F479282

General Info

Members Datasets Scaffolds Average Seq Length
754 497 1508 417

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057529695|8057529777
Length 443
Sequence VVTGLGMVTPLACGVEPSWSRILAGESGARPITTFDVSDLPAQIACTIPRGDGSNGTFNPDDWMEPKEQRKVDDFIIFAMAAATQALRDSGWKPESYEDQVATGVAIGSGIGGLGGIYEASLLLKERGPRRLSPFFIPGRLSNLAAGYVSIEHGLKGPNHAVVTACSTGAHAIGDAARMVALGDAEVMLAGGAESAVNRIGIAGFCACRALSTGFNETPEKASRPYDKDRDGFVMGEGAGVVVLEELGHAKARGARIYAEVVGYGMSGDAYHITSPSEDGDGAYRCMQAALKRAGLRASDLDYINAHGTSTQVGDEIELRAVERLLANAPTRPAMSSTKSATGHLLGAAGAIEAIFFGAGDPRPDRAADDQSRQPLRRDRARSRAAQGQEAEGRHCPVKLIRFRRNQRLSGDAPLRRLTRSALSPQFSLACRRRRASMRPACH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
73 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
100 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
101 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
158 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
223 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
330 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
331 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
332 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
333 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
334 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
339 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
344 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
345 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
346 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
347 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
348 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
351 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
352 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
353 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
354 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
355 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
356 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
357 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
358 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
359 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
360 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
361 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
362 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
363 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
364 2643221733 Bosea sp. Root381 Isolate Unclassified
365 2643221734 Bosea sp. Root670 Isolate Unclassified
366 2643221736 Bosea sp. Root483D1 Isolate Unclassified
367 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
368 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
369 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
370 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
371 2791355199
372 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
373 2818991467 Bosea vestrisii 3192 Isolate Unclassified
374 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
375 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
376 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
377 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
378 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
379 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
380 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
381 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
382 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
383 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
384 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
385 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
386 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
387 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
388 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
389 2841760612 Bosea sp. Tri-49 Isolate Nodule
390 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
391 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
392 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
393 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
394 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
395 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
396 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
397 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
398 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
399 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
400 2844104063 Bosea sp. Tri-39 Isolate Nodule
401 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
402 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
403 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
404 2851182111 Bosea sp. Tri-44 Isolate Nodule
405 2851246043 Bosea sp. Tri-54 Isolate Nodule
406 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
407 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
408 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
409 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
410 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
411 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
412 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
413 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
414 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
415 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
416 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
417 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
418 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
419 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
420 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
421 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
422 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
423 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
424 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
425 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
426 2922368715
427 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
428 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
429 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
430 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
431 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
432 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
433 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
434 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
435 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
436 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
437 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
438 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
439 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
440 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
441 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
442 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
443 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
444 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
445 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
446 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
447 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
448 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
449 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
450 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
451 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
452 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
453 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
454 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
455 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
456 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
457 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
458 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
459 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
460 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
461 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
462 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
