F479319

General Info

Members Datasets Scaffolds Average Seq Length
755 374 1510 188

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_5364_c1|nmdc:mga0k408_5364_c1_5505_6152
Length 215
Sequence MAVEDSAQGRGELQAAERHLRERNVMTLFTDRRPALSGSKTATYRTEEAKASQEFRKAYESKSNVVLAEDMPWEHCADGLIKHLVHEKLNTREMCVEAYMQFLKPGEKSGVHRHMWEEIIFVVEGSGYDLHWDLKWDCLEAFQWEWAAEPKAYSWKRGDYIYIPPFTNHQHVAGDHEDCRLIVMSNRIVKEMGFDWFDQVANAPSFDALKPDGGR

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
242 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
243 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
244 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
374 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.17
Nodule 0
Rhizoplane 7.28
Rhizosphere 86.62
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_5364_c1 3300050493 Bacteria 6814
2 CNAas_1002558 3300000532 Unclassified 1282
3 JGI24752J21851_1005544 3300001976 Bacteria 1646
4 JGI24746J21847_1024544 3300001977 Bacteria 836
5 JGI24737J22298_10014202 3300001990 Bacteria 2586
6 JGI24743J22301_10012592 3300001991 Bacteria 1541
7 JGI24745J21846_1002116 3300002073 Bacteria 1995
8 JGI24748J21848_1001451 3300002074 Bacteria 2611
9 JGI24744J21845_10007412 3300002077 Bacteria 2267
10 JGI24742J22300_10003995 3300002244 Bacteria 2406
11 JGI25153J46596_10001233 3300003215 Bacteria 15427
12 JGI25405J52794_10002281 3300003911 Bacteria 3288
13 JGI25405J52794_10013830 3300003911 Bacteria 1570
14 Ga0058859_11600099 3300004798 Bacteria 609
15 Ga0065707_10244512 3300005295 Bacteria 1145
16 Ga0070676_10465640 3300005328 Unclassified 891
17 Ga0070683_100288879 3300005329 Bacteria 1560
18 Ga0070683_100362491 3300005329 Bacteria 1380
19 Ga0070690_100208031 3300005330 Bacteria 1364
20 Ga0070670_101028424 3300005331 Bacteria 750
21 Ga0070677_10013405 3300005333 Bacteria 2866
22 Ga0070680_100003050 3300005336 Bacteria 12433
23 Ga0070680_100029915 3300005336 Bacteria 4372
24 Ga0070680_100579024 3300005336 Bacteria 963
25 Ga0070680_100682271 3300005336 Bacteria 884
26 Ga0070680_100795673 3300005336 Unclassified 815
27 Ga0070682_100179233 3300005337 Bacteria 1478
28 Ga0070660_100072439 3300005339 Bacteria 2693
29 Ga0070660_100516443 3300005339 Bacteria 994
30 Ga0070689_100060345 3300005340 Bacteria 2949
31 Ga0070689_100126007 3300005340 Bacteria 2049
32 Ga0070691_10075046 3300005341 Bacteria 1646
33 Ga0070687_100030223 3300005343 Bacteria 2647
34 Ga0070661_100084746 3300005344 Bacteria 2341
35 Ga0070668_100371367 3300005347 Bacteria 1215
36 Ga0070668_100794112 3300005347 Bacteria 841
37 Ga0070669_100039793 3300005353 Bacteria 3416
38 Ga0070669_100533171 3300005353 Bacteria 977
39 Ga0070675_100015827 3300005354 Bacteria 5972
40 Ga0070675_100299040 3300005354 Bacteria 1418
41 Ga0070671_100031065 3300005355 Bacteria 4410
42 Ga0070674_100018047 3300005356 Bacteria 4452
43 Ga0070674_100057655 3300005356 Bacteria 2697
44 Ga0070674_100529708 3300005356 Bacteria 985
45 Ga0070673_100039138 3300005364 Bacteria 3626
46 Ga0070673_100348605 3300005364 Bacteria 1313
47 Ga0070688_100743596 3300005365 Bacteria 763
48 Ga0070659_100137348 3300005366 Bacteria 1988
49 Ga0070659_100350646 3300005366 Bacteria 1238
50 Ga0070667_100068329 3300005367 Bacteria 3024
51 Ga0070667_100354042 3300005367 Bacteria 1330
52 Ga0070709_10014966 3300005434 Bacteria 4403
53 Ga0070714_100017315 3300005435 Bacteria 5836
54 Ga0070714_100295340 3300005435 Bacteria 1509
55 Ga0070714_100447830 3300005435 Unclassified 1226
56 Ga0070713_100084654 3300005436 Bacteria 2714
57 Ga0070713_100223078 3300005436 Bacteria 1710
58 Ga0070713_100623785 3300005436 Bacteria 1025
59 Ga0070713_100738014 3300005436 Bacteria 941
60 Ga0070710_10007889 3300005437 Bacteria 5171
61 Ga0070710_10149057 3300005437 Unclassified 1441
62 Ga0070710_10474480 3300005437 Bacteria 852
63 Ga0070701_10263875 3300005438 Bacteria 1045
64 Ga0070705_100228185 3300005440 Bacteria 1294
65 Ga0070705_100528861 3300005440 Unclassified 900
66 Ga0070700_100032327 3300005441 Bacteria 3143
67 Ga0070694_100317234 3300005444 Bacteria 1199
68 Ga0070708_100008656 3300005445 Bacteria 8177
69 Ga0070708_100802036 3300005445 Unclassified 885
70 Ga0070663_100497846 3300005455 Bacteria 1011
71 Ga0070678_100074505 3300005456 Bacteria 2551
72 Ga0070678_100186131 3300005456 Bacteria 1704
73 Ga0070662_100055666 3300005457 Bacteria 2870
74 Ga0070662_100358114 3300005457 Bacteria 1197
75 Ga0070681_10001234 3300005458 Bacteria 22246
76 Ga0070681_10074036 3300005458 Bacteria 3367
77 Ga0070681_10083414 3300005458 Bacteria 3149
78 Ga0070681_10907166 3300005458 Unclassified 800
79 Ga0070681_11113558 3300005458 Bacteria 711
80 Ga0068867_100082820 3300005459 Bacteria 2421
81 Ga0068867_100126291 3300005459 Bacteria 1983
82 Ga0070685_10005812 3300005466 Bacteria 6272
83 Ga0070698_100232313 3300005471 Bacteria 1778
84 Ga0070699_100009225 3300005518 Bacteria 8552
85 Ga0070699_100540285 3300005518 Unclassified 1060
86 Ga0070679_100057516 3300005530 Bacteria 3876
87 Ga0070679_100185123 3300005530 Bacteria 2054
88 Ga0070679_100580576 3300005530 Bacteria 1064
89 Ga0070679_100792793 3300005530 Unclassified 891
90 Ga0070697_100257455 3300005536 Bacteria 1493
91 Ga0068853_101017705 3300005539 Bacteria 798
92 Ga0070672_100078551 3300005543 Bacteria 2640
93 Ga0070672_100555876 3300005543 Bacteria 997
94 Ga0070686_100106450 3300005544 Unclassified 1903
95 Ga0070686_100608710 3300005544 Bacteria 862
96 Ga0070686_100919550 3300005544 Bacteria 713
97 Ga0070696_100060120 3300005546 Bacteria 2657
98 Ga0070696_100629110 3300005546 Bacteria 868
99 Ga0070693_100598416 3300005547 Bacteria 796
100 Ga0070704_100090055 3300005549 Bacteria 2284
101 Ga0070704_100206569 3300005549 Bacteria 1589
102 Ga0070704_100401965 3300005549 Bacteria 1169
103 Ga0068855_100708331 3300005563 Unclassified 1077
104 Ga0068855_101035277 3300005563 Bacteria 861
105 Ga0068855_101645548 3300005563 Bacteria 656
106 Ga0070664_100231757 3300005564 Bacteria 1655
107 Ga0068857_100134268 3300005577 Bacteria 2234
108 Ga0068857_100228970 3300005577 Bacteria 1699
109 Ga0068854_101172311 3300005578 Unclassified 687
110 Ga0068856_100481220 3300005614 Bacteria 1262
111 Ga0070702_100525164 3300005615 Bacteria 874
112 Ga0068859_100589771 3300005617 Bacteria 1205
113 Ga0068864_100008546 3300005618 Bacteria 8451
114 Ga0068864_100819788 3300005618 Bacteria 915
115 Ga0068866_10177447 3300005718 Bacteria 1255
116 Ga0068866_10325389 3300005718 Bacteria 968
117 Ga0068861_100216686 3300005719 Bacteria 1615
118 Ga0068861_100457098 3300005719 Bacteria 1145
119 Ga0068851_10036255 3300005834 Bacteria 2469
120 Ga0068870_10015098 3300005840 Bacteria 3658
121 Ga0068870_10022327 3300005840 Bacteria 3109
122 Ga0068863_100011842 3300005841 Bacteria 8430
123 Ga0068858_100079955 3300005842 Bacteria 3037
124 Ga0068858_100966923 3300005842 Bacteria 834
125 Ga0068860_100024092 3300005843 Bacteria 5883
126 Ga0068860_100908125 3300005843 Bacteria 897
127 Ga0068862_100853467 3300005844 Bacteria 893
128 Ga0081455_10002985 3300005937 Bacteria 19740
129 Ga0081455_10004868 3300005937 Bacteria 14892
