8005500740 8005497431 Bacteria 6477605
730 8005549323 8005542996 Bacteria 7077758
731 8005557157 8005556819 Bacteria 6908598
732 8005567847 8005563573 Bacteria 7153261
733 8005573607 8005570704 Bacteria 6957481
734 8005622113 8005619151 Bacteria 7030230
735 8005632404 8005626139 Bacteria 6534237
736 8005646726 8005645114 Bacteria 6950293
737 8005661211 8005658619 Bacteria 4500593
738 8005672158 8005668836 Bacteria 6953162
739 8005684868 8005682033 Bacteria 6726518
740 8005692264 8005688590 Bacteria 6610080
741 8005699726 8005695170 Bacteria 6912330
742 8006967273 8006964411 Bacteria 8966052
743 8018133933 8018127388 Bacteria 7351159
744 8018166237 8018163183 Bacteria 7277977
745 8018181467 8018176218 Bacteria 6896178
746 8023683308 8023680758 Bacteria 7729763
747 8024483010 8024479707 Bacteria 6954785
748 8024490279 8024486573 Bacteria 6540512
749 8024503923 8024501048 Bacteria 6427847
750 8046769738 8046767195 Bacteria 7547379
751 8055910871 8055909800 Bacteria 7278581
752 8056378371 8056375014 Bacteria 7006639
753 8056386578 8056382006 Bacteria 6408074
754 8057577353 8057575449 Bacteria 7367519
755 8057877384 8057874678 Bacteria 7494653
756 8057980607 8057977335 Bacteria 5694872
757 Ga0501082_0001805
758 CNBas_1000573
759 JGI24740J21852_10001797
760 JGI25155J39150_1000006
761 JGI25156J39149_1000105
762 JGI25162J39368_1000266
763 JGI25162J39368_1000694
764 JGI25154J39366_1000055
765 JGI25154J39366_1000085
766 JGI25157J39369_1000782
767 JGI25157J39369_1001299
768 JGI25159J45721_1003157
769 JGI25151J46595_10000723
770 JGI25165J46597_1000028
771 JGI25165J46597_1000579
772 JGI25165J46597_1000786
773 JGI25165J46597_1005162
774 rootL2_10112396
775 rootH1_10013182
776 JGI25160J50197_1000053
777 JGI25160J50197_1000782
778 JGI25161J50226_1000039
779 JGI25161J50226_1004458
780 Ga0055535_1002072
781 Ga0055542_1000637
782 Ga0055526_1007484
783 Ga0055528_1000331
784 Ga0055540_1000508
785 Ga0055543_1000015
786 Ga0055543_1002085
787 Ga0065165_1000568
788 Ga0065712_10005803
789 Ga0065715_10144541
790 Ga0070670_100012940
791 Ga0070670_100088723
792 Ga0068869_100164561
793 Ga0070660_100088287
794 Ga0070668_100068317
795 Ga0070673_100004801
796 Ga0070688_100041762
797 Ga0070714_100071416
798 Ga0070700_100066774
799 Ga0070694_100168259
800 Ga0070708_100264862
801 Ga0070678_100018012
802 Ga0070707_100000311
803 Ga0070698_100141780
804 Ga0070699_100117102
805 Ga0068853_100025963
806 Ga0070696_100032609
807 Ga0070696_100162136
808 Ga0070665_100000062
809 Ga0070665_100031499
810 Ga0070665_100058339
811 Ga0068856_100035355
812 Ga0068859_100047771
813 Ga0068864_100018691
814 Ga0068858_100035682
815 Ga0068860_100091604
816 Ga0068862_100130067
817 Ga0081455_10002201
818 Ga0081538_10000940
819 Ga0081538_10007360
820 Ga0081538_10027369
821 Ga0081540_1006757
822 Ga0081540_1012046
823 Ga0081539_10001282
