F479282
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 497 | 1508 | 417 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8057529695|8057529777 |
| Length | 443 |
| Sequence | VVTGLGMVTPLACGVEPSWSRILAGESGARPITTFDVSDLPAQIACTIPRGDGSNGTFNPDDWMEPKEQRKVDDFIIFAMAAATQALRDSGWKPESYEDQVATGVAIGSGIGGLGGIYEASLLLKERGPRRLSPFFIPGRLSNLAAGYVSIEHGLKGPNHAVVTACSTGAHAIGDAARMVALGDAEVMLAGGAESAVNRIGIAGFCACRALSTGFNETPEKASRPYDKDRDGFVMGEGAGVVVLEELGHAKARGARIYAEVVGYGMSGDAYHITSPSEDGDGAYRCMQAALKRAGLRASDLDYINAHGTSTQVGDEIELRAVERLLANAPTRPAMSSTKSATGHLLGAAGAIEAIFFGAGDPRPDRAADDQSRQPLRRDRARSRAAQGQEAEGRHCPVKLIRFRRNQRLSGDAPLRRLTRSALSPQFSLACRRRRASMRPACH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 73 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 100 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 101 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 102 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 105 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 198 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 199 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 205 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 284 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 330 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 331 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 333 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 334 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 335 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 337 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 338 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 342 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 343 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 346 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 347 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 351 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 352 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 353 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 354 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 355 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 356 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 357 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 358 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 359 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 360 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 361 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 362 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 363 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 364 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 365 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 366 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 367 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 368 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 369 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 370 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 371 | 2791355199 | |||
| 372 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 373 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 374 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 375 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 376 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 377 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 378 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 379 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 380 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 381 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 382 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 383 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 384 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 385 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 386 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 387 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 388 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 389 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 390 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 391 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 392 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 393 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 394 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 395 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 396 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 397 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 398 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 399 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 400 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 401 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 402 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 403 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 404 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 405 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 406 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 407 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 408 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 409 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 410 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 411 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 412 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 413 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 414 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 415 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 416 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 417 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 418 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 419 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 420 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 421 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 422 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 423 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 424 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 425 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 426 | 2922368715 | |||