130 Ga0081455_10017262 3300005937 Bacteria 6927
131 Ga0081455_10172189 3300005937 Bacteria 1648
132 Ga0081455_10236455 3300005937 Bacteria 1345
133 Ga0081455_10495459 3300005937 Bacteria 822
134 Ga0081538_10002885 3300005981 Bacteria 16416
135 Ga0081538_10021663 3300005981 Bacteria 4680
136 Ga0081538_10027802 3300005981 Bacteria 3908
137 Ga0081540_1006751 3300005983 Bacteria 8298
138 Ga0081540_1007409 3300005983 Bacteria 7825
139 Ga0081539_10164932 3300005985 Bacteria 1053
140 Ga0070717_10010855 3300006028 Bacteria 6894
141 Ga0070717_10249858 3300006028 Bacteria 1566
142 Ga0070717_10681562 3300006028 Bacteria 934
143 Ga0075365_10168292 3300006038 Bacteria 1529
144 Ga0075365_10217227 3300006038 Bacteria 1341
145 Ga0075365_10234909 3300006038 Bacteria 1287
146 Ga0075365_10383667 3300006038 Bacteria 991
147 Ga0075365_10533045 3300006038 Bacteria 830
148 Ga0075368_10146164 3300006042 Bacteria 986
149 Ga0075364_10124651 3300006051 Bacteria 1726
150 Ga0070715_10045671 3300006163 Bacteria 1858
151 Ga0070716_100147136 3300006173 Bacteria 1510
152 Ga0070716_100452011 3300006173 Bacteria 937
153 Ga0070712_100003552 3300006175 Bacteria 9600
154 Ga0070712_100070857 3300006175 Bacteria 2492
155 Ga0070712_100133322 3300006175 Bacteria 1886
156 Ga0070712_100164421 3300006175 Bacteria 1716
157 Ga0070712_100410260 3300006175 Unclassified 1121
158 Ga0070712_100464572 3300006175 Bacteria 1056
159 Ga0075362_10081872 3300006177 Bacteria 1489
160 Ga0075362_10113670 3300006177 Bacteria 1277
161 Ga0075362_10159510 3300006177 Bacteria 1085
162 Ga0075367_10120219 3300006178 Bacteria 1618
163 Ga0075367_10315084 3300006178 Bacteria 985
164 Ga0075369_10019703 3300006186 Bacteria 2757
165 Ga0075366_10006969 3300006195 Bacteria 6223
166 Ga0075366_10048872 3300006195 Bacteria 2509
167 Ga0097621_100045453 3300006237 Bacteria 3547
168 Ga0075370_10248378 3300006353 Bacteria 1054
169 Ga0068871_100194441 3300006358 Bacteria 1749
170 Ga0068871_100267538 3300006358 Bacteria 1493
171 Ga0075428_100093557 3300006844 Bacteria 3277
172 Ga0075428_100116053 3300006844 Bacteria 2916
173 Ga0075428_100159264 3300006844 Bacteria 2450
174 Ga0075428_100379766 3300006844 Bacteria 1515
175 Ga0075428_100455800 3300006844 Bacteria 1370
176 Ga0075428_100469238 3300006844 Bacteria 1347
177 Ga0075428_100723707 3300006844 Bacteria 1060
178 Ga0075428_100944455 3300006844 Unclassified 914
179 Ga0075430_100015997 3300006846 Bacteria 6389
180 Ga0075430_100065552 3300006846 Bacteria 3051
181 Ga0075430_100111356 3300006846 Bacteria 2282
182 Ga0075430_100419480 3300006846 Bacteria 1104
183 Ga0075431_100025791 3300006847 Bacteria 6025
184 Ga0075431_100032433 3300006847 Bacteria 5382
185 Ga0075431_100058769 3300006847 Bacteria 3968
186 Ga0075431_100115142 3300006847 Bacteria 2775
187 Ga0075431_100211129 3300006847 Bacteria 1983
188 Ga0075431_100273655 3300006847 Bacteria 1711
189 Ga0075433_10109417 3300006852 Bacteria 2452
190 Ga0075433_10652131 3300006852 Bacteria 923
191 Ga0075433_11089636 3300006852 Bacteria 695
192 Ga0075434_100023136 3300006871 Bacteria 6052
193 Ga0075434_100190431 3300006871 Bacteria 2071
194 Ga0075434_100591464 3300006871 Bacteria 1129
195 Ga0075434_100662851 3300006871 Bacteria 1061
196 Ga0075434_100706371 3300006871 Bacteria 1026
197 Ga0075434_100711423 3300006871 Bacteria 1022
198 Ga0075434_100772049 3300006871 Bacteria 978
199 Ga0075434_100843858 3300006871 Unclassified 932
200 Ga0075429_100069541 3300006880 Bacteria 3065
201 Ga0075429_100114883 3300006880 Bacteria 2353
202 Ga0075429_100388181 3300006880 Bacteria 1222
203 Ga0075429_101097208 3300006880 Unclassified 695
204 Ga0068865_100222404 3300006881 Bacteria 1476
205 Ga0075436_100171471 3300006914 Bacteria 1532
206 Ga0075436_100427116 3300006914 Bacteria 963
207 Ga0097620_100589821 3300006931 Bacteria 1205
208 Ga0075435_100055395 3300007076 Bacteria 3202
209 Ga0075435_100109128 3300007076 Bacteria 2300
210 Ga0075435_100397851 3300007076 Bacteria 1184
211 Ga0099794_10116596 3300007265 Bacteria 1341
212 Ga0099794_10206689 3300007265 Bacteria 1006
213 Ga0099795_10093754 3300007788 Unclassified 1168
214 Ga0099795_10208302 3300007788 Bacteria 827
215 Ga0099795_10397271 3300007788 Unclassified 626
216 Ga0105240_10060081 3300009093 Bacteria 4740
217 Ga0111539_10119006 3300009094 Bacteria 3095
218 Ga0111539_10393954 3300009094 Bacteria 1613
219 Ga0111539_10550379 3300009094 Bacteria 1344
220 Ga0111539_11394574 3300009094 Bacteria 813
221 Ga0111539_11466149 3300009094 Unclassified 791
222 Ga0105245_10027775 3300009098 Bacteria 4986
223 Ga0105247_10030343 3300009101 Bacteria 3276
224 Ga0105247_10382255 3300009101 Unclassified 998
225 Ga0105247_10903388 3300009101 Bacteria 682
226 Ga0114129_10005829 3300009147 Bacteria 17453
227 Ga0114129_10012350 3300009147 Bacteria 12157
228 Ga0114129_10044692 3300009147 Bacteria 6231
229 Ga0114129_10476155 3300009147 Bacteria 1634
230 Ga0114129_10504830 3300009147 Bacteria 1579
231 Ga0114129_10777477 3300009147 Bacteria 1223
232 Ga0114129_10817930 3300009147 Bacteria 1187
233 Ga0114129_11186012 3300009147 Bacteria 952
234 Ga0105243_10125522 3300009148 Bacteria 2170
235 Ga0105243_10288413 3300009148 Bacteria 1482
236 Ga0105243_10439464 3300009148 Bacteria 1221
237 Ga0105243_11690823 3300009148 Bacteria 662
238 Ga0105242_10782957 3300009176 Bacteria 942
239 Ga0105242_10884909 3300009176 Unclassified 892
240 Ga0105248_10075856 3300009177 Bacteria 3779
241 Ga0105248_10135953 3300009177 Bacteria 2773
242 Ga0105248_10233209 3300009177 Bacteria 2072
243 Ga0105248_12012385 3300009177 Bacteria 656
244 Ga0105237_10202122 3300009545 Bacteria 1987
245 Ga0105237_10257104 3300009545 Bacteria 1749
246 Ga0105237_11136812 3300009545 Bacteria 788
247 Ga0105238_10141142 3300009551 Bacteria 2386
248 Ga0105238_10332282 3300009551 Bacteria 1507
249 Ga0105238_10942472 3300009551 Unclassified 883
250 Ga0105249_10070237 3300009553 Bacteria 3232
251 Ga0105249_10196738 3300009553 Bacteria 1970
252 Ga0099796_10025477 3300010159 Bacteria 1868
253 Ga0105239_11969542 3300010375 Bacteria 678
254 Ga0105246_10373633 3300011119 Bacteria 1176
255 Ga0105246_10545854 3300011119 Bacteria 992
256 Ga0157370_10100690 3300013104 Bacteria 2707
257 Ga0157369_10007596 3300013105 Bacteria 12475
258 Ga0157374_10176663 3300013296 Bacteria 2084
259 Ga0157374_11178869 3300013296 Bacteria 787
260 Ga0157378_10132348 3300013297 Bacteria 2310
261 Ga0157378_10800288 3300013297 Bacteria 968
262 Ga0157378_11365673 3300013297 Bacteria 751
263 Ga0163162_10798947 3300013306 Bacteria 1061
264 Ga0157372_10248754 3300013307 Bacteria 2063
265 Ga0157372_10281396 3300013307 Bacteria 1934
266 Ga0157372_11225842 3300013307 Bacteria 867
267 Ga0157375_10186933 3300013308 Bacteria 2225
268 Ga0157375_10367650 3300013308 Bacteria 1604
269 Ga0157375_12181891 3300013308 Bacteria 660
270 Ga0157380_10038583 3300014326 Bacteria 3710
271 Ga0157380_10339021 3300014326 Bacteria 1401
272 Ga0157380_10608230 3300014326 Bacteria 1083
273 Ga0157380_10623793 3300014326 Bacteria 1071
274 Ga0182008_10137863 3300014497 Bacteria 1219
275 Ga0157377_10217983 3300014745 Bacteria 1220