824 Ga0081539_10014005
825 Ga0075365_10000388
826 Ga0070712_100113269
827 Ga0075367_10001308
828 Ga0075369_10000195
829 Ga0075369_10018748
830 Ga0075366_10026651
831 Ga0097621_100000830
832 Ga0075370_10005893
833 Ga0075370_10039003
834 Ga0068871_100013903
835 Ga0075428_100005413
836 Ga0075434_100053103
837 Ga0075434_100189570
838 Ga0075429_100020373
839 Ga0097620_100047772
840 Ga0075435_100247909
841 Ga0105251_10092498
842 Ga0105244_10001313
843 Ga0105244_10050599
844 Ga0105240_10000027
845 Ga0105240_10083097
846 Ga0111539_10018085
847 Ga0111539_10052837
848 Ga0111539_10125168
849 Ga0111539_10137172
850 Ga0105247_10037197
851 Ga0105241_10030333
852 Ga0105248_10234943
853 Ga0105237_10003395
854 Ga0105238_10028931
855 Ga0105249_10084241
856 Ga0105249_10144657
857 Ga0123341_1000576
858 Ga0105239_10006404
859 Ga0105239_10010405
860 Ga0105239_10066579
861 Ga0105239_10177236
862 Ga0105239_10334535
863 Ga0157370_10036186
864 Ga0157374_10219244
865 Ga0157378_10054267
866 Ga0163162_10076836
867 Ga0157372_10381673
868 Ga0157375_10162492
869 Ga0163163_10151820
870 Ga0157380_10367686
871 Ga0157379_10048711
872 Ga0182007_10003280
873 Ga0182005_1004517
874 Ga0182005_1006088
875 Ga0214542_1023097
876 Ga0214543_1000005
877 Ga0209435_100011
878 Ga0209672_102283
879 Ga0209672_104514
880 Ga0209437_100033
881 Ga0209437_100036
882 Ga0209258_100265
883 Ga0209646_1000024
884 Ga0209026_1000009
885 Ga0209026_1000081
886 Ga0209677_100188
887 Ga0209148_1000065
888 Ga0209759_1000011
889 Ga0209759_1000117
890 Ga0209233_1000056
891 Ga0209233_1000087
892 Ga0209233_1000152
893 Ga0209233_1000271
894 Ga0209455_1001167
895 Ga0209673_1000384
896 Ga0209673_1005485
897 Ga0209673_1005540
898 Ga0209130_1000038
899 Ga0209025_1000058
900 Ga0209564_1000388
901 Ga0209564_1000458
902 Ga0209758_1001805
903 Ga0209758_1007127
904 Ga0209256_1001984
905 Ga0209256_1016697
906 Ga0207426_1000081
907 Ga0207426_1001412
908 Ga0209051_1002798
909 Ga0209257_1001598
910 Ga0207697_10045151
911 Ga0207655_1000184
912 Ga0207647_10006297
913 Ga0207643_10019727
914 Ga0207695_10000024
915 Ga0207695_10154117
916 Ga0207671_10001033
917 Ga0207693_10126913
918 Ga0207660_10125726
919 Ga0207662_10080040
920 Ga0207646_10000581
921 Ga0207646_10015623
922 Ga0207650_10001778
923 Ga0207706_10191256
924 Ga0207704_10059725
925 Ga0207691_10052459
926 Ga0207689_10246350
927 Ga0207651_10046768
928 Ga0207651_10054172
929 Ga0207677_10162928
930 Ga0207639_10196110
931 Ga0207708_10053629
932 Ga0207702_10060372
933 Ga0207648_10044647
934 Ga0207676_10068903
935 Ga0207683_10024976
936 Ga0207698_10149033
937 Ga0209371_1002612
938 Ga0207428_10023006
939 Ga0268266_10000001
940 Ga0268266_10099091
941 Ga0268266_10227133
942 Ga0268264_10078150
943 Ga0265318_10034433
944 Ga0307515_10005688
945 Ga0307515_10083019
946 Ga0268256_1002306
947 Ga0307513_10046157
948 Ga0307408_100002979