| 427 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 428 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 429 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 430 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 431 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 432 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 433 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 434 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 435 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 436 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 437 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 438 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 439 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 440 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 441 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 442 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 443 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 444 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 445 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 446 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 447 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 448 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 449 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 450 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 451 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 452 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 453 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 454 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 455 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 456 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 457 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 458 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 459 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 460 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 461 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 462 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 463 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 464 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 465 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 466 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 467 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 468 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 469 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 470 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 471 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 472 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 473 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 474 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 475 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 476 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 477 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 478 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 479 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 480 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 481 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 482 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 483 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 484 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 485 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 486 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 487 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 488 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 489 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 490 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 491 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 492 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 493 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 494 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 495 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 496 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 497 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.19 |
| Metatranscriptomes | 0.53 |
| Isolates | 19.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.29 |
| Nodule | 15.25 |
| Rhizoplane | 8.49 |
| Rhizosphere | 59.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013233 | 3300001979 | Bacteria | 3086 |
| 2 | JGI24737J22298_10008734 | 3300001990 | Bacteria | 3383 |
| 3 | JGI24735J21928_10014231 | 3300002067 | Bacteria | 2493 |
| 4 | JGI25151J46595_10000136 | 3300003187 | Bacteria | 97150 |
| 5 | JGI25151J46595_10000217 | 3300003187 | Bacteria | 68708 |
| 6 | Ga0055526_1000896 | 3300003771 | Bacteria | 22165 |
| 7 | Ga0055526_1000904 | 3300003771 | Bacteria | 22053 |
| 8 | Ga0055524_1000078 | 3300003775 | Bacteria | 120745 |