276 Ga0157379_10868502 3300014968 Bacteria 854
277 Ga0157376_10176260 3300014969 Bacteria 1950
278 Ga0157376_10499562 3300014969 Bacteria 1195
279 Ga0163161_10043929 3300017792 Bacteria 3218
280 Ga0163161_10416077 3300017792 Bacteria 1081
281 Ga0184598_132508 3300019182 Bacteria 783
282 Ga0213873_10186248 3300021358 Bacteria 639
283 Ga0213872_10039119 3300021361 Bacteria 2165
284 Ga0224712_10026029 3300022467 Unclassified 2063
285 Ga0209233_1005483 3300025261 Unclassified 4203
286 Ga0209758_1000351 3300025297 Bacteria 83626
287 Ga0207426_1041079 3300025302 Bacteria 1436
288 Ga0207697_10045924 3300025315 Bacteria 1798
289 Ga0207697_10079214 3300025315 Bacteria 1383
290 Ga0207697_10131828 3300025315 Bacteria 1080
291 Ga0207653_10013516 3300025885 Bacteria 2556
292 Ga0207682_10057558 3300025893 Bacteria 1621
293 Ga0207682_10085280 3300025893 Bacteria 1360
294 Ga0207692_10020922 3300025898 Bacteria 2985
295 Ga0207642_10026722 3300025899 Bacteria 2353
296 Ga0207710_10023852 3300025900 Bacteria 2631
297 Ga0207710_10181187 3300025900 Bacteria 1034
298 Ga0207688_10005066 3300025901 Bacteria 7167
299 Ga0207688_10031804 3300025901 Bacteria 2914
300 Ga0207688_10231901 3300025901 Bacteria 1114
301 Ga0207680_10054601 3300025903 Bacteria 2404
302 Ga0207647_10019169 3300025904 Bacteria 4605
303 Ga0207685_10007357 3300025905 Bacteria 3064
304 Ga0207699_10021859 3300025906 Bacteria 3457
305 Ga0207699_10396122 3300025906 Bacteria 983
306 Ga0207645_10013461 3300025907 Bacteria 5511
307 Ga0207645_10032037 3300025907 Bacteria 3380
308 Ga0207643_10002909 3300025908 Bacteria 9249
309 Ga0207643_10171047 3300025908 Bacteria 1311
310 Ga0207705_10856872 3300025909 Bacteria 704
311 Ga0207684_10030988 3300025910 Bacteria 4551
312 Ga0207707_10001155 3300025912 Bacteria 25051
313 Ga0207707_10053017 3300025912 Bacteria 3530
314 Ga0207707_10272934 3300025912 Bacteria 1465
315 Ga0207693_10003651 3300025915 Bacteria 13135
316 Ga0207693_10013085 3300025915 Bacteria 6694
317 Ga0207693_10020070 3300025915 Bacteria 5316
318 Ga0207693_10082804 3300025915 Bacteria 2513
319 Ga0207693_10085436 3300025915 Bacteria 2472
320 Ga0207693_10463643 3300025915 Bacteria 990
321 Ga0207663_10017134 3300025916 Bacteria 4030
322 Ga0207663_10059154 3300025916 Unclassified 2423
323 Ga0207663_10256321 3300025916 Bacteria 1290
324 Ga0207660_10002334 3300025917 Bacteria 12492
325 Ga0207660_10615610 3300025917 Bacteria 885
326 Ga0207660_10640022 3300025917 Bacteria 867
327 Ga0207660_10778366 3300025917 Bacteria 781
328 Ga0207662_10052026 3300025918 Bacteria 2437
329 Ga0207662_10074950 3300025918 Bacteria 2055
330 Ga0207662_10443347 3300025918 Bacteria 887
331 Ga0207657_10076419 3300025919 Bacteria 2825
332 Ga0207657_10084811 3300025919 Bacteria 2654
333 Ga0207652_10020199 3300025921 Bacteria 5484
334 Ga0207652_10893138 3300025921 Bacteria 785
335 Ga0207646_10022518 3300025922 Bacteria 5804
336 Ga0207681_10151222 3300025923 Bacteria 1740
337 Ga0207681_10843717 3300025923 Bacteria 766
338 Ga0207694_10187439 3300025924 Bacteria 1679
339 Ga0207694_10455006 3300025924 Bacteria 1069
340 Ga0207659_10066893 3300025926 Bacteria 2609
341 Ga0207659_10152158 3300025926 Bacteria 1808
342 Ga0207687_10140966 3300025927 Bacteria 1829
343 Ga0207700_10007334 3300025928 Bacteria 6731
344 Ga0207700_10015358 3300025928 Bacteria 5049
345 Ga0207700_10145380 3300025928 Bacteria 1953
346 Ga0207700_10732694 3300025928 Bacteria 883
347 Ga0207664_10038090 3300025929 Bacteria 3726
348 Ga0207664_10159361 3300025929 Bacteria 1924
349 Ga0207664_10402249 3300025929 Unclassified 1218
350 Ga0207664_11075067 3300025929 Bacteria 720
351 Ga0207644_10156453 3300025931 Bacteria 1768
352 Ga0207690_10006288 3300025932 Bacteria 7035
353 Ga0207690_10077789 3300025932 Bacteria 2307
354 Ga0207690_10368645 3300025932 Bacteria 1139
355 Ga0207706_10066395 3300025933 Bacteria 3175
356 Ga0207706_10304657 3300025933 Bacteria 1388
357 Ga0207709_10024780 3300025935 Bacteria 3430
358 Ga0207709_10738658 3300025935 Bacteria 790
359 Ga0207670_10011612 3300025936 Bacteria 5121
360 Ga0207670_10091975 3300025936 Bacteria 2146
361 Ga0207670_10358515 3300025936 Bacteria 1156
362 Ga0207669_10073516 3300025937 Bacteria 2157
363 Ga0207669_10111333 3300025937 Bacteria 1835
364 Ga0207704_10104735 3300025938 Bacteria 1896
365 Ga0207665_10002092 3300025939 Bacteria 13481
366 Ga0207711_10064444 3300025941 Bacteria 3165
367 Ga0207711_10106004 3300025941 Bacteria 2493
368 Ga0207689_10149734 3300025942 Unclassified 1924
369 Ga0207661_10114460 3300025944 Bacteria 2287
370 Ga0207679_10272901 3300025945 Bacteria 1447
371 Ga0207667_10510254 3300025949 Unclassified 1219
372 Ga0207667_11207145 3300025949 Unclassified 736
373 Ga0207651_10529300 3300025960 Bacteria 1022
374 Ga0207651_11188937 3300025960 Unclassified 684
375 Ga0207712_10086977 3300025961 Bacteria 2291
376 Ga0207668_10163643 3300025972 Bacteria 1736
377 Ga0207640_10168483 3300025981 Bacteria 1629
378 Ga0207658_11031338 3300025986 Bacteria 751
379 Ga0207677_10342132 3300026023 Bacteria 1250
380 Ga0207678_10129020 3300026067 Bacteria 2156
381 Ga0207678_10340091 3300026067 Bacteria 1293
382 Ga0207708_10016435 3300026075 Bacteria 5565
383 Ga0207708_10120360 3300026075 Bacteria 2045
384 Ga0207708_10868567 3300026075 Bacteria 779
385 Ga0207702_10850956 3300026078 Bacteria 903
386 Ga0207641_10145774 3300026088 Bacteria 2141
387 Ga0207648_10013078 3300026089 Bacteria 7739
388 Ga0207648_10156600 3300026089 Bacteria 2011
389 Ga0207648_10164979 3300026089 Bacteria 1957
390 Ga0207676_10007061 3300026095 Bacteria 7959
391 Ga0207676_10013650 3300026095 Bacteria 5832
392 Ga0207674_10440392 3300026116 Unclassified 1259
393 Ga0207675_100004076 3300026118 Bacteria 14144
394 Ga0207675_100067259 3300026118 Bacteria 3349
395 Ga0207683_10013234 3300026121 Bacteria 7034
396 Ga0207683_10220229 3300026121 Bacteria 1729
397 Ga0209813_10007617 3300027866 Bacteria 2703
398 Ga0207428_10294054 3300027907 Bacteria 1203
399 Ga0207428_10490859 3300027907 Bacteria 893
400 Ga0207428_10768791 3300027907 Unclassified 686
401 Ga0268265_10283495 3300028380 Bacteria 1483
402 Ga0268264_10101882 3300028381 Bacteria 2497
403 Ga0265325_10000031 3300031241 Bacteria 102905
404 Ga0265325_10011768 3300031241 Bacteria 5019
405 Ga0265340_10001901 3300031247 Bacteria 11908
406 Ga0265340_10006675 3300031247 Bacteria 6323
407 Ga0265340_10105089 3300031247 Bacteria 1310
408 Ga0265339_10000067 3300031249 Bacteria 91730
409 Ga0265331_10080344 3300031250 Bacteria 1516
410 Ga0265313_10000054 3300031595 Bacteria 110199
411 Ga0265314_10365494 3300031711 Bacteria 790
412 Ga0265342_10001629 3300031712 Bacteria 20703
413 Ga0307409_101095025 3300031995 Bacteria 818
414 Ga0373930_0128696 3300034816 Bacteria 622
415 Ga0373959_0007564 3300034820 Bacteria 1829
416 Ga0373959_0054228 3300034820 Bacteria 873
417 Ga0373926_0009301 3300035083 Bacteria 3281
418 Ga0373926_0195998 3300035083 Bacteria 777
419 Ga0373944_0010496 3300035089 Bacteria 2527
420 Ga0373944_0012110 3300035089 Bacteria 2372
421 Ga0373944_0132827 3300035089 Unclassified 866
422 Ga0373923_0059900 3300035111 Bacteria 1615