949 Ga0307408_100066548
950 Ga0307508_10031735
951 Ga0307405_10005397
952 Ga0307406_10001179
953 Ga0307406_10181632
954 Ga0307412_10006822
955 Ga0307412_10117185
956 Ga0307416_100167753
957 Ga0307414_10002528
958 Ga0307414_10143445
959 Ga0307415_100000420
960 Ga0307415_100181588
961 Ga0373937_0017691
962 Ga0373925_0142571
963 Ga0395899_0000047
964 Ga0395900_0000011
965 Ga0395898_0000058
966 Ga0439436_0009316
967 Ga0439465_0010016
968 Ga0451787_044841
969 Ga0451835_0278968
970 Ga0451847_0193794
971 Ga0451851_0998667
972 Ga0451853_1774076
973 Ga0439432_017708
974 Ga0439449_0000817
975 Ga0439449_0002007
976 Ga0451577_0000001
977 Ga0453683_0147470
978 Ga0466966_0002414
979 Ga0466966_0006828
980 Ga0466966_0114037
981 Ga0466961_0001713
982 Ga0466963_0013795
983 Ga0453684_0090396
984 Ga0453684_0106391
985 Ga0453684_0126109
986 Ga0466970_0002744
987 Ga0466970_0005938
988 Ga0466959_0001599
989 Ga0451576_0003396
990 Ga0451576_0029706
991 Ga0451576_0121220
992 Ga0466967_0273145
993 Ga0495617_007029
994 Ga0495617_024020
995 Ga0495638_0000032
996 Ga0495638_0000037
997 Ga0495638_0000163
998 Ga0495651_0018760
999 Ga0495605_0001143
1000 Ga0495605_0041683
1001 Ga0495585_0006766
1002 Ga0495585_0058989
1003 Ga0495607_0052311
1004 Ga0495607_0064827
1005 Ga0495583_0003636
1006 Ga0495583_0011102
1007 Ga0495620_0032172
1008 Ga0495631_0005088
1009 Ga0495631_0035123
1010 Ga0495631_0067618
1011 Ga0495632_0005665
1012 Ga0495632_0041211
1013 Ga0495643_0001423
1014 Ga0495643_0037042
1015 Ga0495643_0048962
1016 Ga0495643_0104562
1017 Ga0495654_0025092
1018 Ga0495609_0002759
1019 Ga0495633_0000232
1020 Ga0495633_0010450
1021 Ga0495656_0031338
1022 Ga0495668_0004661
1023 Ga0495625_0000118
1024 Ga0495625_0000326
1025 Ga0495625_0011026
1026 Ga0495625_0028356
1027 Ga0495625_0047676
1028 Ga0495661_0077909
1029 Ga0495670_0029727
1030 Ga0495589_0029632
1031 Ga0495660_0000001
1032 Ga0495660_0018736
1033 Ga0495660_0019203
1034 Ga0495660_0046569
1035 Ga0495636_0045053
1036 Ga0495674_0132445
1037 Ga0495672_0019828
1038 Ga0495687_059714
1039 Ga0495681_0000091
1040 Ga0495681_0033089
1041 Ga0495686_0002874
1042 Ga0495626_0012791
1043 Ga0496100_0044484
1044 Ga0496102_0141689
1045 Ga0496103_0021165
1046 Ga0496106_0054828
1047 Ga0496107_0057780
1048 Ga0496112_0304270
1049 Ga0496117_0033596
1050 Ga0496117_0109064
1051 Ga0496118_0001729
1052 Ga0496118_0008530
1053 Ga0496119_0014796
1054 Ga0496121_0003867
1055 Ga0496121_0004297
1056 Ga0496121_0014859
1057 Ga0496122_0008923
1058 Ga0496122_0034273
1059 Ga0496122_0091061
1060 Ga0496123_0048314
1061 Ga0496124_0003113
1062 Ga0496124_0134119
1063 Ga0496125_0087396
1064 Ga0496126_0066081
1065 Ga0496126_0135211
1066 Ga0496126_0158160
1067 Ga0501306_006815
1068 Ga0495682_0000105
1069 Ga0501292_005106
1070 Ga0501299_002807
1071 Ga0501031_0000254
1072 Ga0501031_0011187