463 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
464 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
465 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
466 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
467 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
468 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
469 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
470 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
471 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
472 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
473 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
474 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
475 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
476 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
477 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
478 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
479 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
480 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
481 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
482 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
483 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
484 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
485 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
486 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
487 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
488 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
489 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
490 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
491 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
492 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
493 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
494 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
495 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
496 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
497 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.19
Metatranscriptomes 0.53
Isolates 19.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.29
Nodule 15.25
Rhizoplane 8.49
Rhizosphere 59.02
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013233 3300001979 Bacteria 3086
2 JGI24737J22298_10008734 3300001990 Bacteria 3383
3 JGI24735J21928_10014231 3300002067 Bacteria 2493
4 JGI25151J46595_10000136 3300003187 Bacteria 97150
5 JGI25151J46595_10000217 3300003187 Bacteria 68708
6 Ga0055526_1000896 3300003771 Bacteria 22165
7 Ga0055526_1000904 3300003771 Bacteria 22053
8 Ga0055524_1000078 3300003775 Bacteria 120745
9 Ga0055543_1004114 3300004625 Bacteria 4056
10 Ga0058859_11782272 3300004798 Bacteria 2819
11 Ga0058860_12209077 3300004801 Bacteria 1691
12 Ga0065165_1000072 3300005262 Bacteria 165049
13 Ga0065165_1002278 3300005262 Bacteria 16922
14 Ga0065712_10000361 3300005290 Bacteria 28271
15 Ga0065715_10000318 3300005293 Bacteria 15195
16 Ga0070676_10024166 3300005328 Bacteria 3421
17 Ga0070676_10052658 3300005328 Bacteria 2394
18 Ga0070676_10112763 3300005328 Bacteria 1695
19 Ga0070670_100013797 3300005331 Bacteria 6925
20 Ga0068869_100163677 3300005334 Bacteria 1733
21 Ga0070680_100116556 3300005336 Bacteria 2227
22 Ga0070680_100270185 3300005336 Bacteria 1439
23 Ga0068868_100030944 3300005338 Bacteria 4106
24 Ga0070689_100139626 3300005340 Bacteria 1948
25 Ga0070687_100054905 3300005343 Bacteria 2077
26 Ga0070671_100007858 3300005355 Bacteria 8527
27 Ga0070674_100082407 3300005356 Bacteria 2301
28 Ga0070673_100258065 3300005364 Bacteria 1522
29 Ga0070667_100081780 3300005367 Bacteria 2764
30 Ga0070703_10009308 3300005406 Bacteria 2772
31 Ga0070709_10000348 3300005434 Bacteria 28698
32 Ga0070709_10013740 3300005434 Bacteria 4559
33 Ga0070714_100000490 3300005435 Bacteria 28629
34 Ga0070714_100008940 3300005435 Bacteria 7838
35 Ga0070714_100067032 3300005435 Bacteria 3094
36 Ga0070713_100000278 3300005436 Bacteria 33610
37 Ga0070710_10001018 3300005437 Bacteria 13295
38 Ga0070710_10003676 3300005437 Bacteria 7254
39 Ga0070711_100003976 3300005439 Bacteria 8689
40 Ga0070711_100017385 3300005439 Bacteria 4577
41 Ga0070711_100104917 3300005439 Bacteria 2063
42 Ga0070705_100056890 3300005440 Bacteria 2305
43 Ga0070694_100007125 3300005444 Bacteria 6807
44 Ga0070663_100040237 3300005455 Bacteria 3271
45 Ga0070663_100047985 3300005455 Bacteria 3026
46 Ga0070678_100057626 3300005456 Bacteria 2847
47 Ga0070662_100060596 3300005457 Unclassified 2760
48 Ga0070662_100125746 3300005457 Bacteria 1970
49 Ga0070681_10040909 3300005458 Bacteria 4644
50 Ga0068867_100046303 3300005459 Bacteria 3194
51 Ga0070697_100000080 3300005536 Bacteria 77671
52 Ga0070697_100194476 3300005536 Bacteria 1722
53 Ga0068853_100169717 3300005539 Bacteria 1973
54 Ga0068853_100174501 3300005539 Bacteria 1946
55 Ga0068853_100218047 3300005539 Bacteria 1741
56 Ga0068853_100272856 3300005539 Bacteria 1558
57 Ga0070696_100053539 3300005546 Bacteria 2809
58 Ga0070665_100050963 3300005548 Bacteria 4153
59 Ga0070665_100100174 3300005548 Bacteria 2901
60 Ga0070665_100119517 3300005548 Bacteria 2637
61 Ga0070665_100150908 3300005548 Bacteria 2327
62 Ga0070704_100008118 3300005549 Bacteria 6276
63 Ga0068855_100019340 3300005563 Bacteria 8183
64 Ga0068855_100042552 3300005563 Bacteria 5381
65 Ga0068855_100144104 3300005563 Bacteria 2713
66 Ga0068855_100266977 3300005563 Bacteria 1904
67 Ga0070664_100169249 3300005564 Bacteria 1938
68 Ga0068857_100075965 3300005577 Bacteria 2995
69 Ga0068857_100182935 3300005577 Bacteria 1907
70 Ga0068854_100125445 3300005578 Bacteria 1954
71 Ga0068854_100126712 3300005578 Bacteria 1945
72 Ga0068856_100152498 3300005614 Bacteria 2320
73 Ga0068856_100230315 3300005614 Bacteria 1868
74 Ga0068852_100089766 3300005616 Bacteria 2747
75 Ga0068866_10040218 3300005718 Bacteria 2313
76 Ga0068851_10004835 3300005834 Bacteria 6095
77 Ga0068858_100028222 3300005842 Bacteria 5214
78 Ga0068858_100245500 3300005842 Bacteria 1700
79 Ga0068860_100026198 3300005843 Bacteria 5622
80 Ga0081455_10008528 3300005937 Bacteria 10640
81 Ga0081455_10008869 3300005937 Bacteria 10399
82 Ga0081540_1004841 3300005983 Bacteria 10144
83 Ga0081540_1005905 3300005983 Bacteria 9036
84 Ga0081540_1009855 3300005983 Bacteria 6531
85 Ga0081539_10000597 3300005985 Bacteria 73805
86 Ga0081539_10000735 3300005985 Bacteria 65597
87 Ga0081539_10013306 3300005985 Bacteria 6210
88 Ga0081539_10033563 3300005985 Bacteria 3122
89 Ga0070717_10000297 3300006028 Bacteria 33338
90 Ga0070717_10036246 3300006028 Bacteria 3999
91 Ga0075365_10142987 3300006038 Bacteria 1661
92 Ga0075363_100016047 3300006048 Bacteria 3694
93 Ga0075363_100041613 3300006048 Bacteria 2424
94 Ga0070715_10005158 3300006163 Bacteria 4339
95 Ga0070716_100001393 3300006173 Bacteria 10721
96 Ga0070716_100045273 3300006173 Bacteria 2469
97 Ga0070712_100005370 3300006175 Bacteria 7935
98 Ga0070712_100006220 3300006175 Bacteria 7388
99 Ga0070712_100010554 3300006175 Bacteria 5832
100 Ga0070712_100011725 3300006175 Bacteria 5568
101 Ga0070712_100058839 3300006175 Bacteria 2704
102 Ga0075362_10001513 3300006177 Bacteria 7478
103 Ga0075367_10110137 3300006178 Bacteria 1689
104 Ga0075366_10011078 3300006195 Bacteria 5080
105 Ga0097621_100122698 3300006237 Bacteria 2205
106 Ga0075370_10099694 3300006353 Bacteria 1680
107 Ga0068871_100029523 3300006358 Bacteria 4307
108 Ga0075431_100007067 3300006847 Bacteria 11151
109 Ga0075431_100010451 3300006847 Bacteria 9333
110 Ga0075433_10079274 3300006852 Bacteria 2894
111 Ga0075434_100018441 3300006871 Bacteria 6743
112 Ga0075434_100046859 3300006871 Bacteria 4289
113 Ga0075429_100044375 3300006880 Bacteria 3867
114 Ga0068865_100028670 3300006881 Bacteria 3687
115 Ga0099825_1029851 3300006941 Bacteria 2481
116 Ga0099824_1025839 3300006942 Bacteria 3139
117 Ga0075435_100000827 3300007076 Bacteria 19283
118 Ga0075435_100032914 3300007076 Bacteria 4097
119 Ga0099795_10000521 3300007788 Bacteria 7219
120 Ga0099795_10001501 3300007788 Bacteria 5093
121 Ga0105240_10005341 3300009093 Bacteria 19162