423 Ga0373936_0030174 3300035113 Bacteria 2138
424 Ga0373941_0040398 3300035115 Bacteria 1438
425 Ga0373945_0013534 3300035116 Bacteria 2724
426 Ga0373945_0037286 3300035116 Bacteria 1744
427 Ga0373956_0162545 3300035119 Bacteria 1053
428 Ga0373957_0121170 3300035120 Bacteria 1059
429 Ga0373960_0035224 3300035121 Bacteria 1420
430 Ga0373943_0000185 3300035170 Bacteria 24985
431 Ga0373943_0014310 3300035170 Bacteria 3589
432 Ga0373946_0001621 3300035171 Bacteria 7835
433 Ga0373946_0088196 3300035171 Bacteria 1370
434 Ga0373961_0003587 3300035241 Bacteria 3823
435 Ga0373961_0029752 3300035241 Bacteria 1515
436 Ga0373962_0090028 3300035242 Bacteria 944
437 Ga0373962_0098621 3300035242 Bacteria 909
438 Ga0373931_0003377 3300035691 Bacteria 7161
439 Ga0373931_0031631 3300035691 Bacteria 2732
440 Ga0373931_0070007 3300035691 Bacteria 1913
441 Ga0373935_0003389 3300035692 Bacteria 9255
442 Ga0373935_0087657 3300035692 Bacteria 2033
443 Ga0373927_0000434 3300035695 Bacteria 32038
444 Ga0373927_0010452 3300035695 Bacteria 6186
445 Ga0373927_0042327 3300035695 Bacteria 2950
446 Ga0373927_0053956 3300035695 Bacteria 2600
447 Ga0373927_0145914 3300035695 Bacteria 1549
448 Ga0373927_0207755 3300035695 Bacteria 1286
449 Ga0373947_0000583 3300035725 Bacteria 21422
450 Ga0373947_0022004 3300035725 Bacteria 3694
451 Ga0373947_0033489 3300035725 Bacteria 3034
452 Ga0373947_0052000 3300035725 Bacteria 2467
453 Ga0373947_0166914 3300035725 Bacteria 1426
454 Ga0373947_0173158 3300035725 Bacteria 1402
455 Ga0373947_0386499 3300035725 Unclassified 943
456 Ga0373937_0063065 3300036401 Bacteria 3408
457 Ga0373937_0706781 3300036401 Bacteria 955
458 Ga0373925_0011505 3300037068 Bacteria 6402
459 Ga0373925_0047689 3300037068 Bacteria 3189
460 Ga0373925_0060409 3300037068 Bacteria 2847
461 Ga0373925_0330197 3300037068 Bacteria 1235
462 Ga0395899_0243481 3300037312 Bacteria 1237
463 Ga0395900_0074583 3300037418 Bacteria 3488
464 Ga0395898_0366315 3300037466 Bacteria 1374
465 Ga0395905_0184949 3300037471 Bacteria 1956
466 Ga0436364_1421631 3300037853 Bacteria 2119
467 Ga0436365_0378414 3300039437 Bacteria 1211
468 Ga0436365_1481938 3300039437 Bacteria 710
469 Ga0436361_0014424 3300039447 Bacteria 11856
470 Ga0436361_0953843 3300039447 Bacteria 1005
471 Ga0436363_1513570 3300039450 Bacteria 813
472 Ga0436362_0604624 3300039453 Unclassified 2211
473 Ga0451800_1670893 3300041459 Bacteria 1140
474 Ga0451851_1173687 3300041507 Unclassified 604
475 Ga0451855_1368076 3300041511 Bacteria 888
476 Ga0450923_017585 3300042125 Bacteria 1359
477 Ga0439459_0011045 3300042438 Bacteria 1585
478 Ga0495592_0046109 3300046454 Bacteria 3250
479 Ga0495592_0069378 3300046454 Bacteria 2570
480 Ga0495592_0345190 3300046454 Bacteria 956
481 Ga0495592_0432260 3300046454 Bacteria 828
482 Ga0495603_0031240 3300046455 Bacteria 3206
483 Ga0495590_0120596 3300046457 Unclassified 940
484 Ga0495591_051176 3300046458 Bacteria 1128
485 Ga0495629_0034963 3300046459 Bacteria 3552
486 Ga0495629_0088484 3300046459 Bacteria 2160
487 Ga0495629_0124194 3300046459 Bacteria 1798
488 Ga0495641_0038296 3300046461 Bacteria 2240
489 Ga0495653_0114763 3300046463 Bacteria 1929
490 Ga0495580_0008952 3300046472 Bacteria 7913
491 Ga0495580_0124327 3300046472 Bacteria 1790
492 Ga0495582_0048419 3300046473 Bacteria 2340
493 Ga0495582_0154880 3300046473 Bacteria 1302
494 Ga0495605_0115961 3300046474 Bacteria 1218
495 Ga0495639_0013627 3300046475 Bacteria 3515
496 Ga0495662_0002257 3300046476 Bacteria 9716
497 Ga0495662_0013539 3300046476 Bacteria 3971
498 Ga0495662_0035256 3300046476 Bacteria 2414
499 Ga0495664_0003373 3300046477 Bacteria 8682
500 Ga0495584_0018856 3300046491 Bacteria 3506
501 Ga0495584_0046670 3300046491 Bacteria 2185
502 Ga0495584_0090134 3300046491 Bacteria 1546
503 Ga0495584_0136262 3300046491 Bacteria 1246
504 Ga0495585_0076506 3300046492 Bacteria 1818
505 Ga0495585_0092211 3300046492 Bacteria 1630
506 Ga0495618_0051270 3300046514 Bacteria 2607
507 Ga0495618_0057794 3300046514 Bacteria 2456
508 Ga0495618_0085362 3300046514 Bacteria 2018
509 Ga0495628_0270614 3300046516 Bacteria 1264
510 Ga0495630_0016449 3300046517 Bacteria 5406
511 Ga0495630_0035164 3300046517 Bacteria 3743
512 Ga0495630_0256521 3300046517 Bacteria 1336
513 Ga0495637_0078991 3300046520 Bacteria 1315
514 Ga0495643_0109116 3300046522 Bacteria 1409
515 Ga0495644_0017921 3300046523 Bacteria 2705
516 Ga0495663_0043303 3300046525 Bacteria 1374
517 Ga0495666_0016204 3300046526 Bacteria 3712
518 Ga0495652_0161141 3300046529 Bacteria 1742
519 Ga0495652_0164250 3300046529 Bacteria 1720
520 Ga0495654_0200595 3300046530 Bacteria 854
521 Ga0495665_0011426 3300046531 Bacteria 4804
522 Ga0495665_0106091 3300046531 Bacteria 1474
523 Ga0495640_0024555 3300046533 Bacteria 4384
524 Ga0495640_0032913 3300046533 Bacteria 3688
525 Ga0495640_0071967 3300046533 Bacteria 2318
526 Ga0495640_0184241 3300046533 Bacteria 1329
527 Ga0495640_0285353 3300046533 Bacteria 1027
528 Ga0495640_0629348 3300046533 Bacteria 647
529 Ga0495586_0005871 3300046535 Bacteria 6562
530 Ga0495587_0282758 3300046536 Unclassified 929
531 Ga0495598_0058457 3300046537 Unclassified 1183
532 Ga0495621_0095323 3300046539 Unclassified 1127
533 Ga0495645_0039268 3300046543 Bacteria 3453
534 Ga0495645_0136316 3300046543 Bacteria 1717
535 Ga0495622_0021328 3300046557 Bacteria 3016
536 Ga0495656_0021573 3300046615 Bacteria 2509
537 Ga0495634_0011835 3300046642 Bacteria 6343
538 Ga0495634_0080813 3300046642 Bacteria 2127
539 Ga0495634_0113195 3300046642 Bacteria 1743
540 Ga0495634_0348763 3300046642 Bacteria 887
541 Ga0495634_0385119 3300046642 Bacteria 835
542 Ga0495635_0010464 3300046663 Bacteria 6488
543 Ga0495635_0050373 3300046663 Bacteria 2871
544 Ga0495635_0425438 3300046663 Unclassified 880
545 Ga0495659_0009154 3300046664 Bacteria 3157
546 Ga0495659_0089908 3300046664 Bacteria 1177
547 Ga0495661_0172618 3300046665 Bacteria 1152
548 Ga0495588_0018559 3300046674 Bacteria 3394
549 Ga0495657_0133638 3300046675 Bacteria 1552
550 Ga0495646_0215939 3300046680 Bacteria 1039
551 Ga0495646_0255334 3300046680 Bacteria 938
552 Ga0495658_0027484 3300046683 Bacteria 3062
553 Ga0495658_0356317 3300046683 Bacteria 930
554 Ga0495669_0199928 3300046684 Bacteria 955
555 Ga0495613_0048419 3300046689 Bacteria 3139
556 Ga0495613_0265939 3300046689 Bacteria 1193
557 Ga0495624_0000948 3300046690 Bacteria 22863
558 Ga0495624_0052417 3300046690 Bacteria 2578
559 Ga0495624_0073305 3300046690 Bacteria 2129
560 Ga0495670_0014063 3300046691 Bacteria 3938
561 Ga0495649_0111719 3300046694 Bacteria 1449
562 Ga0495589_0103400 3300046794 Bacteria 1377
563 Ga0495600_0412547 3300046809 Bacteria 839
564 Ga0495581_0030418 3300047315 Bacteria 3129
565 Ga0495636_0067248 3300047318 Bacteria 1525
566 Ga0495674_0006441 3300047319 Bacteria 11254
567 Ga0495674_0094647 3300047319 Bacteria 2548
568 Ga0495674_0301020 3300047319 Bacteria 1310
569 Ga0495674_0348173 3300047319 Bacteria 1203
570 Ga0495672_0112395 3300047320 Bacteria 1460
571 Ga0495676_0029094 3300047321 Bacteria 4707
572 Ga0495680_0274081 3300047322 Bacteria 1191