1073 Ga0501031_0031830
1074 Ga0501031_0035156
1075 Ga0501032_0006240
1076 Ga0501032_0007946
1077 Ga0501032_0085951
1078 Ga0501032_0097438
1079 Ga0501033_0000147
1080 Ga0501033_0005918
1081 Ga0501033_0017068
1082 Ga0501033_0018899
1083 Ga0501034_0004515
1084 Ga0501034_0012819
1085 Ga0501034_0086042
1086 Ga0501034_0141850
1087 Ga0501036_0011061
1088 Ga0501036_0049139
1089 Ga0501036_0126188
1090 Ga0501036_0188906
1091 Ga0501036_0204982
1092 Ga0501037_0004182
1093 Ga0501037_0008122
1094 Ga0501037_0031967
1095 Ga0501037_0063585
1096 Ga0501037_0081216
1097 Ga0501037_0121761
1098 Ga0501038_0002884
1099 Ga0501038_0013415
1100 Ga0501038_0014198
1101 Ga0501038_0028110
1102 Ga0501038_0032375
1103 Ga0501038_0052654
1104 Ga0501039_0012121
1105 Ga0501039_0013065
1106 Ga0501039_0015836
1107 Ga0501039_0022849
1108 Ga0501039_0029331
1109 Ga0501039_0029830
1110 Ga0501039_0121207
1111 Ga0501039_0134542
1112 Ga0501040_0031122
1113 Ga0501040_0052172
1114 Ga0501040_0064982
1115 Ga0501040_0066294
1116 Ga0501041_0060586
1117 Ga0501041_0119351
1118 Ga0501042_0026436
1119 Ga0501042_0036468
1120 Ga0501043_0020482
1121 Ga0501043_0033056
1122 Ga0501046_0003445
1123 Ga0501046_0011544
1124 Ga0501046_0033653
1125 Ga0501046_0182192
1126 Ga0501047_0009302
1127 Ga0501047_0012894
1128 Ga0501048_0025351
1129 Ga0501048_0034078
1130 Ga0501048_0068141
1131 Ga0501048_0207296
1132 Ga0501067_0015702
1133 Ga0501067_0023598
1134 Ga0501068_0012675
1135 Ga0501068_0035096
1136 Ga0501069_0006698
1137 Ga0501070_0082130
1138 Ga0501070_0144354
1139 Ga0501071_0014376
1140 Ga0501071_0041321
1141 Ga0501072_0025696
1142 Ga0501072_0030100
1143 Ga0501073_0008086
1144 Ga0501073_0015938
1145 Ga0501073_0106321
1146 Ga0501073_0132844
1147 Ga0501074_0011152
1148 Ga0501074_0043589
1149 Ga0501075_0094855
1150 Ga0501075_0119491
1151 Ga0501076_0023036
1152 Ga0501076_0046158
1153 Ga0501077_0082391
1154 Ga0501198_000362
1155 Ga0501202_000781
1156 Ga0501207_000403
1157 Ga0501216_000695
1158 Ga0501217_000196
1159 Ga0501217_009173
1160 Ga0501223_000642
1161 Ga0501224_000087
1162 Ga0501233_000366
1163 Ga0501235_001486
1164 Ga0501236_007996
1165 Ga0501243_002548
1166 Ga0501243_006920
1167 Ga0501259_002323
1168 Ga0501225_0005946
1169 Ga0501229_001771
1170 Ga0501234_000618
1171 Ga0501079_0009768
1172 Ga0501079_0054608
1173 Ga0501079_0055190
1174 Ga0501079_0099704
1175 Ga0501079_0169585
1176 Ga0501080_0013377
1177 Ga0501080_0063780
1178 Ga0501080_0072291
1179 Ga0501081_0012433
1180 Ga0501081_0160323
1181 Ga0501083_0001116
1182 Ga0501083_0021602
1183 Ga0501083_0074377
1184 Ga0501283_000179
1185 Ga0501035_0011289
1186 Ga0501035_0064900
1187 Ga0501035_0104174
1188 Ga0501035_0117345
1189 Ga0501035_0148844
1190 Ga0501044_0006247
1191 Ga0501044_0096339
1192 Ga0501044_0178994
1193 Ga0501045_0004167
1194 Ga0501045_0072116
1195 Ga0501045_0109976
1196 Ga0501212_000171