122 Ga0105240_10012605 3300009093 Bacteria 11658
123 Ga0105240_10164491 3300009093 Bacteria 2632
124 Ga0105240_10187496 3300009093 Bacteria 2435
125 Ga0111539_10052427 3300009094 Bacteria 4856
126 Ga0105245_10165592 3300009098 Bacteria 2101
127 Ga0105245_10217310 3300009098 Bacteria 1842
128 Ga0114129_10017485 3300009147 Bacteria 10210
129 Ga0114129_10611758 3300009147 Bacteria 1410
130 Ga0105243_10017871 3300009148 Bacteria 5365
131 Ga0105241_10077937 3300009174 Bacteria 2588
132 Ga0105241_10161752 3300009174 Bacteria 1841
133 Ga0105248_10072817 3300009177 Bacteria 3862
134 Ga0105237_10023811 3300009545 Bacteria 6268
135 Ga0105237_10215828 3300009545 Bacteria 1918
136 Ga0105238_10064921 3300009551 Bacteria 3651
137 Ga0105238_10259151 3300009551 Bacteria 1718
138 Ga0105249_10350717 3300009553 Bacteria 1495
139 Ga0099796_10000086 3300010159 Bacteria 15528
140 Ga0105239_10002676 3300010375 Bacteria 22436
141 Ga0105239_10048001 3300010375 Bacteria 4680
142 Ga0105239_10059881 3300010375 Bacteria 4178
143 Ga0105239_10147202 3300010375 Bacteria 2628
144 Ga0105246_10017870 3300011119 Bacteria 4512
145 Ga0105246_10129020 3300011119 Bacteria 1885
146 Ga0157370_10062573 3300013104 Bacteria 3528
147 Ga0171462_1037 3300013250 Bacteria 78452
148 Ga0157374_10010944 3300013296 Bacteria 7832
149 Ga0157374_10013272 3300013296 Bacteria 7188
150 Ga0157374_10105256 3300013296 Bacteria 2709
151 Ga0157378_10006214 3300013297 Bacteria 10456
152 Ga0157372_10240915 3300013307 Bacteria 2099
153 Ga0157375_10178475 3300013308 Bacteria 2275
154 Ga0157375_10312234 3300013308 Bacteria 1736
155 Ga0163163_10006000 3300014325 Bacteria 10568
156 Ga0163163_10040601 3300014325 Bacteria 4544
157 Ga0163163_10246906 3300014325 Bacteria 1835
158 Ga0163163_10325423 3300014325 Bacteria 1591
159 Ga0157380_10075964 3300014326 Bacteria 2732
160 Ga0197907_11280375 3300020069 Bacteria 3083
161 Ga0206350_10193835 3300020080 Bacteria 1867
162 Ga0214544_1000002 3300021320 Bacteria 753857
163 Ga0214542_1000001 3300021321 Bacteria 1018696
164 Ga0214545_1000001 3300021324 Bacteria 1092817
165 Ga0214543_1000001 3300021327 Bacteria 776921
166 Ga0213876_10001215 3300021384 Bacteria 16252
167 Ga0228598_1000979 3300024227 Bacteria 6226
168 Ga0209130_1000125 3300025284 Bacteria 124425
169 Ga0209675_1001197 3300025291 Bacteria 15731
170 Ga0209025_1000014 3300025294 Bacteria 865448
171 Ga0209025_1001183 3300025294 Bacteria 36933
172 Ga0209564_1000105 3300025295 Bacteria 218124
173 Ga0209564_1000179 3300025295 Bacteria 151032
174 Ga0209758_1002544 3300025297 Bacteria 18390
175 Ga0209256_1000055 3300025299 Bacteria 295530
176 Ga0209257_1017751 3300025304 Bacteria 2784
177 Ga0207697_10012580 3300025315 Bacteria 3545
178 Ga0207692_10000116 3300025898 Bacteria 23998
179 Ga0207692_10001592 3300025898 Bacteria 8547
180 Ga0207692_10074954 3300025898 Bacteria 1794
181 Ga0207642_10023479 3300025899 Bacteria 2464
182 Ga0207710_10007078 3300025900 Bacteria 4761
183 Ga0207710_10011722 3300025900 Bacteria 3687
184 Ga0207688_10115569 3300025901 Bacteria 1561
185 Ga0207647_10011073 3300025904 Bacteria 6339
186 Ga0207685_10002629 3300025905 Bacteria 4168
187 Ga0207699_10007380 3300025906 Bacteria 5377
188 Ga0207699_10009773 3300025906 Bacteria 4791
189 Ga0207699_10148625 3300025906 Bacteria 1548
190 Ga0207645_10076135 3300025907 Bacteria 2148
191 Ga0207684_10058004 3300025910 Bacteria 3285
192 Ga0207654_10000308 3300025911 Bacteria 29561
193 Ga0207654_10008665 3300025911 Bacteria 5155
194 Ga0207654_10091644 3300025911 Bacteria 1854
195 Ga0207707_10034699 3300025912 Bacteria 4413
196 Ga0207707_10060434 3300025912 Bacteria 3297
197 Ga0207695_10001719 3300025913 Bacteria 35011
198 Ga0207695_10001812 3300025913 Bacteria 33654
199 Ga0207695_10015101 3300025913 Bacteria 9111
200 Ga0207695_10141323 3300025913 Bacteria 2355
201 Ga0207695_10277579 3300025913 Bacteria 1570
202 Ga0207671_10008038 3300025914 Bacteria 9019
203 Ga0207671_10026027 3300025914 Bacteria 4388
204 Ga0207671_10043689 3300025914 Bacteria 3314
205 Ga0207693_10000936 3300025915 Bacteria 26200
206 Ga0207693_10015310 3300025915 Bacteria 6155
207 Ga0207693_10055385 3300025915 Bacteria 3111
208 Ga0207693_10089262 3300025915 Bacteria 2416
209 Ga0207693_10097802 3300025915 Bacteria 2302
210 Ga0207663_10001209 3300025916 Bacteria 11925
211 Ga0207663_10004152 3300025916 Bacteria 7169
212 Ga0207660_10098393 3300025917 Bacteria 2182
213 Ga0207657_10121768 3300025919 Bacteria 2146
214 Ga0207652_10011414 3300025921 Bacteria 7162
215 Ga0207652_10053499 3300025921 Bacteria 3468
216 Ga0207694_10000157 3300025924 Bacteria 70076
217 Ga0207694_10070529 3300025924 Bacteria 2730
218 Ga0207694_10137111 3300025924 Bacteria 1966
219 Ga0207694_10175526 3300025924 Bacteria 1736
220 Ga0207650_10005423 3300025925 Bacteria 8704
221 Ga0207687_10135380 3300025927 Bacteria 1863
222 Ga0207700_10000380 3300025928 Bacteria 25773
223 Ga0207700_10034366 3300025928 Bacteria 3639
224 Ga0207700_10058979 3300025928 Bacteria 2901
225 Ga0207664_10003152 3300025929 Bacteria 10955
226 Ga0207664_10008858 3300025929 Bacteria 7040
227 Ga0207644_10113219 3300025931 Bacteria 2054
228 Ga0207706_10171579 3300025933 Bacteria 1906
229 Ga0207709_10003187 3300025935 Bacteria 9854
230 Ga0207669_10025941 3300025937 Bacteria 3178
231 Ga0207669_10077289 3300025937 Bacteria 2116
232 Ga0207665_10001402 3300025939 Bacteria 16207
233 Ga0207665_10035413 3300025939 Bacteria 3314
234 Ga0207711_10058835 3300025941 Bacteria 3309
235 Ga0207667_10008116 3300025949 Bacteria 12512
236 Ga0207667_10092805 3300025949 Bacteria 3118
237 Ga0207667_10151627 3300025949 Bacteria 2385
238 Ga0207667_10229954 3300025949 Bacteria 1899
239 Ga0207651_10003242 3300025960 Bacteria 7964
240 Ga0207640_10060288 3300025981 Bacteria 2507
241 Ga0207677_10063534 3300026023 Bacteria 2567
242 Ga0207677_10093801 3300026023 Bacteria 2189
243 Ga0207703_10077402 3300026035 Bacteria 2761
244 Ga0207703_10096486 3300026035 Bacteria 2496
245 Ga0207703_10170351 3300026035 Bacteria 1915
246 Ga0207639_10010722 3300026041 Bacteria 6347
247 Ga0207678_10077767 3300026067 Bacteria 2842
248 Ga0207678_10171583 3300026067 Bacteria 1852
249 Ga0207678_10227417 3300026067 Bacteria 1597
250 Ga0207708_10032968 3300026075 Bacteria 3933
251 Ga0207702_10000002 3300026078 Bacteria 491507
252 Ga0207702_10009353 3300026078 Bacteria 8233
253 Ga0207702_10026824 3300026078 Bacteria 4784
254 Ga0207648_10066627 3300026089 Bacteria 3140
255 Ga0207676_10146220 3300026095 Bacteria 2030
256 Ga0207676_10153198 3300026095 Bacteria 1988
257 Ga0207674_10009623 3300026116 Bacteria 11024
258 Ga0207674_10075571 3300026116 Bacteria 3378
259 Ga0207674_10274519 3300026116 Bacteria 1633
260 Ga0207675_100011052 3300026118 Bacteria 8456
261 Ga0207675_100021910 3300026118 Bacteria 5949
262 Ga0207675_100241457 3300026118 Bacteria 1746
263 Ga0207683_10190253 3300026121 Bacteria 1863
264 Ga0209389_1000008 3300027296 Bacteria 227385
265 Ga0209389_1000292 3300027296 Bacteria 31202
266 Ga0209589_1001423 3300027357 Bacteria 39445
267 Ga0209489_100096 3300027361 Bacteria 122075
268 Ga0209489_100333 3300027361 Bacteria 82975
269 Ga0209700_100062 3300027363 Bacteria 145471
270 Ga0209179_1001675 3300027512 Bacteria 2801
271 Ga0209968_1007374 3300027526 Bacteria 1664
272 Ga0209971_1002819 3300027682 Bacteria 4152
273 Ga0209974_10006149 3300027876 Bacteria 4206
274 Ga0207428_10048166 3300027907 Bacteria 3420
275 Ga0268266_10008946 3300028379 Bacteria 8862
276 Ga0268266_10029812 3300028379 Bacteria 4635
277 Ga0268266_10117217 3300028379 Bacteria 2366
278 Ga0268266_10178603 3300028379 Bacteria 1931
279 Ga0268266_10271922 3300028379 Bacteria 1573
280 Ga0268264_10359309 3300028381 Bacteria 1389
281 Ga0265340_10003545 3300031247 Bacteria 8783
282 Ga0265331_10003122 3300031250 Bacteria 10827
283 Ga0265327_10005683 3300031251 Bacteria 10314
284 Ga0265316_10016635 3300031344 Bacteria 6375
285 Ga0265342_10035774 3300031712 Bacteria 3036
286 Ga0307406_10065258 3300031901 Bacteria 2365