573 Ga0495677_0186469 3300047445 Bacteria 805
574 Ga0495681_0083874 3300047470 Bacteria 1418
575 Ga0495684_0025944 3300047471 Bacteria 4503
576 Ga0495684_0030558 3300047471 Bacteria 4135
577 Ga0495684_0164469 3300047471 Bacteria 1653
578 Ga0495593_0008247 3300047673 Bacteria 6063
579 Ga0495602_0112433 3300048088 Bacteria 2210
580 Ga0495614_0092853 3300048089 Bacteria 1314
581 Ga0496100_0059004 3300048903 Bacteria 2520
582 Ga0496100_0118505 3300048903 Bacteria 1849
583 Ga0496101_0051491 3300048904 Bacteria 2967
584 Ga0496101_0091156 3300048904 Bacteria 2268
585 Ga0496101_0193913 3300048904 Bacteria 1568
586 Ga0496102_0181010 3300048905 Bacteria 1986
587 Ga0496102_0504877 3300048905 Bacteria 1132
588 Ga0496102_0777211 3300048905 Bacteria 880
589 Ga0496103_0225730 3300048906 Bacteria 1204
590 Ga0496104_0004279 3300048907 Bacteria 12411
591 Ga0496104_0015801 3300048907 Bacteria 6847
592 Ga0496104_0084357 3300048907 Bacteria 3031
593 Ga0496104_0204633 3300048907 Bacteria 1885
594 Ga0496104_0423373 3300048907 Bacteria 1243
595 Ga0496104_0494882 3300048907 Bacteria 1134
596 Ga0496105_0019440 3300048908 Bacteria 5478
597 Ga0496105_0073498 3300048908 Bacteria 2824
598 Ga0496105_0159604 3300048908 Bacteria 1851
599 Ga0496105_0245921 3300048908 Bacteria 1450
600 Ga0496105_0275934 3300048908 Bacteria 1357
601 Ga0496106_0007768 3300048909 Bacteria 7935
602 Ga0496107_0007548 3300048910 Bacteria 7503
603 Ga0496107_0047941 3300048910 Bacteria 3077
604 Ga0496107_0518502 3300048910 Bacteria 884
605 Ga0496108_0013673 3300048911 Bacteria 6626
606 Ga0496108_0077933 3300048911 Bacteria 2805
607 Ga0496109_0001145 3300048912 Bacteria 22044
608 Ga0496109_0010240 3300048912 Bacteria 8008
609 Ga0496109_0077153 3300048912 Bacteria 3066
610 Ga0496109_0800916 3300048912 Bacteria 880
611 Ga0496110_0001744 3300048913 Bacteria 16036
612 Ga0496110_0023424 3300048913 Bacteria 5251
613 Ga0496110_0079958 3300048913 Bacteria 2911
614 Ga0496110_0139885 3300048913 Bacteria 2188
615 Ga0496110_0215589 3300048913 Bacteria 1745
616 Ga0496111_0013141 3300048914 Bacteria 5626
617 Ga0496111_0016513 3300048914 Bacteria 5087
618 Ga0496111_0155661 3300048914 Bacteria 1696
619 Ga0496112_0004490 3300048915 Bacteria 11838
620 Ga0496112_0063475 3300048915 Bacteria 3643
621 Ga0496112_0353323 3300048915 Bacteria 1412
622 Ga0496112_1005842 3300048915 Unclassified 753
623 Ga0496113_0002392 3300048916 Bacteria 10897
624 Ga0496113_0072540 3300048916 Bacteria 2620
625 Ga0496113_0297487 3300048916 Bacteria 1292
626 Ga0496113_0368787 3300048916 Bacteria 1152
627 Ga0496113_0846130 3300048916 Bacteria 725
628 Ga0496114_0068840 3300048917 Bacteria 2971
629 Ga0496114_0205697 3300048917 Bacteria 1725
630 Ga0496115_0010887 3300048918 Bacteria 6809
631 Ga0496115_0016315 3300048918 Bacteria 5652
632 Ga0496115_0101317 3300048918 Bacteria 2361
633 Ga0496115_0111409 3300048918 Bacteria 2248
634 Ga0496115_0149497 3300048918 Unclassified 1928
635 Ga0501032_0010965 3300049569 Bacteria 6516
636 Ga0501033_0102386 3300049570 Bacteria 2089
637 Ga0501033_0127805 3300049570 Bacteria 1842
638 Ga0501034_0207451 3300049571 Bacteria 1915
639 Ga0501034_0207804 3300049571 Bacteria 1913
640 Ga0501034_0478446 3300049571 Bacteria 1161
641 Ga0501034_0553270 3300049571 Bacteria 1060
642 Ga0501036_0003162 3300049572 Bacteria 13138
643 Ga0501037_0003374 3300049573 Bacteria 11609
644 Ga0501037_0217923 3300049573 Bacteria 1344
645 Ga0501038_0030351 3300049574 Bacteria 4784
646 Ga0501038_0063888 3300049574 Bacteria 3141
647 Ga0501038_0873428 3300049574 Unclassified 665
648 Ga0501039_0092788 3300049575 Bacteria 2353
649 Ga0501039_0364230 3300049575 Bacteria 1136
650 Ga0501040_0159296 3300049576 Bacteria 1595
651 Ga0501041_0378772 3300049577 Bacteria 895
652 Ga0501041_0870265 3300049577 Unclassified 579
653 Ga0501042_0363562 3300049578 Bacteria 1047
654 Ga0501043_0124034 3300049579 Bacteria 2025
655 Ga0501046_0020638 3300049580 Bacteria 5446
656 Ga0501047_0094867 3300049581 Bacteria 2862
657 Ga0501047_0261410 3300049581 Bacteria 1578
658 Ga0501067_0255934 3300049583 Bacteria 975
659 Ga0501068_0105376 3300049584 Bacteria 1750
660 Ga0501068_0122752 3300049584 Bacteria 1621
661 Ga0501068_0328847 3300049584 Bacteria 980
662 Ga0501069_0354833 3300049585 Bacteria 864
663 Ga0501070_0030621 3300049586 Bacteria 4509
664 Ga0501071_0070374 3300049587 Bacteria 2548
665 Ga0501071_0073175 3300049587 Bacteria 2499
666 Ga0501071_0377502 3300049587 Bacteria 1081
667 Ga0501072_0010550 3300049588 Bacteria 7034
668 Ga0501073_0199885 3300049589 Bacteria 1382
669 Ga0501073_0222961 3300049589 Bacteria 1302
670 Ga0501075_0004617 3300049591 Bacteria 9345
671 Ga0501076_0128580 3300049592 Bacteria 2053
672 Ga0501079_0125759 3300049741 Bacteria 1995
673 Ga0501079_0321855 3300049741 Bacteria 1211
674 Ga0501080_0062015 3300049742 Bacteria 3480
675 Ga0501080_0103031 3300049742 Bacteria 2647
676 Ga0501080_0208790 3300049742 Bacteria 1790
677 Ga0501080_0241732 3300049742 Bacteria 1648
678 Ga0501080_0732349 3300049742 Bacteria 871
679 Ga0501081_0154600 3300049743 Bacteria 1650
680 Ga0501081_0531355 3300049743 Unclassified 878
681 Ga0501083_0156289 3300049744 Bacteria 1493
682 Ga0501044_0000122 3300049823 Bacteria 93246
683 Ga0501044_0095677 3300049823 Bacteria 2992
684 Ga0501045_0019673 3300049824 Bacteria 4817
685 Ga0501045_0094555 3300049824 Unclassified 2211
686 nmdc:mga03683_12022_c1 3300050489 Bacteria 3149
687 nmdc:mga03683_146665_c1 3300050489 Bacteria 1063
688 nmdc:mga03n38_53075_c1 3300050490 Bacteria 1816
689 nmdc:mga03n38_96857_c1 3300050490 Bacteria 1416
690 nmdc:mga0yw44_149191_c1 3300050492 Bacteria 1524
691 nmdc:mga0yw44_3399_c1 3300050492 Bacteria 3317
692 nmdc:mga0k408_297796_c1 3300050493 Bacteria 963
693 nmdc:mga0k408_52251_c1 3300050493 Bacteria 2368
694 nmdc:mga06z11_13418_c1 3300050494 Bacteria 3598
695 nmdc:mga06z11_254806_c1 3300050494 Bacteria 1034
696 nmdc:mga06z11_498137_c1 3300050494 Bacteria 738
697 nmdc:mga07m45_193801_c1 3300050496 Bacteria 1182
698 nmdc:mga07m45_38547_c1 3300050496 Bacteria 2667
699 nmdc:mga07m45_418324_c1 3300050496 Bacteria 778
700 nmdc:mga05p37_12909_c1 3300050507 Bacteria 9990
701 nmdc:mga05p37_151746_c1 3300050507 Bacteria 2833
702 nmdc:mga05p37_175149_c1 3300050507 Bacteria 2614
703 nmdc:mga05p37_31974_c1 3300050507 Bacteria 6433
704 nmdc:mga05p37_33708_c1 3300050507 Bacteria 6272
705 nmdc:mga05p37_450513_c1 3300050507 Bacteria 1490
706 nmdc:mga05p37_507078_c1 3300050507 Bacteria 1383
707 nmdc:mga09592_75462_c1 3300050508 Bacteria 2866
708 nmdc:mga09592_90407_c1 3300050508 Bacteria 2615
709 nmdc:mga09592_925352_c1 3300050508 Bacteria 732
710 nmdc:mga0qj67_20517_c1 3300050509 Bacteria 5061
711 nmdc:mga0qj67_263854_c1 3300050509 Bacteria 1397
712 nmdc:mga0qj67_392795_c1 3300050509 Bacteria 1120
713 nmdc:mga0qj67_620882_c1 3300050509 Bacteria 864
714 nmdc:mga06r32_176956_c1 3300050510 Bacteria 2118
715 nmdc:mga06r32_514224_c1 3300050510 Bacteria 1173
716 nmdc:mga06r32_74594_c1 3300050510 Bacteria 3289
717 nmdc:mga08y16_132162_c1 3300050511 Bacteria 2595
718 nmdc:mga08y16_296117_c1 3300050511 Bacteria 1668