1197 Ga0501226_000297
1198 nmdc:mga0yw44_11624_c1
1199 nmdc:mga0yw44_152151_c1
1200 nmdc:mga06z11_42766_c1
1201 nmdc:mga06z11_44862_c1
1202 nmdc:mga07m45_6637_c1
1203 nmdc:mga07m45_928_c1
1204 nmdc:mga05p37_131287_c1
1205 nmdc:mga05p37_54660_c1
1206 nmdc:mga09592_126857_c1
1207 nmdc:mga06r32_239516_c1
1208 nmdc:mga08y16_143666_c1
1209 nmdc:mga08y16_176790_c1
1210 nmdc:mga08y16_28915_c1
1211 nmdc:mga0n895_83253_c1
1212 nmdc:mga0sz30_1704_c1
1213 nmdc:mga0sz30_22355_c1
1214 Ga0495655_0008577
1215 Ga0500658_0000578
1216 Ga0500658_0064159
1217 Ga0500568_0000210
1218 Ga0500568_0000366
1219 Ga0500616_0001017
1220 Ga0500616_0002649
1221 Ga0500616_0005135
1222 Ga0500616_0006752
1223 Ga0500622_0042881
1224 Ga0500622_0056464
1225 Ga0500634_0024095
1226 Ga0500634_0077016
1227 Ga0500636_0001753
1228 Ga0501084_0054207
1229 Ga0501084_0087607
1230 Ga0587111_0011353
1231 Ga0501082_0004421
1232 Ga0501082_0019820
1233 Ga0501082_0078860
1234 Ga0530510_0015055
1235 Ga0530510_0056470
1236 Ga0530510_0091250
1237 Ga0530510_0118205
1238 2509110296
1239 2509377262
1240 2509392194
1241 2509445840
1242 2509446856
1243 2510133807
1244 2510895236
1245 2511133899
1246 2513574153
1247 2513576811
1248 2513629541
1249 2513708183
1250 2513871026
1251 2513910687
1252 2513927293
1253 2514020144
1254 2514592536
1255 2515112852
1256 2515636460
1257 2515640824
1258 2515655492
1259 2515739349
1260 2516206748
1261 2517036560
1262 2517076930
1263 2517095692
1264 2517407253
1265 2524457759
1266 2530646151
1267 2535518410
1268 2545679348
1269 2558862213
1270 2585205878
1271 2585231701
1272 2585256051
1273 2585276671
1274 2585278642
1275 2585325742
1276 2585329911
1277 2585404387
1278 2585527307
1279 2585536292
1280 2585538045
1281 2585554166
1282 2585560357
1283 2585824705
1284 2585835993
1285 2585901369
1286 2585905457
1287 2587979427
1288 2599415265
1289 2616293513
1290 2616306083
1291 2616553663
1292 2617382066
1293 2644193467
1294 2644307374
1295 2644331390
1296 2644541406
1297 2644613463
1298 2671112608
1299 2692319148
1300 2719181663
1301 2719386195
1302 2719666004
1303 2719732327
1304 2720492424
1305 2720613779
1306 2720620567
1307 2720631992
1308 2720775720
1309 2721147755
1310 2721159202
1311 2721164590
1312 2721399977
1313 2722840760
1314 2723027327
1315 2723560946
1316 2723567539
1317 2723845644
1318 2724038790
1319 2724045083
1320 2724090327
1321 2724104804
1322 2724110606
1323 2725952701
1324 2730108263
1325 2730164898
1326 2730298834
1327 2738743262
1328 2739032702
1329 2739310318
1330 2739352879
1331 2753463855
1332 2757571154
1333 2766065729
1334 2770200427
1335 2778174406
1336 2792621576
1337 2792627737
1338 2792640303
1339 2792746114
1340 2793298706
1341 2793314677
1342 2793320512
1343 2793330447
1344 2793338329
1345 2793339067
1346 2793348735
1347 2793351973
1348 2793363851
1349 2793370327
1350 2805930996