287 Ga0307406_10203175 3300031901 Bacteria 1460
288 Ga0307411_10236984 3300032005 Bacteria 1426
289 Ga0307510_10069887 3300033180 Bacteria 3512
290 Ga0373923_0023152 3300035111 Bacteria 2442
291 Ga0373936_0022889 3300035113 Bacteria 2433
292 Ga0373945_0003120 3300035116 Bacteria 5203
293 Ga0373945_0034614 3300035116 Bacteria 1801
294 Ga0373953_0001976 3300035117 Bacteria 6102
295 Ga0373954_0000070 3300035118 Bacteria 36271
296 Ga0373956_0001764 3300035119 Bacteria 8915
297 Ga0373957_0002936 3300035120 Bacteria 4940
298 Ga0373955_0000771 3300035172 Bacteria 13748
299 Ga0373924_0005902 3300035410 Bacteria 4365
300 Ga0373924_0007507 3300035410 Bacteria 3939
301 Ga0373931_0029484 3300035691 Bacteria 2817
302 Ga0373935_0068712 3300035692 Bacteria 2280
303 Ga0373927_0025168 3300035695 Bacteria 3891
304 Ga0373933_0006540 3300035724 Bacteria 6349
305 Ga0373947_0001951 3300035725 Bacteria 12629
306 Ga0373947_0035703 3300035725 Bacteria 2944
307 Ga0373947_0057404 3300035725 Bacteria 2355
308 Ga0373937_0034207 3300036401 Bacteria 4622
309 Ga0373925_0000183 3300037068 Bacteria 68921
310 Ga0373925_0056552 3300037068 Bacteria 2939
311 Ga0395905_0089264 3300037471 Bacteria 2889
312 Ga0436364_0351634 3300037853 Bacteria 1494
313 Ga0436364_0617696 3300037853 Bacteria 3167
314 Ga0436365_0389941 3300039437 Bacteria 2445
315 Ga0436365_0903497 3300039437 Bacteria 4459
316 Ga0436365_1136865 3300039437 Bacteria 22786
317 Ga0436365_1625412 3300039437 Bacteria 5828
318 Ga0436365_1781597 3300039437 Bacteria 4648
319 Ga0436360_0689838 3300039438 Bacteria 1882
320 Ga0436360_1287647 3300039438 Bacteria 2821
321 Ga0436363_0716857 3300039450 Bacteria 1750
322 Ga0436363_0801798 3300039450 Bacteria 3203
323 Ga0436362_0188545 3300039453 Bacteria 4150
324 Ga0451577_0113078 3300042876 Bacteria 2430
325 Ga0466969_0025258 3300044656 Bacteria 3056
326 Ga0466972_0005717 3300044658 Bacteria 6232
327 Ga0466966_0013591 3300044684 Bacteria 5385
328 Ga0466963_0002381 3300044694 Bacteria 10510
329 Ga0466963_0237853 3300044694 Bacteria 1277
330 Ga0466971_0032723 3300044719 Bacteria 2330
331 Ga0466968_0024730 3300044735 Bacteria 2456
332 Ga0466960_0008985 3300044901 Bacteria 4107
333 Ga0466959_0002189 3300045049 Bacteria 12429
334 Ga0451576_0214044 3300045051 Bacteria 2012
335 Ga0466958_0036218 3300045836 Bacteria 2953
336 Ga0466967_0080868 3300045976 Bacteria 2934
337 Ga0495592_0022090 3300046454 Bacteria 4840
338 Ga0495592_0106036 3300046454 Bacteria 1995
339 Ga0495603_0017433 3300046455 Bacteria 4345
340 Ga0495603_0116667 3300046455 Bacteria 1556
341 Ga0495629_0000005 3300046459 Bacteria 404868
342 Ga0495629_0002263 3300046459 Bacteria 14836
343 Ga0495629_0006304 3300046459 Bacteria 8802
344 Ga0495629_0136933 3300046459 Bacteria 1704
345 Ga0495629_0152292 3300046459 Bacteria 1607
346 Ga0495638_0063568 3300046460 Bacteria 2275
347 Ga0495641_0037933 3300046461 Bacteria 2254
348 Ga0495651_0001805 3300046462 Bacteria 16510
349 Ga0495651_0039119 3300046462 Bacteria 3692
350 Ga0495651_0110241 3300046462 Bacteria 2036
351 Ga0495653_0003677 3300046463 Bacteria 12388
352 Ga0495653_0047853 3300046463 Bacteria 3305
353 Ga0495653_0147798 3300046463 Bacteria 1645
354 Ga0495580_0026326 3300046472 Bacteria 4242
355 Ga0495639_0000842 3300046475 Bacteria 13990
356 Ga0495662_0001038 3300046476 Bacteria 13621
357 Ga0495664_0000168 3300046477 Bacteria 31977
358 Ga0495664_0025332 3300046477 Bacteria 3453
359 Ga0495664_0046258 3300046477 Bacteria 2582
360 Ga0495584_0072545 3300046491 Bacteria 1730
361 Ga0495594_0077008 3300046499 Bacteria 1860
362 Ga0495596_0049332 3300046500 Bacteria 1650
363 Ga0495607_0049959 3300046501 Bacteria 2437
364 Ga0495608_0001870 3300046511 Bacteria 15052
365 Ga0495608_0006442 3300046511 Bacteria 8335
366 Ga0495608_0152486 3300046511 Bacteria 1472
367 Ga0495610_0027626 3300046512 Bacteria 3013
368 Ga0495618_0017854 3300046514 Bacteria 4353
369 Ga0495628_0002643 3300046516 Bacteria 16072
370 Ga0495628_0013414 3300046516 Bacteria 6893
371 Ga0495643_0009568 3300046522 Bacteria 6015
372 Ga0495643_0025025 3300046522 Bacteria 3381
373 Ga0495644_0055063 3300046523 Bacteria 1494
374 Ga0495663_0011517 3300046525 Bacteria 2460
375 Ga0495666_0000024 3300046526 Bacteria 57339
376 Ga0495652_0031409 3300046529 Bacteria 4651
377 Ga0495652_0089619 3300046529 Bacteria 2518
378 Ga0495640_0002929 3300046533 Bacteria 13739
379 Ga0495640_0095851 3300046533 Bacteria 1952
380 Ga0495586_0001169 3300046535 Bacteria 14718
381 Ga0495586_0048074 3300046535 Bacteria 2304
382 Ga0495587_0001351 3300046536 Bacteria 16275
383 Ga0495587_0008371 3300046536 Bacteria 6655
384 Ga0495621_0013236 3300046539 Bacteria 2588
385 Ga0495645_0003263 3300046543 Bacteria 11010
386 Ga0495645_0008453 3300046543 Bacteria 7190
387 Ga0495645_0016949 3300046543 Bacteria 5213
388 Ga0495645_0024685 3300046543 Bacteria 4362
389 Ga0495622_0011772 3300046557 Bacteria 4044
390 Ga0495667_0000926 3300046559 Bacteria 18989
391 Ga0495667_0028061 3300046559 Bacteria 3790
392 Ga0495667_0131178 3300046559 Bacteria 1616
393 Ga0495656_0020832 3300046615 Bacteria 2547
394 Ga0495634_0003658 3300046642 Bacteria 12265
395 Ga0495634_0007605 3300046642 Bacteria 8118
396 Ga0495634_0008514 3300046642 Bacteria 7627
397 Ga0495634_0061030 3300046642 Bacteria 2508
398 Ga0495635_0004011 3300046663 Bacteria 10224
399 Ga0495635_0004483 3300046663 Bacteria 9674
400 Ga0495635_0058336 3300046663 Bacteria 2655
401 Ga0495588_0030709 3300046674 Bacteria 2702
402 Ga0495657_0001016 3300046675 Bacteria 24742
403 Ga0495657_0052531 3300046675 Bacteria 2731
404 Ga0495599_0000637 3300046678 Bacteria 19794
405 Ga0495623_0003015 3300046679 Bacteria 11083
406 Ga0495623_0005023 3300046679 Bacteria 8674
407 Ga0495623_0096301 3300046679 Bacteria 1808
408 Ga0495646_0001926 3300046680 Bacteria 12482
409 Ga0495646_0033730 3300046680 Bacteria 3182
410 Ga0495646_0079815 3300046680 Bacteria 1909
411 Ga0495647_0013552 3300046681 Bacteria 2827
412 Ga0495613_0074181 3300046689 Bacteria 2478
413 Ga0495600_0002398 3300046809 Bacteria 10736
414 Ga0495581_0007505 3300047315 Bacteria 6307
415 Ga0495604_0013258 3300047317 Bacteria 6565
416 Ga0495604_0032291 3300047317 Bacteria 4151
417 Ga0495604_0034842 3300047317 Bacteria 3979
418 Ga0495674_0000138 3300047319 Bacteria 55916
419 Ga0495674_0011842 3300047319 Bacteria 8222
420 Ga0495672_0000437 3300047320 Bacteria 49739
421 Ga0495672_0049705 3300047320 Bacteria 2480
422 Ga0495676_0001542 3300047321 Bacteria 19955
423 Ga0495676_0036897 3300047321 Bacteria 4076
424 Ga0495676_0049376 3300047321 Bacteria 3384
425 Ga0495680_0004188 3300047322 Bacteria 13854
426 Ga0495680_0013222 3300047322 Bacteria 7211
427 Ga0495680_0015409 3300047322 Bacteria 6597
428 Ga0495683_0072960 3300047323 Bacteria 1684
429 Ga0495687_005957 3300047443 Bacteria 7606
430 Ga0495675_0001543 3300047444 Bacteria 13904
431 Ga0495675_0035239 3300047444 Bacteria 3197
432 Ga0495677_0017922 3300047445 Bacteria 2567
433 Ga0495673_0019085 3300047469 Bacteria 3442
434 Ga0495684_0000380 3300047471 Bacteria 36351
435 Ga0495593_0001866 3300047673 Bacteria 12550
436 Ga0495593_0075992 3300047673 Bacteria 1741
437 Ga0495602_0010536 3300048088 Bacteria 9594
438 Ga0495602_0053726 3300048088 Bacteria 3564
439 Ga0495614_0034246 3300048089 Bacteria 2184
440 Ga0496100_0020098 3300048903 Bacteria 3998
441 Ga0496100_0048366 3300048903 Bacteria 2745
442 Ga0496100_0113210 3300048903 Bacteria 1888
443 Ga0496101_0130235 3300048904 Bacteria 1910
444 Ga0496102_0003736 3300048905 Bacteria 12868
445 Ga0496102_0032222 3300048905 Bacteria 4709
446 Ga0496102_0225135 3300048905 Bacteria 1768
447 Ga0496102_0229928 3300048905 Bacteria 1748
448 Ga0496102_0242557 3300048905 Bacteria 1699
449 Ga0496103_0002281 3300048906 Bacteria 12123
450 Ga0496103_0092083 3300048906 Bacteria 1913
451 Ga0496104_0000035 3300048907 Bacteria 181792
452 Ga0496104_0003085 3300048907 Bacteria 14356
453 Ga0496104_0004213 3300048907 Bacteria 12488
454 Ga0496104_0014054 3300048907 Bacteria 7226
455 Ga0496104_0108133 3300048907 Bacteria 2665