719 nmdc:mga08y16_562981_c1 3300050511 Bacteria 1152
720 nmdc:mga08y16_723880_c1 3300050511 Bacteria 993
721 nmdc:mga08y16_845400_c1 3300050511 Bacteria 905
722 nmdc:mga0n895_104195_c1 3300050512 Bacteria 2849
723 nmdc:mga0n895_149888_c1 3300050512 Bacteria 2362
724 nmdc:mga0n895_270694_c1 3300050512 Bacteria 1723
725 nmdc:mga0n895_328306_c1 3300050512 Bacteria 1550
726 nmdc:mga0n895_651787_c1 3300050512 Bacteria 1052
727 nmdc:mga0n895_74700_c1 3300050512 Bacteria 3368
728 nmdc:mga0n895_91745_c1 3300050512 Bacteria 3040
729 nmdc:mga0n895_928482_c1 3300050512 Bacteria 854
730 nmdc:mga0rr50_234225_c1 3300050513 Bacteria 1520
731 nmdc:mga0rr50_284091_c1 3300050513 Bacteria 1381
732 nmdc:mga0rr50_450707_c1 3300050513 Unclassified 1091
733 nmdc:mga08x19_77320_c1 3300050514 Bacteria 2179
734 nmdc:mga0a205_126617_c1 3300050515 Bacteria 2454
735 nmdc:mga0a205_385263_c1 3300050515 Bacteria 1267
736 nmdc:mga0a205_91847_c1 3300050515 Bacteria 2933
737 Ga0495601_0009511 3300053077 Bacteria 5753
738 Ga0495601_0027228 3300053077 Bacteria 3534
739 Ga0495601_0048456 3300053077 Bacteria 2676
740 Ga0495612_0000688 3300053078 Bacteria 13638
741 Ga0495612_0094632 3300053078 Unclassified 1268
742 Ga0495612_0232320 3300053078 Bacteria 818
743 Ga0495655_0044200 3300053083 Bacteria 1151
744 Ga0495595_0130778 3300053084 Unclassified 1227
745 Ga0495595_0166644 3300053084 Bacteria 1089
746 Ga0495619_0002604 3300053085 Bacteria 11784
747 Ga0495619_0039880 3300053085 Bacteria 3067
748 Ga0495619_0673859 3300053085 Bacteria 704
749 Ga0500595_004617 3300053119 Bacteria 6142
750 Ga0500568_0050296 3300053139 Bacteria 1643
751 Ga0500616_0063017 3300053153 Bacteria 1913
752 Ga0501084_0040389 3300054114 Bacteria 3903
753 Ga0501084_0168658 3300054114 Bacteria 1848
754 Ga0501082_0544285 3300060353 Bacteria 1015
755 Ga0530510_0029177 3300061734 Bacteria 3959
756 nmdc:mga0k408_5364_c1
757 CNAas_1002558
758 JGI24752J21851_1005544
759 JGI24746J21847_1024544
760 JGI24737J22298_10014202
761 JGI24743J22301_10012592
762 JGI24745J21846_1002116
763 JGI24748J21848_1001451
764 JGI24744J21845_10007412
765 JGI24742J22300_10003995
766 JGI25153J46596_10001233
767 JGI25405J52794_10002281
768 JGI25405J52794_10013830
769 Ga0058859_11600099
770 Ga0065707_10244512
771 Ga0070676_10465640
772 Ga0070683_100288879
773 Ga0070683_100362491
774 Ga0070690_100208031
775 Ga0070670_101028424
776 Ga0070677_10013405
777 Ga0070680_100003050
778 Ga0070680_100029915
779 Ga0070680_100579024
780 Ga0070680_100682271
781 Ga0070680_100795673
782 Ga0070682_100179233
783 Ga0070660_100072439
784 Ga0070660_100516443
785 Ga0070689_100060345
786 Ga0070689_100126007
787 Ga0070691_10075046
788 Ga0070687_100030223
789 Ga0070661_100084746
790 Ga0070668_100371367
791 Ga0070668_100794112
792 Ga0070669_100039793
793 Ga0070669_100533171
794 Ga0070675_100015827
795 Ga0070675_100299040
796 Ga0070671_100031065
797 Ga0070674_100018047
798 Ga0070674_100057655
799 Ga0070674_100529708
800 Ga0070673_100039138
801 Ga0070673_100348605
802 Ga0070688_100743596
803 Ga0070659_100137348
804 Ga0070659_100350646
805 Ga0070667_100068329
806 Ga0070667_100354042
807 Ga0070709_10014966
808 Ga0070714_100017315
809 Ga0070714_100295340
810 Ga0070714_100447830
811 Ga0070713_100084654
812 Ga0070713_100223078
813 Ga0070713_100623785
814 Ga0070713_100738014
815 Ga0070710_10007889
816 Ga0070710_10149057
817 Ga0070710_10474480
818 Ga0070701_10263875
819 Ga0070705_100228185
820 Ga0070705_100528861
821 Ga0070700_100032327
822 Ga0070694_100317234
823 Ga0070708_100008656
824 Ga0070708_100802036
825 Ga0070663_100497846
826 Ga0070678_100074505
827 Ga0070678_100186131
828 Ga0070662_100055666
829 Ga0070662_100358114
830 Ga0070681_10001234
831 Ga0070681_10074036
832 Ga0070681_10083414
833 Ga0070681_10907166
834 Ga0070681_11113558
835 Ga0068867_100082820
836 Ga0068867_100126291
837 Ga0070685_10005812
838 Ga0070698_100232313
839 Ga0070699_100009225
840 Ga0070699_100540285
841 Ga0070679_100057516
842 Ga0070679_100185123
843 Ga0070679_100580576
844 Ga0070679_100792793
845 Ga0070697_100257455
846 Ga0068853_101017705
847 Ga0070672_100078551
848 Ga0070672_100555876
849 Ga0070686_100106450
850 Ga0070686_100608710
851 Ga0070686_100919550
852 Ga0070696_100060120
853 Ga0070696_100629110
854 Ga0070693_100598416
855 Ga0070704_100090055
856 Ga0070704_100206569
857 Ga0070704_100401965
858 Ga0068855_100708331
859 Ga0068855_101035277
860 Ga0068855_101645548
861 Ga0070664_100231757
862 Ga0068857_100134268
863 Ga0068857_100228970
864 Ga0068854_101172311
865 Ga0068856_100481220
866 Ga0070702_100525164
867 Ga0068859_100589771
868 Ga0068864_100008546
869 Ga0068864_100819788
870 Ga0068866_10177447
871 Ga0068866_10325389
872 Ga0068861_100216686
873 Ga0068861_100457098
874 Ga0068851_10036255
875 Ga0068870_10015098
876 Ga0068870_10022327
877 Ga0068863_100011842
878 Ga0068858_100079955
879 Ga0068858_100966923
880 Ga0068860_100024092
881 Ga0068860_100908125
882 Ga0068862_100853467
883 Ga0081455_10002985
884 Ga0081455_10004868
885 Ga0081455_10017262
886 Ga0081455_10172189
887 Ga0081455_10236455
888 Ga0081455_10495459
889 Ga0081538_10002885
890 Ga0081538_10021663
891 Ga0081538_10027802
892 Ga0081540_1006751
893 Ga0081540_1007409
894 Ga0081539_10164932
895 Ga0070717_10010855
896 Ga0070717_10249858
897 Ga0070717_10681562
898 Ga0075365_10168292
899 Ga0075365_10217227
900 Ga0075365_10234909
901 Ga0075365_10383667
902 Ga0075365_10533045
903 Ga0075368_10146164
904 Ga0075364_10124651
905 Ga0070715_10045671
906 Ga0070716_100147136
907 Ga0070716_100452011
908 Ga0070712_100003552
909 Ga0070712_100070857
910 Ga0070712_100133322
911 Ga0070712_100164421
912 Ga0070712_100410260
913 Ga0070712_100464572
914 Ga0075362_10081872
915 Ga0075362_10113670
916 Ga0075362_10159510
917 Ga0075367_10120219
918 Ga0075367_10315084
919 Ga0075369_10019703
920 Ga0075366_10006969
921 Ga0075366_10048872
922 Ga0097621_100045453
923 Ga0075370_10248378
924 Ga0068871_100194441
925 Ga0068871_100267538
926 Ga0075428_100093557
927 Ga0075428_100116053
928 Ga0075428_100159264
929 Ga0075428_100379766
930 Ga0075428_100455800
931 Ga0075428_100469238
932 Ga0075428_100723707
933 Ga0075428_100944455
934 Ga0075430_100015997
935 Ga0075430_100065552
936 Ga0075430_100111356
937 Ga0075430_100419480
938 Ga0075431_100025791
939 Ga0075431_100032433
940 Ga0075431_100058769
941 Ga0075431_100115142
942 Ga0075431_100211129
943 Ga0075431_100273655
944 Ga0075433_10109417
945 Ga0075433_10652131
946 Ga0075433_11089636
947 Ga0075434_100023136
948 Ga0075434_100190431
949 Ga0075434_100591464
950 Ga0075434_100662851
951 Ga0075434_100706371
952 Ga0075434_100711423
953 Ga0075434_100772049
954 Ga0075434_100843858
955 Ga0075429_100069541
956 Ga0075429_100114883
957 Ga0075429_100388181
958 Ga0075429_101097208
959 Ga0068865_100222404
960 Ga0075436_100171471
961 Ga0075436_100427116
962 Ga0097620_100589821
963 Ga0075435_100055395
964 Ga0075435_100109128
965 Ga0075435_100397851
966 Ga0099794_10116596
967 Ga0099794_10206689
968 Ga0099795_10093754
969 Ga0099795_10208302
970 Ga0099795_10397271
971 Ga0105240_10060081
972 Ga0111539_10119006