1351 2805937990
1352 2806043682
1353 2806064585
1354 2806071852
1355 2819551974
1356 2819608156
1357 2819639514
1358 2819717846
1359 2831433069
1360 2838017808
1361 2838028597
1362 2838031161
1363 2838039010
1364 2838043831
1365 2838051901
1366 2838068321
1367 2838070297
1368 2838077731
1369 2838664398
1370 2838674149
1371 2838681749
1372 2838687190
1373 2838696321
1374 2838706605
1375 2838710440
1376 2838729838
1377 2838743147
1378 2841852633
1379 2841869935
1380 2842078614
1381 2842114840
1382 2842118877
1383 2842151340
1384 2842157907
1385 2842167545
1386 2842181526
1387 2842198412
1388 2842204625
1389 2842205626
1390 2842217790
1391 2842230423
1392 2842239852
1393 2842244325
1394 2842256343
1395 2842257589
1396 2842266110
1397 2842271272
1398 2842279083
1399 2842285749
1400 2842292276
1401 2842300626
1402 2842304900
1403 2842315063
1404 2842320561
1405 2842346318
1406 2842358256
1407 2842369102
1408 2842372316
1409 2842378673
1410 2842385387
1411 2842401930
1412 2842403108
1413 2842409519
1414 2842416171
1415 2842423911
1416 2842430573
1417 2842437440
1418 2842443810
1419 2842454466
1420 2842464716
1421 2842472058
1422 2842478244
1423 2842482598
1424 2842490433
1425 2842496975
1426 2842505053
1427 2842509447
1428 2844458556
1429 2847422346
1430 2848699671
1431 2848998205
1432 2849666616
1433 2850085400
1434 2852388780
1435 2855875728
1436 2857517577
1437 2865005763
1438 2886632548
1439 2888580666
1440 2889050679
1441 2896391845
1442 2904115186
1443 2909045654
1444 2919409043
1445 2920765015
1446 2923559900
1447 2929201880
1448 2933017894
1449 2933570708
1450 2933591212
1451 2933601102
1452 2935900674
1453 2935902094
1454 2936372185
1455 2936381012
1456 2936383033
1457 2939670501
1458 2941502880
1459 2958065540
1460 2980187551
1461 2990266115
1462 2993696091
1463 2996896495
1464 3003670394
1465 3005413524
1466 3005417584
1467 639649056
1468 641644567
1469 643601583
1470 643601816
1471 643605169
1472 643823730
1473 8005280985
1474 8005283412
1475 8005293494
1476 8005302967
1477 8005312694
1478 8005314939
1479 8005380784
1480 8005385355
1481 8005396274
1482 8005434999
1483 8005463527
1484 8005485893
1485 8005500740
1486 8005549323
1487 8005557157
1488 8005567847
1489 8005573607
1490 8005622113
1491 8005632404
1492 8005646726
1493 8005661211
1494 8005672158
1495 8005684868
1496 8005692264
1497 8005699726
1498 8006967273
1499 8018133933
1500 8018166237
1501 8018181467
1502 8023683308
1503 8024483010
1504 8024490279
1505 8024503923
1506 8046769738
1507 8055910871
1508 8056378371
1509 8056386578
1510 8057577353
1511 8057877384
1512 8057980607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01595

CNNM

Cyclin M transmembrane N-terminal domain

60

256

0.97

PF03471

CorC_HlyC

Transporter associated domain

404

484

0.94

PF00571

CBS

CBS domain

339

391

0.86

Map