456 Ga0496104_0138124 3300048907 Bacteria 2342
457 Ga0496104_0209020 3300048907 Bacteria 1863
458 Ga0496105_0000029 3300048908 Bacteria 139338
459 Ga0496105_0000279 3300048908 Bacteria 33711
460 Ga0496105_0034896 3300048908 Bacteria 4139
461 Ga0496105_0057759 3300048908 Bacteria 3203
462 Ga0496105_0184635 3300048908 Bacteria 1707
463 Ga0496105_0235873 3300048908 Bacteria 1485
464 Ga0496106_0076211 3300048909 Bacteria 2570
465 Ga0496106_0222586 3300048909 Bacteria 1505
466 Ga0496107_0015807 3300048910 Bacteria 5294
467 Ga0496107_0058123 3300048910 Bacteria 2796
468 Ga0496107_0089789 3300048910 Bacteria 2244
469 Ga0496107_0262791 3300048910 Bacteria 1284
470 Ga0496108_0057566 3300048911 Bacteria 3266
471 Ga0496108_0075853 3300048911 Bacteria 2841
472 Ga0496108_0095615 3300048911 Bacteria 2530
473 Ga0496108_0322718 3300048911 Bacteria 1346
474 Ga0496108_0324142 3300048911 Bacteria 1343
475 Ga0496109_0015089 3300048912 Bacteria 6724
476 Ga0496109_0093643 3300048912 Bacteria 2780
477 Ga0496109_0140849 3300048912 Bacteria 2255
478 Ga0496110_0018675 3300048913 Bacteria 5818
479 Ga0496110_0064949 3300048913 Bacteria 3226
480 Ga0496110_0225231 3300048913 Bacteria 1705
481 Ga0496110_0462982 3300048913 Bacteria 1155
482 Ga0496111_0023631 3300048914 Bacteria 4318
483 Ga0496111_0071890 3300048914 Bacteria 2518
484 Ga0496111_0102036 3300048914 Bacteria 2108
485 Ga0496111_0151566 3300048914 Bacteria 1719
486 Ga0496112_0005015 3300048915 Bacteria 11365
487 Ga0496112_0005456 3300048915 Bacteria 11004
488 Ga0496112_0011944 3300048915 Bacteria 7958
489 Ga0496112_0060843 3300048915 Bacteria 3721
490 Ga0496112_0102019 3300048915 Bacteria 2839
491 Ga0496113_0002755 3300048916 Bacteria 10329
492 Ga0496113_0084898 3300048916 Bacteria 2431
493 Ga0496113_0097950 3300048916 Bacteria 2269
494 Ga0496113_0162957 3300048916 Bacteria 1763
495 Ga0496113_0225831 3300048916 Bacteria 1493
496 Ga0496114_0026635 3300048917 Bacteria 4735
497 Ga0496114_0056707 3300048917 Bacteria 3270
498 Ga0496114_0066371 3300048917 Bacteria 3025
499 Ga0496115_0001490 3300048918 Bacteria 16832
500 Ga0496115_0027232 3300048918 Bacteria 4469
501 Ga0496115_0183061 3300048918 Bacteria 1731
502 Ga0496115_0199642 3300048918 Bacteria 1652
503 Ga0496115_0239386 3300048918 Bacteria 1496
504 Ga0496117_0035460 3300048920 Bacteria 3744
505 Ga0496117_0039537 3300048920 Bacteria 3480
506 Ga0496118_0141233 3300048921 Bacteria 1526
507 Ga0496118_0142351 3300048921 Bacteria 1517
508 Ga0496119_0004200 3300048922 Bacteria 14477
509 Ga0496119_0013974 3300048922 Bacteria 6328
510 Ga0496120_0016201 3300048923 Bacteria 4878
511 Ga0496121_0001335 3300048924 Bacteria 42241
512 Ga0496121_0062065 3300048924 Bacteria 3063
513 Ga0496121_0081839 3300048924 Bacteria 2554
514 Ga0496121_0147726 3300048924 Bacteria 1734
515 Ga0496122_0038402 3300048925 Bacteria 3837
516 Ga0496122_0083768 3300048925 Bacteria 2209
517 Ga0496123_0044483 3300048926 Bacteria 3036
518 Ga0496124_0086603 3300048927 Bacteria 2563
519 Ga0496125_0017244 3300048928 Bacteria 6898
520 Ga0496125_0066790 3300048928 Bacteria 2839
521 Ga0496126_0033274 3300048929 Bacteria 4850
522 Ga0496126_0118098 3300048929 Bacteria 2303
523 Ga0496126_0277399 3300048929 Bacteria 1389
524 Ga0501033_0059632 3300049570 Bacteria 2818
525 Ga0501034_0069571 3300049571 Bacteria 3531
526 Ga0501038_0143722 3300049574 Bacteria 1950
527 Ga0501039_0019916 3300049575 Bacteria 5143
528 Ga0501041_0057803 3300049577 Bacteria 2372
529 Ga0501046_0145826 3300049580 Bacteria 1788
530 Ga0501067_0018349 3300049583 Bacteria 3876
531 Ga0501069_0002306 3300049585 Bacteria 9628
532 Ga0501070_0010686 3300049586 Bacteria 7762
533 Ga0501070_0018160 3300049586 Bacteria 5899
534 Ga0501071_0063145 3300049587 Bacteria 2685
535 Ga0501072_0016161 3300049588 Bacteria 5725
536 Ga0501072_0099754 3300049588 Bacteria 2308
537 Ga0501073_0028653 3300049589 Bacteria 3979
538 Ga0501073_0030390 3300049589 Bacteria 3857
539 Ga0501074_0170349 3300049590 Bacteria 1554
540 Ga0501076_0104514 3300049592 Bacteria 2285
541 Ga0501077_0026564 3300049593 Bacteria 3674
542 Ga0501079_0086329 3300049741 Bacteria 2429
543 Ga0501080_0108722 3300049742 Bacteria 2570
544 Ga0501081_0044304 3300049743 Bacteria 3054
545 Ga0501083_0094571 3300049744 Bacteria 1973
546 Ga0501035_0158737 3300049822 Bacteria 1959
547 Ga0501044_0051380 3300049823 Bacteria 4250
548 Ga0501045_0012068 3300049824 Bacteria 6077
549 nmdc:mga03683_6669_c1 3300050489 Bacteria 3966
550 nmdc:mga03n38_5710_c1 3300050490 Bacteria 4264
551 nmdc:mga06z11_61277_c1 3300050494 Bacteria 1962
552 nmdc:mga05p37_53000_c1 3300050507 Bacteria 4989
553 nmdc:mga06r32_33248_c1 3300050510 Bacteria 4857
554 nmdc:mga06r32_370813_c1 3300050510 Bacteria 1415
555 nmdc:mga08y16_126616_c1 3300050511 Bacteria 2657
556 nmdc:mga0n895_2487_c1 3300050512 Bacteria 14415
557 nmdc:mga0n895_82764_c1 3300050512 Bacteria 3199
558 nmdc:mga0n895_83942_c1 3300050512 Bacteria 3178
559 nmdc:mga0n895_87383_c1 3300050512 Bacteria 3115
560 nmdc:mga0n895_98008_c1 3300050512 Bacteria 2938
561 nmdc:mga0rr50_26478_c1 3300050513 Bacteria 4047
562 nmdc:mga0rr50_56681_c1 3300050513 Bacteria 2928
563 nmdc:mga0rr50_88078_c1 3300050513 Bacteria 2411
564 nmdc:mga08x19_136569_c1 3300050514 Bacteria 1653
565 nmdc:mga08x19_54355_c1 3300050514 Bacteria 2577
566 nmdc:mga0a205_134501_c1 3300050515 Bacteria 2373
567 nmdc:mga0a205_134526_c1 3300050515 Bacteria 2372
568 nmdc:mga0a205_2871_c1 3300050515 Bacteria 15239
569 nmdc:mga0a205_348195_c1 3300050515 Bacteria 1349
570 nmdc:mga0a205_99582_c1 3300050515 Bacteria 2805
571 Ga0495601_0005765 3300053077 Bacteria 7224
572 Ga0495612_0001072 3300053078 Bacteria 11201
573 Ga0495595_0002657 3300053084 Bacteria 7012
574 Ga0495595_0006491 3300053084 Bacteria 4773
575 Ga0495619_0000355 3300053085 Bacteria 32054
576 Ga0495619_0036614 3300053085 Bacteria 3195
577 Ga0495619_0076078 3300053085 Bacteria 2253
578 Ga0500643_000032 3300053087 Bacteria 200350
579 Ga0500566_0000026 3300053094 Bacteria 77138
580 Ga0500566_0001584 3300053094 Bacteria 13387
581 Ga0500566_0008786 3300053094 Bacteria 5975
582 Ga0500640_002218 3300053095 Bacteria 6337
583 Ga0500555_005056 3300053103 Bacteria 3743
584 Ga0500557_000087 3300053105 Bacteria 32155
585 Ga0500595_009653 3300053119 Bacteria 3885
586 Ga0500614_000135 3300053123 Bacteria 18032
587 Ga0500642_0001017 3300053130 Bacteria 8061
588 Ga0500652_034780 3300053131 Bacteria 1998
589 Ga0500559_0004957 3300053136 Bacteria 6188
590 Ga0500559_0010760 3300053136 Bacteria 3922
591 Ga0500559_0038877 3300053136 Bacteria 2068
592 Ga0500590_011029 3300053148 Bacteria 4574
593 Ga0500603_000591 3300053150 Bacteria 9040
594 Ga0500616_0015563 3300053153 Bacteria 4346
595 Ga0500616_0038525 3300053153 Bacteria 2581
596 Ga0500619_003290 3300053154 Bacteria 3284
597 Ga0500622_0004721 3300053156 Bacteria 8421
598 Ga0500639_000939 3300053163 Bacteria 14837
599 Ga0500636_0000978 3300053177 Bacteria 15335
600 Ga0500636_0039374 3300053177 Bacteria 2795
601 Ga0500637_0013976 3300053178 Bacteria 4223
602 Ga0500637_0027839 3300053178 Bacteria 3122
603 Ga0500625_007369 3300053729 Bacteria 4780
604 Ga0500596_002113 3300053735 Bacteria 3960
605 Ga0500601_000801 3300053737 Bacteria 3947
606 Ga0501084_0050929 3300054114 Bacteria 3465
607 Ga0530510_0081050 3300061734 Bacteria 2362
608 8057529777 8057529695 Bacteria 6306553
609 2509150578 2508501128 Bacteria 8613869
610 2513625501 2513237092 Bacteria 8341956
611 2513644502 2513237094 Bacteria 8789602
612 2513658049 2513237096 Bacteria 8722461
613 2513703767 2513237102 Bacteria 7703324
614 2513717176 2513237104 Bacteria 10034502
615 2513872891 2513237139 Bacteria 8737671
616 2513919857 2513237145 Bacteria 8979722
617 2517107454 2517093001 Bacteria 9002274
618 2517892291 2517572143 Bacteria 9484767
619 2528849947 2528768022 Bacteria 10457665
620 2617375644 2617270741 Bacteria 8201522
621 2644728719 2643221733 Bacteria 5690728
622 2644735931 2643221734 Bacteria 5365412
623 2644747204 2643221736 Bacteria 6608466
624 2723844935 2721755755 Bacteria 8322773