973 Ga0111539_10393954
974 Ga0111539_10550379
975 Ga0111539_11394574
976 Ga0111539_11466149
977 Ga0105245_10027775
978 Ga0105247_10030343
979 Ga0105247_10382255
980 Ga0105247_10903388
981 Ga0114129_10005829
982 Ga0114129_10012350
983 Ga0114129_10044692
984 Ga0114129_10476155
985 Ga0114129_10504830
986 Ga0114129_10777477
987 Ga0114129_10817930
988 Ga0114129_11186012
989 Ga0105243_10125522
990 Ga0105243_10288413
991 Ga0105243_10439464
992 Ga0105243_11690823
993 Ga0105242_10782957
994 Ga0105242_10884909
995 Ga0105248_10075856
996 Ga0105248_10135953
997 Ga0105248_10233209
998 Ga0105248_12012385
999 Ga0105237_10202122
1000 Ga0105237_10257104
1001 Ga0105237_11136812
1002 Ga0105238_10141142
1003 Ga0105238_10332282
1004 Ga0105238_10942472
1005 Ga0105249_10070237
1006 Ga0105249_10196738
1007 Ga0099796_10025477
1008 Ga0105239_11969542
1009 Ga0105246_10373633
1010 Ga0105246_10545854
1011 Ga0157370_10100690
1012 Ga0157369_10007596
1013 Ga0157374_10176663
1014 Ga0157374_11178869
1015 Ga0157378_10132348
1016 Ga0157378_10800288
1017 Ga0157378_11365673
1018 Ga0163162_10798947
1019 Ga0157372_10248754
1020 Ga0157372_10281396
1021 Ga0157372_11225842
1022 Ga0157375_10186933
1023 Ga0157375_10367650
1024 Ga0157375_12181891
1025 Ga0157380_10038583
1026 Ga0157380_10339021
1027 Ga0157380_10608230
1028 Ga0157380_10623793
1029 Ga0182008_10137863
1030 Ga0157377_10217983
1031 Ga0157379_10868502
1032 Ga0157376_10176260
1033 Ga0157376_10499562
1034 Ga0163161_10043929
1035 Ga0163161_10416077
1036 Ga0184598_132508
1037 Ga0213873_10186248
1038 Ga0213872_10039119
1039 Ga0224712_10026029
1040 Ga0209233_1005483
1041 Ga0209758_1000351
1042 Ga0207426_1041079
1043 Ga0207697_10045924
1044 Ga0207697_10079214
1045 Ga0207697_10131828
1046 Ga0207653_10013516
1047 Ga0207682_10057558
1048 Ga0207682_10085280
1049 Ga0207692_10020922
1050 Ga0207642_10026722
1051 Ga0207710_10023852
1052 Ga0207710_10181187
1053 Ga0207688_10005066
1054 Ga0207688_10031804
1055 Ga0207688_10231901
1056 Ga0207680_10054601
1057 Ga0207647_10019169
1058 Ga0207685_10007357
1059 Ga0207699_10021859
1060 Ga0207699_10396122
1061 Ga0207645_10013461
1062 Ga0207645_10032037
1063 Ga0207643_10002909
1064 Ga0207643_10171047
1065 Ga0207705_10856872
1066 Ga0207684_10030988
1067 Ga0207707_10001155
1068 Ga0207707_10053017
1069 Ga0207707_10272934
1070 Ga0207693_10003651
1071 Ga0207693_10013085
1072 Ga0207693_10020070
1073 Ga0207693_10082804
1074 Ga0207693_10085436
1075 Ga0207693_10463643
1076 Ga0207663_10017134
1077 Ga0207663_10059154
1078 Ga0207663_10256321
1079 Ga0207660_10002334
1080 Ga0207660_10615610
1081 Ga0207660_10640022
1082 Ga0207660_10778366
1083 Ga0207662_10052026
1084 Ga0207662_10074950
1085 Ga0207662_10443347
1086 Ga0207657_10076419
1087 Ga0207657_10084811
1088 Ga0207652_10020199
1089 Ga0207652_10893138
1090 Ga0207646_10022518
1091 Ga0207681_10151222
1092 Ga0207681_10843717
1093 Ga0207694_10187439
1094 Ga0207694_10455006
1095 Ga0207659_10066893
1096 Ga0207659_10152158
1097 Ga0207687_10140966
1098 Ga0207700_10007334
1099 Ga0207700_10015358
1100 Ga0207700_10145380
1101 Ga0207700_10732694
1102 Ga0207664_10038090
1103 Ga0207664_10159361
1104 Ga0207664_10402249
1105 Ga0207664_11075067
1106 Ga0207644_10156453
1107 Ga0207690_10006288
1108 Ga0207690_10077789
1109 Ga0207690_10368645
1110 Ga0207706_10066395
1111 Ga0207706_10304657
1112 Ga0207709_10024780
1113 Ga0207709_10738658
1114 Ga0207670_10011612
1115 Ga0207670_10091975
1116 Ga0207670_10358515
1117 Ga0207669_10073516
1118 Ga0207669_10111333
1119 Ga0207704_10104735
1120 Ga0207665_10002092
1121 Ga0207711_10064444
1122 Ga0207711_10106004
1123 Ga0207689_10149734
1124 Ga0207661_10114460
1125 Ga0207679_10272901
1126 Ga0207667_10510254
1127 Ga0207667_11207145
1128 Ga0207651_10529300
1129 Ga0207651_11188937
1130 Ga0207712_10086977
1131 Ga0207668_10163643
1132 Ga0207640_10168483
1133 Ga0207658_11031338
1134 Ga0207677_10342132
1135 Ga0207678_10129020
1136 Ga0207678_10340091
1137 Ga0207708_10016435
1138 Ga0207708_10120360
1139 Ga0207708_10868567
1140 Ga0207702_10850956
1141 Ga0207641_10145774
1142 Ga0207648_10013078
1143 Ga0207648_10156600
1144 Ga0207648_10164979
1145 Ga0207676_10007061
1146 Ga0207676_10013650
1147 Ga0207674_10440392
1148 Ga0207675_100004076
1149 Ga0207675_100067259
1150 Ga0207683_10013234
1151 Ga0207683_10220229
1152 Ga0209813_10007617
1153 Ga0207428_10294054
1154 Ga0207428_10490859
1155 Ga0207428_10768791
1156 Ga0268265_10283495
1157 Ga0268264_10101882
1158 Ga0265325_10000031
1159 Ga0265325_10011768
1160 Ga0265340_10001901
1161 Ga0265340_10006675
1162 Ga0265340_10105089
1163 Ga0265339_10000067
1164 Ga0265331_10080344
1165 Ga0265313_10000054
1166 Ga0265314_10365494
1167 Ga0265342_10001629
1168 Ga0307409_101095025
1169 Ga0373930_0128696
1170 Ga0373959_0007564
1171 Ga0373959_0054228
1172 Ga0373926_0009301
1173 Ga0373926_0195998
1174 Ga0373944_0010496
1175 Ga0373944_0012110
1176 Ga0373944_0132827
1177 Ga0373923_0059900
1178 Ga0373936_0030174
1179 Ga0373941_0040398
1180 Ga0373945_0013534
1181 Ga0373945_0037286
1182 Ga0373956_0162545
1183 Ga0373957_0121170
1184 Ga0373960_0035224
1185 Ga0373943_0000185
1186 Ga0373943_0014310
1187 Ga0373946_0001621
1188 Ga0373946_0088196
1189 Ga0373961_0003587
1190 Ga0373961_0029752
1191 Ga0373962_0090028
1192 Ga0373962_0098621
1193 Ga0373931_0003377
1194 Ga0373931_0031631
1195 Ga0373931_0070007
1196 Ga0373935_0003389
1197 Ga0373935_0087657
1198 Ga0373927_0000434
1199 Ga0373927_0010452
1200 Ga0373927_0042327
1201 Ga0373927_0053956
1202 Ga0373927_0145914
1203 Ga0373927_0207755
1204 Ga0373947_0000583
1205 Ga0373947_0022004
1206 Ga0373947_0033489
1207 Ga0373947_0052000
1208 Ga0373947_0166914
1209 Ga0373947_0173158
1210 Ga0373947_0386499
1211 Ga0373937_0063065
1212 Ga0373937_0706781
1213 Ga0373925_0011505
1214 Ga0373925_0047689
1215 Ga0373925_0060409
1216 Ga0373925_0330197
1217 Ga0395899_0243481
1218 Ga0395900_0074583
1219 Ga0395898_0366315
1220 Ga0395905_0184949
1221 Ga0436364_1421631
1222 Ga0436365_0378414
1223 Ga0436365_1481938
1224 Ga0436361_0014424
1225 Ga0436361_0953843
1226 Ga0436363_1513570
1227 Ga0436362_0604624
1228 Ga0451800_1670893
1229 Ga0451851_1173687
1230 Ga0451855_1368076
1231 Ga0450923_017585
1232 Ga0439459_0011045
1233 Ga0495592_0046109
1234 Ga0495592_0069378
1235 Ga0495592_0345190
1236 Ga0495592_0432260
1237 Ga0495603_0031240
1238 Ga0495590_0120596
1239 Ga0495591_051176
1240 Ga0495629_0034963
1241 Ga0495629_0088484
1242 Ga0495629_0124194
1243 Ga0495641_0038296
1244 Ga0495653_0114763
1245 Ga0495580_0008952
1246 Ga0495580_0124327
1247 Ga0495582_0048419
1248 Ga0495582_0154880
1249 Ga0495605_0115961
1250 Ga0495639_0013627
1251 Ga0495662_0002257
1252 Ga0495662_0013539
1253 Ga0495662_0035256
1254 Ga0495664_0003373
1255 Ga0495584_0018856
1256 Ga0495584_0046670
1257 Ga0495584_0090134
1258 Ga0495584_0136262
1259 Ga0495585_0076506
1260 Ga0495585_0092211
1261 Ga0495618_0051270
1262 Ga0495618_0057794
1263 Ga0495618_0085362
1264 Ga0495628_0270614
1265 Ga0495630_0016449
1266 Ga0495630_0035164
1267 Ga0495630_0256521
1268 Ga0495637_0078991
1269 Ga0495643_0109116
1270 Ga0495644_0017921
1271 Ga0495663_0043303
1272 Ga0495666_0016204