625 2728747354 2728368998 Bacteria 8720350
626 2793065384 2791355196 Bacteria 7323613
627 2793072366 2791355197 Bacteria 8420563
628 2793082193
629 2805915211 2802429603 Bacteria 8777136
630 2819718137 2818991467 Bacteria 5893227
631 2824608905 2824600985 Bacteria 8488197
632 2824617684 2824609381 Bacteria 8672835
633 2824626133 2824617872 Bacteria 8814715
634 2824635070 2824626560 Bacteria 8813858
635 2824643803 2824635225 Bacteria 8785348
636 2824652498 2824644064 Bacteria 8743947
637 2824661118 2824653114 Bacteria 8493680
638 2824670952 2824661429 Bacteria 9877870
639 2824686735 2824679649 Bacteria 8248951
640 2824703550 2824696289 Bacteria 8335049
641 2824722987 2824714736 Bacteria 8717648
642 2824731795 2824723954 Bacteria 8758240
643 2824739442 2824732956 Bacteria 7810675
644 2824753446 2824746037 Bacteria 7911610
645 2838123618 2838122688 Bacteria 8803140
646 2841762060 2841760612 Bacteria 6454112
647 2841916513 2841911363 Bacteria 6173697
648 2841922410 2841917233 Bacteria 6173500
649 2841946738 2841941048 Bacteria 8688029
650 2841949717 2841949485 Bacteria 8680857
651 2841958786 2841957949 Bacteria 8652217
652 2841971777 2841966195 Bacteria 8673214
653 2841974878 2841974524 Bacteria 8931498
654 2841983559 2841983080 Bacteria 8395090
655 2842038937 2842038055 Bacteria 8002051
656 2842048117 2842045827 Bacteria 8006841
657 2844105085 2844104063 Bacteria 6440972
658 2844319200 2844315083 Bacteria 8138177
659 2847936343 2847930680 Bacteria 9342022
660 2847946690 2847939898 Bacteria 8606328
661 2851183435 2851182111 Bacteria 6047226
662 2851248073 2851246043 Bacteria 6439203
663 2857514183 2857509624 Bacteria 7472071
664 2874615052 2874612657 Bacteria 8252029
665 2876764635 2876761206 Bacteria 10111113
666 2879090581 2879083081 Bacteria 8587928
667 2879105783 2879099564 Bacteria 10442239
668 2881368709 2881364244 Bacteria 7710352
669 2881673550 2881665667 Bacteria 8175609
670 2885411379 2885409591 Bacteria 9235467
671 2888384191 2888378607 Bacteria 9652610
672 2888424659 2888419890 Bacteria 7857137
673 2891091442 2891088606 Bacteria 4762464
674 2903731042 2903727486 Bacteria 8281579
675 2906608177 2906602504 Bacteria 8295279
676 2906626934 2906626472 Bacteria 8826946
677 2906637435 2906635258 Bacteria 8601019
678 2906649203 2906643746 Bacteria 8722424
679 2906666266 2906660503 Bacteria 8595048
680 2908780307 2908775508 Bacteria 8092255
681 2917699457 2917699015 Bacteria 7043791
682 2922365490 2922361189 Bacteria 7436256
683 2922374532
684 2922391113 2922386360 Bacteria 7017218
685 2922400672 2922393267 Bacteria 8285685
686 2929632386 2929624759 Bacteria 9339455
687 2932790492 2932784394 Bacteria 9704911
688 2932799830 2932794094 Bacteria 7915132
689 2932802671 2932801729 Bacteria 7987968
690 2932810913 2932809354 Bacteria 9135765
691 2932823757 2932818245 Bacteria 9955613
692 2932830123 2932828146 Bacteria 9745859
693 2935622651 2935616580 Bacteria 9032984
694 2935642549 2935638405 Bacteria 10015038
695 2935668147 2935665750 Bacteria 9571747
696 2935676181 2935675223 Bacteria 9928132
697 2935686163 2935684952 Bacteria 9590419
698 2935701210 2935694250 Bacteria 9291695
699 2935706007 2935703347 Bacteria 10242284
700 2935714715 2935713505 Bacteria 9608509
701 2935725334 2935722832 Bacteria 9608746
702 2935732306 2935732158 Bacteria 9706831
703 2935741685 2935741537 Bacteria 9707219
704 2935752128 2935750917 Bacteria 9590372
705 2935766477 2935760218 Bacteria 9817913
706 2935771923 2935769743 Bacteria 7878163
707 2935778645 2935777560 Bacteria 8077691
708 2935788969 2935785616 Bacteria 7962367
709 2935795230 2935793552 Bacteria 8012592
710 2935803006 2935801545 Bacteria 9301974
711 2935814323 2935810662 Bacteria 9401221
712 2935831460 2935827899 Bacteria 10038562
713 2935838320 2935837841 Bacteria 9454360
714 2935860900 2935855204 Bacteria 9035059
715 2935869763 2935864058 Bacteria 9784707
716 2935878818 2935873716 Bacteria 9632195
717 2935886957 2935883170 Bacteria 7964738
718 2935994786 2935992306 Bacteria 9802711
719 2936003428 2936002035 Bacteria 9362176
720 2936039879 2936037263 Bacteria 9446081
721 2940557069 2940556831 Bacteria 9590747
722 2941532944 2941531003 Bacteria 7653939
723 2941539012 2941538514 Bacteria 9402094
724 3005484440 3005483717 Bacteria 7877331
725 3005510449 3005506211 Bacteria 6943378
726 3005587914 3005587118 Bacteria 7794411
727 3005599365 3005594810 Bacteria 8716512
728 3005715028 3005710791 Bacteria 7622528
729 3005722442 3005718088 Bacteria 8283608
730 8006931848 8006926726 Bacteria 6749210
731 8006967188 8006964411 Bacteria 8966052
732 8016522189 8016511872 Bacteria 9921665
733 8016529499 8016522445 Bacteria 8156687
734 8016534709 8016530956 Bacteria 8155261
735 8016547926 8016539877 Bacteria 8155419
736 8016554204 8016548790 Bacteria 8155074
737 8016562579 8016557553 Bacteria 8154380
738 8016573059 8016566248 Bacteria 8158151
739 8016577205 8016575299 Bacteria 8154085
740 8016591609 8016583857 Bacteria 10421953
741 8016600367 8016595262 Bacteria 8149947
742 8016610371 8016603502 Bacteria 8731218
743 8016614560 8016613128 Bacteria 8794220
744 8016626440 8016622563 Bacteria 7999408
745 8017063481 8017057580 Bacteria 10023680
746 8019534476 8019530166 Bacteria 8155624
747 8019544996 8019538911 Bacteria 7872763
748 8019553532 8019547302 Bacteria 7996444
749 8019582800 8019576017 Bacteria 10049540
750 8019590590 8019586578 Bacteria 10212056
751 8019600762 8019597564 Bacteria 10041141
752 8019617790 8019608314 Bacteria 10042931
753 8019658536 8019648815 Bacteria 10014479
754 8056968158 8056967851 Bacteria 9038162
755 JGI24740J21852_10013233
756 JGI24737J22298_10008734
757 JGI24735J21928_10014231
758 JGI25151J46595_10000136
759 JGI25151J46595_10000217
760 Ga0055526_1000896
761 Ga0055526_1000904
762 Ga0055524_1000078
763 Ga0055543_1004114
764 Ga0058859_11782272
765 Ga0058860_12209077
766 Ga0065165_1000072
767 Ga0065165_1002278
768 Ga0065712_10000361
769 Ga0065715_10000318
770 Ga0070676_10024166
771 Ga0070676_10052658
772 Ga0070676_10112763
773 Ga0070670_100013797
774 Ga0068869_100163677
775 Ga0070680_100116556
776 Ga0070680_100270185
777 Ga0068868_100030944
778 Ga0070689_100139626
779 Ga0070687_100054905
780 Ga0070671_100007858
781 Ga0070674_100082407
782 Ga0070673_100258065
783 Ga0070667_100081780
784 Ga0070703_10009308
785 Ga0070709_10000348
786 Ga0070709_10013740
787 Ga0070714_100000490
788 Ga0070714_100008940
789 Ga0070714_100067032
790 Ga0070713_100000278
791 Ga0070710_10001018
792 Ga0070710_10003676
793 Ga0070711_100003976
794 Ga0070711_100017385
795 Ga0070711_100104917
796 Ga0070705_100056890
797 Ga0070694_100007125
798 Ga0070663_100040237
799 Ga0070663_100047985
800 Ga0070678_100057626
801 Ga0070662_100060596
802 Ga0070662_100125746
803 Ga0070681_10040909
804 Ga0068867_100046303
805 Ga0070697_100000080
806 Ga0070697_100194476
807 Ga0068853_100169717
808 Ga0068853_100174501
809 Ga0068853_100218047
810 Ga0068853_100272856
811 Ga0070696_100053539
812 Ga0070665_100050963
813 Ga0070665_100100174
814 Ga0070665_100119517
815 Ga0070665_100150908
816 Ga0070704_100008118
817 Ga0068855_100019340
818 Ga0068855_100042552
819 Ga0068855_100144104
820 Ga0068855_100266977
821 Ga0070664_100169249
822 Ga0068857_100075965
823 Ga0068857_100182935
824 Ga0068854_100125445
825 Ga0068854_100126712
826 Ga0068856_100152498
827 Ga0068856_100230315
828 Ga0068852_100089766
829 Ga0068866_10040218
830 Ga0068851_10004835
831 Ga0068858_100028222
832 Ga0068858_100245500
833 Ga0068860_100026198
834 Ga0081455_10008528
835 Ga0081455_10008869
836 Ga0081540_1004841
837 Ga0081540_1005905
838 Ga0081540_1009855
839 Ga0081539_10000597
840 Ga0081539_10000735
841 Ga0081539_10013306
842 Ga0081539_10033563
843 Ga0070717_10000297
844 Ga0070717_10036246
845 Ga0075365_10142987
846 Ga0075363_100016047
847 Ga0075363_100041613
848 Ga0070715_10005158
849 Ga0070716_100001393
850 Ga0070716_100045273
851 Ga0070712_100005370
852 Ga0070712_100006220
853 Ga0070712_100010554
854 Ga0070712_100011725
855 Ga0070712_100058839
856 Ga0075362_10001513
857 Ga0075367_10110137
858 Ga0075366_10011078
859 Ga0097621_100122698
860 Ga0075370_10099694
861 Ga0068871_100029523
862 Ga0075431_100007067
863 Ga0075431_100010451
864 Ga0075433_10079274
865 Ga0075434_100018441
866 Ga0075434_100046859
867 Ga0075429_100044375
868 Ga0068865_100028670
869 Ga0099825_1029851
870 Ga0099824_1025839
871 Ga0075435_100000827
872 Ga0075435_100032914
873 Ga0099795_10000521
874 Ga0099795_10001501
875 Ga0105240_10005341
876 Ga0105240_10012605
877 Ga0105240_10164491
878 Ga0105240_10187496
879 Ga0111539_10052427
880 Ga0105245_10165592
881 Ga0105245_10217310
882 Ga0114129_10017485
883 Ga0114129_10611758
884 Ga0105243_10017871
885 Ga0105241_10077937
886 Ga0105241_10161752
887 Ga0105248_10072817
888 Ga0105237_10023811
889 Ga0105237_10215828
890 Ga0105238_10064921
891 Ga0105238_10259151
892 Ga0105249_10350717
893 Ga0099796_10000086
894 Ga0105239_10002676
895 Ga0105239_10048001
896 Ga0105239_10059881
897 Ga0105239_10147202
898 Ga0105246_10017870
899 Ga0105246_10129020
900 Ga0157370_10062573
901 Ga0171462_1037
902 Ga0157374_10010944
903 Ga0157374_10013272
904 Ga0157374_10105256
905 Ga0157378_10006214
906 Ga0157372_10240915
907 Ga0157375_10178475
908 Ga0157375_10312234
909 Ga0163163_10006000
910 Ga0163163_10040601
911 Ga0163163_10246906
912 Ga0163163_10325423
913 Ga0157380_10075964
914 Ga0197907_11280375
915 Ga0206350_10193835
916 Ga0214544_1000002
917 Ga0214542_1000001
918 Ga0214545_1000001
919 Ga0214543_1000001
920 Ga0213876_10001215
921 Ga0228598_1000979
922 Ga0209130_1000125
923 Ga0209675_1001197
924 Ga0209025_1000014
925 Ga0209025_1001183
926 Ga0209564_1000105
927 Ga0209564_1000179
928 Ga0209758_1002544
929 Ga0209256_1000055
930 Ga0209257_1017751
931 Ga0207697_10012580
932 Ga0207692_10000116
933 Ga0207692_10001592
934 Ga0207692_10074954
935 Ga0207642_10023479
936 Ga0207710_10007078
937 Ga0207710_10011722
938 Ga0207688_10115569
939 Ga0207647_10011073
940 Ga0207685_10002629
941 Ga0207699_10007380
942 Ga0207699_10009773
943 Ga0207699_10148625
944 Ga0207645_10076135
945 Ga0207684_10058004
946 Ga0207654_10000308
947 Ga0207654_10008665
948 Ga0207654_10091644
949 Ga0207707_10034699
950 Ga0207707_10060434
951 Ga0207695_10001719
952 Ga0207695_10001812
953 Ga0207695_10015101
954 Ga0207695_10141323
955 Ga0207695_10277579
956 Ga0207671_10008038
957 Ga0207671_10026027
958 Ga0207671_10043689
959 Ga0207693_10000936
960 Ga0207693_10015310
961 Ga0207693_10055385
962 Ga0207693_10089262
963 Ga0207693_10097802
964 Ga0207663_10001209
965 Ga0207663_10004152
966 Ga0207660_10098393
967 Ga0207657_10121768
968 Ga0207652_10011414
969 Ga0207652_10053499
970 Ga0207694_10000157
971 Ga0207694_10070529
972 Ga0207694_10137111
973 Ga0207694_10175526
974 Ga0207650_10005423
975 Ga0207687_10135380
976 Ga0207700_10000380
977 Ga0207700_10034366
978 Ga0207700_10058979
979 Ga0207664_10003152
980 Ga0207664_10008858
981 Ga0207644_10113219
982 Ga0207706_10171579
983 Ga0207709_10003187
984 Ga0207669_10025941
985 Ga0207669_10077289
986 Ga0207665_10001402
987 Ga0207665_10035413
988 Ga0207711_10058835
989 Ga0207667_10008116
990 Ga0207667_10092805
991 Ga0207667_10151627
992 Ga0207667_10229954
993 Ga0207651_10003242
994 Ga0207640_10060288
995 Ga0207677_10063534
996 Ga0207677_10093801
997 Ga0207703_10077402
998 Ga0207703_10096486
999 Ga0207703_10170351
1000 Ga0207639_10010722
1001 Ga0207678_10077767
1002 Ga0207678_10171583
1003 Ga0207678_10227417
1004 Ga0207708_10032968
1005 Ga0207702_10000002
1006 Ga0207702_10009353
1007 Ga0207702_10026824
1008 Ga0207648_10066627
1009 Ga0207676_10146220
1010 Ga0207676_10153198
1011 Ga0207674_10009623
1012 Ga0207674_10075571
1013 Ga0207674_10274519
1014 Ga0207675_100011052
1015 Ga0207675_100021910
1016 Ga0207675_100241457
1017 Ga0207683_10190253
1018 Ga0209389_1000008
1019 Ga0209389_1000292
1020 Ga0209589_1001423
1021 Ga0209489_100096
1022 Ga0209489_100333
1023 Ga0209700_100062
1024 Ga0209179_1001675
1025 Ga0209968_1007374
1026 Ga0209971_1002819
1027 Ga0209974_10006149
1028 Ga0207428_10048166
1029 Ga0268266_10008946
1030 Ga0268266_10029812
1031 Ga0268266_10117217
1032 Ga0268266_10178603
1033 Ga0268266_10271922
1034 Ga0268264_10359309
1035 Ga0265340_10003545
1036 Ga0265331_10003122
1037 Ga0265327_10005683
1038 Ga0265316_10016635
1039 Ga0265342_10035774
1040 Ga0307406_10065258
1041 Ga0307406_10203175
1042 Ga0307411_10236984
1043 Ga0307510_10069887
1044 Ga0373923_0023152
1045 Ga0373936_0022889
1046 Ga0373945_0003120
1047 Ga0373945_0034614
1048 Ga0373953_0001976
1049 Ga0373954_0000070
1050 Ga0373956_0001764
1051 Ga0373957_0002936
1052 Ga0373955_0000771
1053 Ga0373924_0005902
1054 Ga0373924_0007507
1055 Ga0373931_0029484
1056 Ga0373935_0068712
1057 Ga0373927_0025168
1058 Ga0373933_0006540
1059 Ga0373947_0001951
1060 Ga0373947_0035703
1061 Ga0373947_0057404
1062 Ga0373937_0034207
1063 Ga0373925_0000183
1064 Ga0373925_0056552
1065 Ga0395905_0089264
1066 Ga0436364_0351634
1067 Ga0436364_0617696
1068 Ga0436365_0389941
1069 Ga0436365_0903497
1070 Ga0436365_1136865
1071 Ga0436365_1625412
1072 Ga0436365_1781597
1073 Ga0436360_0689838
1074 Ga0436360_1287647
1075 Ga0436363_0716857
1076 Ga0436363_0801798
1077 Ga0436362_0188545
1078 Ga0451577_0113078
1079 Ga0466969_0025258
1080 Ga0466972_0005717
1081 Ga0466966_0013591
1082 Ga0466963_0002381
1083 Ga0466963_0237853
1084 Ga0466971_0032723
1085 Ga0466968_0024730
1086 Ga0466960_0008985
1087 Ga0466959_0002189
1088 Ga0451576_0214044
1089 Ga0466958_0036218
1090 Ga0466967_0080868
1091 Ga0495592_0022090
1092 Ga0495592_0106036
1093 Ga0495603_0017433
1094 Ga0495603_0116667
1095 Ga0495629_0000005
1096 Ga0495629_0002263
1097 Ga0495629_0006304
1098 Ga0495629_0136933
1099 Ga0495629_0152292
1100 Ga0495638_0063568
1101 Ga0495641_0037933
1102 Ga0495651_0001805
1103 Ga0495651_0039119
1104 Ga0495651_0110241
1105 Ga0495653_0003677
1106 Ga0495653_0047853
1107 Ga0495653_0147798
1108 Ga0495580_0026326
1109 Ga0495639_0000842
1110 Ga0495662_0001038
1111 Ga0495664_0000168
1112 Ga0495664_0025332
1113 Ga0495664_0046258
1114 Ga0495584_0072545
1115 Ga0495594_0077008
1116 Ga0495596_0049332
1117 Ga0495607_0049959
1118 Ga0495608_0001870
1119 Ga0495608_0006442
1120 Ga0495608_0152486
1121 Ga0495610_0027626
1122 Ga0495618_0017854
1123 Ga0495628_0002643
1124 Ga0495628_0013414
1125 Ga0495643_0009568
1126 Ga0495643_0025025
1127 Ga0495644_0055063
1128 Ga0495663_0011517
1129 Ga0495666_0000024
1130 Ga0495652_0031409
1131 Ga0495652_0089619
1132 Ga0495640_0002929
1133 Ga0495640_0095851
1134 Ga0495586_0001169
1135 Ga0495586_0048074
1136 Ga0495587_0001351
1137 Ga0495587_0008371
1138 Ga0495621_0013236
1139 Ga0495645_0003263
1140 Ga0495645_0008453
1141 Ga0495645_0016949
1142 Ga0495645_0024685
1143 Ga0495622_0011772
1144 Ga0495667_0000926
1145 Ga0495667_0028061
1146 Ga0495667_0131178
1147 Ga0495656_0020832
1148 Ga0495634_0003658
1149 Ga0495634_0007605
1150 Ga0495634_0008514
1151 Ga0495634_0061030
1152 Ga0495635_0004011
1153 Ga0495635_0004483
1154 Ga0495635_0058336
1155 Ga0495588_0030709
1156 Ga0495657_0001016
1157 Ga0495657_0052531
1158 Ga0495599_0000637
1159 Ga0495623_0003015
1160 Ga0495623_0005023
1161 Ga0495623_0096301
1162 Ga0495646_0001926
1163 Ga0495646_0033730
1164 Ga0495646_0079815
1165 Ga0495647_0013552
1166 Ga0495613_0074181
1167 Ga0495600_0002398
1168 Ga0495581_0007505
1169 Ga0495604_0013258
1170 Ga0495604_0032291
1171 Ga0495604_0034842
1172 Ga0495674_0000138
1173 Ga0495674_0011842
1174 Ga0495672_0000437
1175 Ga0495672_0049705
1176 Ga0495676_0001542
1177 Ga0495676_0036897
1178 Ga0495676_0049376
1179 Ga0495680_0004188
1180 Ga0495680_0013222
1181 Ga0495680_0015409
1182 Ga0495683_0072960
1183 Ga0495687_005957
1184 Ga0495675_0001543
1185 Ga0495675_0035239
1186 Ga0495677_0017922
1187 Ga0495673_0019085
1188 Ga0495684_0000380
1189 Ga0495593_0001866
1190 Ga0495593_0075992
1191 Ga0495602_0010536
1192 Ga0495602_0053726
1193 Ga0495614_0034246
1194 Ga0496100_0020098
1195 Ga0496100_0048366
1196 Ga0496100_0113210
1197 Ga0496101_0130235
1198 Ga0496102_0003736
1199 Ga0496102_0032222
1200 Ga0496102_0225135
1201 Ga0496102_0229928
1202 Ga0496102_0242557