1273 Ga0495652_0161141
1274 Ga0495652_0164250
1275 Ga0495654_0200595
1276 Ga0495665_0011426
1277 Ga0495665_0106091
1278 Ga0495640_0024555
1279 Ga0495640_0032913
1280 Ga0495640_0071967
1281 Ga0495640_0184241
1282 Ga0495640_0285353
1283 Ga0495640_0629348
1284 Ga0495586_0005871
1285 Ga0495587_0282758
1286 Ga0495598_0058457
1287 Ga0495621_0095323
1288 Ga0495645_0039268
1289 Ga0495645_0136316
1290 Ga0495622_0021328
1291 Ga0495656_0021573
1292 Ga0495634_0011835
1293 Ga0495634_0080813
1294 Ga0495634_0113195
1295 Ga0495634_0348763
1296 Ga0495634_0385119
1297 Ga0495635_0010464
1298 Ga0495635_0050373
1299 Ga0495635_0425438
1300 Ga0495659_0009154
1301 Ga0495659_0089908
1302 Ga0495661_0172618
1303 Ga0495588_0018559
1304 Ga0495657_0133638
1305 Ga0495646_0215939
1306 Ga0495646_0255334
1307 Ga0495658_0027484
1308 Ga0495658_0356317
1309 Ga0495669_0199928
1310 Ga0495613_0048419
1311 Ga0495613_0265939
1312 Ga0495624_0000948
1313 Ga0495624_0052417
1314 Ga0495624_0073305
1315 Ga0495670_0014063
1316 Ga0495649_0111719
1317 Ga0495589_0103400
1318 Ga0495600_0412547
1319 Ga0495581_0030418
1320 Ga0495636_0067248
1321 Ga0495674_0006441
1322 Ga0495674_0094647
1323 Ga0495674_0301020
1324 Ga0495674_0348173
1325 Ga0495672_0112395
1326 Ga0495676_0029094
1327 Ga0495680_0274081
1328 Ga0495677_0186469
1329 Ga0495681_0083874
1330 Ga0495684_0025944
1331 Ga0495684_0030558
1332 Ga0495684_0164469
1333 Ga0495593_0008247
1334 Ga0495602_0112433
1335 Ga0495614_0092853
1336 Ga0496100_0059004
1337 Ga0496100_0118505
1338 Ga0496101_0051491
1339 Ga0496101_0091156
1340 Ga0496101_0193913
1341 Ga0496102_0181010
1342 Ga0496102_0504877
1343 Ga0496102_0777211
1344 Ga0496103_0225730
1345 Ga0496104_0004279
1346 Ga0496104_0015801
1347 Ga0496104_0084357
1348 Ga0496104_0204633
1349 Ga0496104_0423373
1350 Ga0496104_0494882
1351 Ga0496105_0019440
1352 Ga0496105_0073498
1353 Ga0496105_0159604
1354 Ga0496105_0245921
1355 Ga0496105_0275934
1356 Ga0496106_0007768
1357 Ga0496107_0007548
1358 Ga0496107_0047941
1359 Ga0496107_0518502
1360 Ga0496108_0013673
1361 Ga0496108_0077933
1362 Ga0496109_0001145
1363 Ga0496109_0010240
1364 Ga0496109_0077153
1365 Ga0496109_0800916
1366 Ga0496110_0001744
1367 Ga0496110_0023424
1368 Ga0496110_0079958
1369 Ga0496110_0139885
1370 Ga0496110_0215589
1371 Ga0496111_0013141
1372 Ga0496111_0016513
1373 Ga0496111_0155661
1374 Ga0496112_0004490
1375 Ga0496112_0063475
1376 Ga0496112_0353323
1377 Ga0496112_1005842
1378 Ga0496113_0002392
1379 Ga0496113_0072540
1380 Ga0496113_0297487
1381 Ga0496113_0368787
1382 Ga0496113_0846130
1383 Ga0496114_0068840
1384 Ga0496114_0205697
1385 Ga0496115_0010887
1386 Ga0496115_0016315
1387 Ga0496115_0101317
1388 Ga0496115_0111409
1389 Ga0496115_0149497
1390 Ga0501032_0010965
1391 Ga0501033_0102386
1392 Ga0501033_0127805
1393 Ga0501034_0207451
1394 Ga0501034_0207804
1395 Ga0501034_0478446
1396 Ga0501034_0553270
1397 Ga0501036_0003162
1398 Ga0501037_0003374
1399 Ga0501037_0217923
1400 Ga0501038_0030351
1401 Ga0501038_0063888
1402 Ga0501038_0873428
1403 Ga0501039_0092788
1404 Ga0501039_0364230
1405 Ga0501040_0159296
1406 Ga0501041_0378772
1407 Ga0501041_0870265
1408 Ga0501042_0363562
1409 Ga0501043_0124034
1410 Ga0501046_0020638
1411 Ga0501047_0094867
1412 Ga0501047_0261410
1413 Ga0501067_0255934
1414 Ga0501068_0105376
1415 Ga0501068_0122752
1416 Ga0501068_0328847
1417 Ga0501069_0354833
1418 Ga0501070_0030621
1419 Ga0501071_0070374
1420 Ga0501071_0073175
1421 Ga0501071_0377502
1422 Ga0501072_0010550
1423 Ga0501073_0199885
1424 Ga0501073_0222961
1425 Ga0501075_0004617
1426 Ga0501076_0128580
1427 Ga0501079_0125759
1428 Ga0501079_0321855
1429 Ga0501080_0062015
1430 Ga0501080_0103031
1431 Ga0501080_0208790
1432 Ga0501080_0241732
1433 Ga0501080_0732349
1434 Ga0501081_0154600
1435 Ga0501081_0531355
1436 Ga0501083_0156289
1437 Ga0501044_0000122
1438 Ga0501044_0095677
1439 Ga0501045_0019673
1440 Ga0501045_0094555
1441 nmdc:mga03683_12022_c1
1442 nmdc:mga03683_146665_c1
1443 nmdc:mga03n38_53075_c1
1444 nmdc:mga03n38_96857_c1
1445 nmdc:mga0yw44_149191_c1
1446 nmdc:mga0yw44_3399_c1
1447 nmdc:mga0k408_297796_c1
1448 nmdc:mga0k408_52251_c1
1449 nmdc:mga06z11_13418_c1
1450 nmdc:mga06z11_254806_c1
1451 nmdc:mga06z11_498137_c1
1452 nmdc:mga07m45_193801_c1
1453 nmdc:mga07m45_38547_c1
1454 nmdc:mga07m45_418324_c1
1455 nmdc:mga05p37_12909_c1
1456 nmdc:mga05p37_151746_c1
1457 nmdc:mga05p37_175149_c1
1458 nmdc:mga05p37_31974_c1
1459 nmdc:mga05p37_33708_c1
1460 nmdc:mga05p37_450513_c1
1461 nmdc:mga05p37_507078_c1
1462 nmdc:mga09592_75462_c1
1463 nmdc:mga09592_90407_c1
1464 nmdc:mga09592_925352_c1
1465 nmdc:mga0qj67_20517_c1
1466 nmdc:mga0qj67_263854_c1
1467 nmdc:mga0qj67_392795_c1
1468 nmdc:mga0qj67_620882_c1
1469 nmdc:mga06r32_176956_c1
1470 nmdc:mga06r32_514224_c1
1471 nmdc:mga06r32_74594_c1
1472 nmdc:mga08y16_132162_c1
1473 nmdc:mga08y16_296117_c1
1474 nmdc:mga08y16_562981_c1
1475 nmdc:mga08y16_723880_c1
1476 nmdc:mga08y16_845400_c1
1477 nmdc:mga0n895_104195_c1
1478 nmdc:mga0n895_149888_c1
1479 nmdc:mga0n895_270694_c1
1480 nmdc:mga0n895_328306_c1
1481 nmdc:mga0n895_651787_c1
1482 nmdc:mga0n895_74700_c1
1483 nmdc:mga0n895_91745_c1
1484 nmdc:mga0n895_928482_c1
1485 nmdc:mga0rr50_234225_c1
1486 nmdc:mga0rr50_284091_c1
1487 nmdc:mga0rr50_450707_c1
1488 nmdc:mga08x19_77320_c1
1489 nmdc:mga0a205_126617_c1
1490 nmdc:mga0a205_385263_c1
1491 nmdc:mga0a205_91847_c1
1492 Ga0495601_0009511
1493 Ga0495601_0027228
1494 Ga0495601_0048456
1495 Ga0495612_0000688
1496 Ga0495612_0094632
1497 Ga0495612_0232320
1498 Ga0495655_0044200
1499 Ga0495595_0130778
1500 Ga0495595_0166644
1501 Ga0495619_0002604
1502 Ga0495619_0039880
1503 Ga0495619_0673859
1504 Ga0500595_004617
1505 Ga0500568_0050296
1506 Ga0500616_0063017
1507 Ga0501084_0040389
1508 Ga0501084_0168658
1509 Ga0501082_0544285
1510 Ga0530510_0029177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02041

Auxin_BP

Auxin binding protein

60

204

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8691 61 164
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8413 74 164
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8304 76 164
7zyb-assembly1.cif.gz_A bekdgf with ca 0.818 43 170
4cco-assembly1.cif.gz_A-2 60s ribosomal protein l8 histidine hydroxylase (no66 s373c) in complex with mn(ii), n-oxalylglycine (nog) and 60s ribosomal protein l8 (rpl8 g214c) peptide fragment (complex-3) 0.8026 76 164
ID Description Score Start End Superfamily
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9043 76 164 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8615 76 163 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.861 63 164 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8602 76 164 2.60.120.10
af_P42624_134_233_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8418 76 164 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2E7PNM6-F1-model_v4 Cupin 0.9353 51 186
AF-A0A2E3ZNX8-F1-model_v4 Cupin 0.9212 51 188 GO:0009734
GO:0010011
AF-A0A534UJM7-F1-model_v4 Cupin domain-containing protein 0.9187 38 184
AF-A0A2E7PNM6-F1-model_v4 Cupin 0.9156 51 186
AF-A0A3D9ZUW7-F1-model_v4 Cupin domain 0.8994 37 184

Map