1203 Ga0496103_0002281
1204 Ga0496103_0092083
1205 Ga0496104_0000035
1206 Ga0496104_0003085
1207 Ga0496104_0004213
1208 Ga0496104_0014054
1209 Ga0496104_0108133
1210 Ga0496104_0138124
1211 Ga0496104_0209020
1212 Ga0496105_0000029
1213 Ga0496105_0000279
1214 Ga0496105_0034896
1215 Ga0496105_0057759
1216 Ga0496105_0184635
1217 Ga0496105_0235873
1218 Ga0496106_0076211
1219 Ga0496106_0222586
1220 Ga0496107_0015807
1221 Ga0496107_0058123
1222 Ga0496107_0089789
1223 Ga0496107_0262791
1224 Ga0496108_0057566
1225 Ga0496108_0075853
1226 Ga0496108_0095615
1227 Ga0496108_0322718
1228 Ga0496108_0324142
1229 Ga0496109_0015089
1230 Ga0496109_0093643
1231 Ga0496109_0140849
1232 Ga0496110_0018675
1233 Ga0496110_0064949
1234 Ga0496110_0225231
1235 Ga0496110_0462982
1236 Ga0496111_0023631
1237 Ga0496111_0071890
1238 Ga0496111_0102036
1239 Ga0496111_0151566
1240 Ga0496112_0005015
1241 Ga0496112_0005456
1242 Ga0496112_0011944
1243 Ga0496112_0060843
1244 Ga0496112_0102019
1245 Ga0496113_0002755
1246 Ga0496113_0084898
1247 Ga0496113_0097950
1248 Ga0496113_0162957
1249 Ga0496113_0225831
1250 Ga0496114_0026635
1251 Ga0496114_0056707
1252 Ga0496114_0066371
1253 Ga0496115_0001490
1254 Ga0496115_0027232
1255 Ga0496115_0183061
1256 Ga0496115_0199642
1257 Ga0496115_0239386
1258 Ga0496117_0035460
1259 Ga0496117_0039537
1260 Ga0496118_0141233
1261 Ga0496118_0142351
1262 Ga0496119_0004200
1263 Ga0496119_0013974
1264 Ga0496120_0016201
1265 Ga0496121_0001335
1266 Ga0496121_0062065
1267 Ga0496121_0081839
1268 Ga0496121_0147726
1269 Ga0496122_0038402
1270 Ga0496122_0083768
1271 Ga0496123_0044483
1272 Ga0496124_0086603
1273 Ga0496125_0017244
1274 Ga0496125_0066790
1275 Ga0496126_0033274
1276 Ga0496126_0118098
1277 Ga0496126_0277399
1278 Ga0501033_0059632
1279 Ga0501034_0069571
1280 Ga0501038_0143722
1281 Ga0501039_0019916
1282 Ga0501041_0057803
1283 Ga0501046_0145826
1284 Ga0501067_0018349
1285 Ga0501069_0002306
1286 Ga0501070_0010686
1287 Ga0501070_0018160
1288 Ga0501071_0063145
1289 Ga0501072_0016161
1290 Ga0501072_0099754
1291 Ga0501073_0028653
1292 Ga0501073_0030390
1293 Ga0501074_0170349
1294 Ga0501076_0104514
1295 Ga0501077_0026564
1296 Ga0501079_0086329
1297 Ga0501080_0108722
1298 Ga0501081_0044304
1299 Ga0501083_0094571
1300 Ga0501035_0158737
1301 Ga0501044_0051380
1302 Ga0501045_0012068
1303 nmdc:mga03683_6669_c1
1304 nmdc:mga03n38_5710_c1
1305 nmdc:mga06z11_61277_c1
1306 nmdc:mga05p37_53000_c1
1307 nmdc:mga06r32_33248_c1
1308 nmdc:mga06r32_370813_c1
1309 nmdc:mga08y16_126616_c1
1310 nmdc:mga0n895_2487_c1
1311 nmdc:mga0n895_82764_c1
1312 nmdc:mga0n895_83942_c1
1313 nmdc:mga0n895_87383_c1
1314 nmdc:mga0n895_98008_c1
1315 nmdc:mga0rr50_26478_c1
1316 nmdc:mga0rr50_56681_c1
1317 nmdc:mga0rr50_88078_c1
1318 nmdc:mga08x19_136569_c1
1319 nmdc:mga08x19_54355_c1
1320 nmdc:mga0a205_134501_c1
1321 nmdc:mga0a205_134526_c1
1322 nmdc:mga0a205_2871_c1
1323 nmdc:mga0a205_348195_c1
1324 nmdc:mga0a205_99582_c1
1325 Ga0495601_0005765
1326 Ga0495612_0001072
1327 Ga0495595_0002657
1328 Ga0495595_0006491
1329 Ga0495619_0000355
1330 Ga0495619_0036614
1331 Ga0495619_0076078
1332 Ga0500643_000032
1333 Ga0500566_0000026
1334 Ga0500566_0001584
1335 Ga0500566_0008786
1336 Ga0500640_002218
1337 Ga0500555_005056
1338 Ga0500557_000087
1339 Ga0500595_009653
1340 Ga0500614_000135
1341 Ga0500642_0001017
1342 Ga0500652_034780
1343 Ga0500559_0004957
1344 Ga0500559_0010760
1345 Ga0500559_0038877
1346 Ga0500590_011029
1347 Ga0500603_000591
1348 Ga0500616_0015563
1349 Ga0500616_0038525
1350 Ga0500619_003290
1351 Ga0500622_0004721
1352 Ga0500639_000939
1353 Ga0500636_0000978
1354 Ga0500636_0039374
1355 Ga0500637_0013976
1356 Ga0500637_0027839
1357 Ga0500625_007369
1358 Ga0500596_002113
1359 Ga0500601_000801
1360 Ga0501084_0050929
1361 Ga0530510_0081050
1362 8057529777
1363 2509150578
1364 2513625501
1365 2513644502
1366 2513658049
1367 2513703767
1368 2513717176
1369 2513872891
1370 2513919857
1371 2517107454
1372 2517892291
1373 2528849947
1374 2617375644
1375 2644728719
1376 2644735931
1377 2644747204
1378 2723844935
1379 2728747354
1380 2793065384
1381 2793072366
1382 2793082193
1383 2805915211
1384 2819718137
1385 2824608905
1386 2824617684
1387 2824626133
1388 2824635070
1389 2824643803
1390 2824652498
1391 2824661118
1392 2824670952
1393 2824686735
1394 2824703550
1395 2824722987
1396 2824731795
1397 2824739442
1398 2824753446
1399 2838123618
1400 2841762060
1401 2841916513
1402 2841922410
1403 2841946738
1404 2841949717
1405 2841958786
1406 2841971777
1407 2841974878
1408 2841983559
1409 2842038937
1410 2842048117
1411 2844105085
1412 2844319200
1413 2847936343
1414 2847946690
1415 2851183435
1416 2851248073
1417 2857514183
1418 2874615052
1419 2876764635
1420 2879090581
1421 2879105783
1422 2881368709
1423 2881673550
1424 2885411379
1425 2888384191
1426 2888424659
1427 2891091442
1428 2903731042
1429 2906608177
1430 2906626934
1431 2906637435
1432 2906649203
1433 2906666266
1434 2908780307
1435 2917699457
1436 2922365490
1437 2922374532
1438 2922391113
1439 2922400672
1440 2929632386
1441 2932790492
1442 2932799830
1443 2932802671
1444 2932810913
1445 2932823757
1446 2932830123
1447 2935622651
1448 2935642549
1449 2935668147
1450 2935676181
1451 2935686163
1452 2935701210
1453 2935706007
1454 2935714715
1455 2935725334
1456 2935732306
1457 2935741685
1458 2935752128
1459 2935766477
1460 2935771923
1461 2935778645
1462 2935788969
1463 2935795230
1464 2935803006
1465 2935814323
1466 2935831460
1467 2935838320
1468 2935860900
1469 2935869763
1470 2935878818
1471 2935886957
1472 2935994786
1473 2936003428
1474 2936039879
1475 2940557069
1476 2941532944
1477 2941539012
1478 3005484440
1479 3005510449
1480 3005587914
1481 3005599365
1482 3005715028
1483 3005722442
1484 8006931848
1485 8006967188
1486 8016522189
1487 8016529499
1488 8016534709
1489 8016547926
1490 8016554204
1491 8016562579
1492 8016573059
1493 8016577205
1494 8016591609
1495 8016600367
1496 8016610371
1497 8016614560
1498 8016626440
1499 8017063481
1500 8019534476
1501 8019544996
1502 8019553532
1503 8019582800
1504 8019590590
1505 8019600762
1506 8019617790
1507 8019658536
1508 8056968158

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

258

357

0.96

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

1

250

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e60-assembly1.cif.gz_B crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from bartonella henselae 0.9868 1 412
3kzu-assembly2.cif.gz_C-2 crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from brucella melitensis 0.9854 1 412
3e60-assembly1.cif.gz_B crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from bartonella henselae 0.9845 1 412
3kzu-assembly2.cif.gz_C-2 crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from brucella melitensis 0.9831 1 412
4jga-assembly1.cif.gz_B x-ray crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase 2 from rickettsia rickettsii 0.9691 1 412
ID Description Score Start End Superfamily
af_O94297_1_425_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9711 1 411 3.40.47.10
af_O94297_1_425_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9665 1 411 3.40.47.10
4f32A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9634 5 251 3.40.47.10
af_Q5ANC6_1_441_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9587 1 412 3.40.47.10
af_Q0E328_1_239_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9569 178 408 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A1N7L651-F1-model_v4 Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) 0.9867 1 412 GO:0004315
GO:0005829
GO:0006633
AF-A0A3S1UKM1-F1-model_v4 Beta-ketoacyl-ACP synthase II 0.9849 238 412 GO:0004315
GO:0006633
AF-A0A1N7L651-F1-model_v4 Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) 0.9844 1 412 GO:0004315
GO:0005829
GO:0006633
AF-A0A3M1IYU0-F1-model_v4 Beta-ketoacyl-ACP synthase II 0.9835 210 412 GO:0004315
GO:0005829
GO:0006633
AF-A0A176FMC8-F1-model_v4 Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) 0.9828 1 332 GO:0004315
GO:0006633

Map