| 9 | Ga0055543_1004114 | 3300004625 | Bacteria | 4056 |
| 10 | Ga0058859_11782272 | 3300004798 | Bacteria | 2819 |
| 11 | Ga0058860_12209077 | 3300004801 | Bacteria | 1691 |
| 12 | Ga0065165_1000072 | 3300005262 | Bacteria | 165049 |
| 13 | Ga0065165_1002278 | 3300005262 | Bacteria | 16922 |
| 14 | Ga0065712_10000361 | 3300005290 | Bacteria | 28271 |
| 15 | Ga0065715_10000318 | 3300005293 | Bacteria | 15195 |
| 16 | Ga0070676_10024166 | 3300005328 | Bacteria | 3421 |
| 17 | Ga0070676_10052658 | 3300005328 | Bacteria | 2394 |
| 18 | Ga0070676_10112763 | 3300005328 | Bacteria | 1695 |
| 19 | Ga0070670_100013797 | 3300005331 | Bacteria | 6925 |
| 20 | Ga0068869_100163677 | 3300005334 | Bacteria | 1733 |
| 21 | Ga0070680_100116556 | 3300005336 | Bacteria | 2227 |
| 22 | Ga0070680_100270185 | 3300005336 | Bacteria | 1439 |
| 23 | Ga0068868_100030944 | 3300005338 | Bacteria | 4106 |
| 24 | Ga0070689_100139626 | 3300005340 | Bacteria | 1948 |
| 25 | Ga0070687_100054905 | 3300005343 | Bacteria | 2077 |
| 26 | Ga0070671_100007858 | 3300005355 | Bacteria | 8527 |
| 27 | Ga0070674_100082407 | 3300005356 | Bacteria | 2301 |
| 28 | Ga0070673_100258065 | 3300005364 | Bacteria | 1522 |
| 29 | Ga0070667_100081780 | 3300005367 | Bacteria | 2764 |
| 30 | Ga0070703_10009308 | 3300005406 | Bacteria | 2772 |
| 31 | Ga0070709_10000348 | 3300005434 | Bacteria | 28698 |
| 32 | Ga0070709_10013740 | 3300005434 | Bacteria | 4559 |
| 33 | Ga0070714_100000490 | 3300005435 | Bacteria | 28629 |
| 34 | Ga0070714_100008940 | 3300005435 | Bacteria | 7838 |
| 35 | Ga0070714_100067032 | 3300005435 | Bacteria | 3094 |
| 36 | Ga0070713_100000278 | 3300005436 | Bacteria | 33610 |
| 37 | Ga0070710_10001018 | 3300005437 | Bacteria | 13295 |
| 38 | Ga0070710_10003676 | 3300005437 | Bacteria | 7254 |
| 39 | Ga0070711_100003976 | 3300005439 | Bacteria | 8689 |
| 40 | Ga0070711_100017385 | 3300005439 | Bacteria | 4577 |
| 41 | Ga0070711_100104917 | 3300005439 | Bacteria | 2063 |
| 42 | Ga0070705_100056890 | 3300005440 | Bacteria | 2305 |
| 43 | Ga0070694_100007125 | 3300005444 | Bacteria | 6807 |
| 44 | Ga0070663_100040237 | 3300005455 | Bacteria | 3271 |
| 45 | Ga0070663_100047985 | 3300005455 | Bacteria | 3026 |
| 46 | Ga0070678_100057626 | 3300005456 | Bacteria | 2847 |
| 47 | Ga0070662_100060596 | 3300005457 | Unclassified | 2760 |
| 48 | Ga0070662_100125746 | 3300005457 | Bacteria | 1970 |
| 49 | Ga0070681_10040909 | 3300005458 | Bacteria | 4644 |
| 50 | Ga0068867_100046303 | 3300005459 | Bacteria | 3194 |
| 51 | Ga0070697_100000080 | 3300005536 | Bacteria | 77671 |
| 52 | Ga0070697_100194476 | 3300005536 | Bacteria | 1722 |
| 53 | Ga0068853_100169717 | 3300005539 | Bacteria | 1973 |
| 54 | Ga0068853_100174501 | 3300005539 | Bacteria | 1946 |
| 55 | Ga0068853_100218047 | 3300005539 | Bacteria | 1741 |
| 56 | Ga0068853_100272856 | 3300005539 | Bacteria | 1558 |
| 57 | Ga0070696_100053539 | 3300005546 | Bacteria | 2809 |
| 58 | Ga0070665_100050963 | 3300005548 | Bacteria | 4153 |
| 59 | Ga0070665_100100174 | 3300005548 | Bacteria | 2901 |
| 60 | Ga0070665_100119517 | 3300005548 | Bacteria | 2637 |
| 61 | Ga0070665_100150908 | 3300005548 | Bacteria | 2327 |
| 62 | Ga0070704_100008118 | 3300005549 | Bacteria | 6276 |
| 63 | Ga0068855_100019340 | 3300005563 | Bacteria | 8183 |
| 64 | Ga0068855_100042552 | 3300005563 | Bacteria | 5381 |
| 65 | Ga0068855_100144104 | 3300005563 | Bacteria | 2713 |
| 66 | Ga0068855_100266977 | 3300005563 | Bacteria | 1904 |
| 67 | Ga0070664_100169249 | 3300005564 | Bacteria | 1938 |
| 68 | Ga0068857_100075965 | 3300005577 | Bacteria | 2995 |
| 69 | Ga0068857_100182935 | 3300005577 | Bacteria | 1907 |
| 70 | Ga0068854_100125445 | 3300005578 | Bacteria | 1954 |
| 71 | Ga0068854_100126712 | 3300005578 | Bacteria | 1945 |
| 72 | Ga0068856_100152498 | 3300005614 | Bacteria | 2320 |
| 73 | Ga0068856_100230315 | 3300005614 | Bacteria | 1868 |
| 74 | Ga0068852_100089766 | 3300005616 | Bacteria | 2747 |
| 75 | Ga0068866_10040218 | 3300005718 | Bacteria | 2313 |
| 76 | Ga0068851_10004835 | 3300005834 | Bacteria | 6095 |
| 77 | Ga0068858_100028222 | 3300005842 | Bacteria | 5214 |
| 78 | Ga0068858_100245500 | 3300005842 | Bacteria | 1700 |
| 79 | Ga0068860_100026198 | 3300005843 | Bacteria | 5622 |
| 80 | Ga0081455_10008528 | 3300005937 | Bacteria | 10640 |
| 81 | Ga0081455_10008869 | 3300005937 | Bacteria | 10399 |
| 82 | Ga0081540_1004841 | 3300005983 | Bacteria | 10144 |
| 83 | Ga0081540_1005905 | 3300005983 | Bacteria | 9036 |
| 84 | Ga0081540_1009855 | 3300005983 | Bacteria | 6531 |
| 85 | Ga0081539_10000597 | 3300005985 | Bacteria | 73805 |
| 86 | Ga0081539_10000735 | 3300005985 | Bacteria | 65597 |
| 87 | Ga0081539_10013306 | 3300005985 | Bacteria | 6210 |
| 88 | Ga0081539_10033563 | 3300005985 | Bacteria | 3122 |
| 89 | Ga0070717_10000297 | 3300006028 | Bacteria | 33338 |
| 90 | Ga0070717_10036246 | 3300006028 | Bacteria | 3999 |
| 91 | Ga0075365_10142987 | 3300006038 | Bacteria | 1661 |
| 92 | Ga0075363_100016047 | 3300006048 | Bacteria | 3694 |
| 93 | Ga0075363_100041613 | 3300006048 | Bacteria | 2424 |
| 94 | Ga0070715_10005158 | 3300006163 | Bacteria | 4339 |
| 95 | Ga0070716_100001393 | 3300006173 | Bacteria | 10721 |
| 96 | Ga0070716_100045273 | 3300006173 | Bacteria | 2469 |
| 97 | Ga0070712_100005370 | 3300006175 | Bacteria | 7935 |
| 98 | Ga0070712_100006220 | 3300006175 | Bacteria | 7388 |
| 99 | Ga0070712_100010554 | 3300006175 | Bacteria | 5832 |
| 100 | Ga0070712_100011725 | 3300006175 | Bacteria | 5568 |
| 101 | Ga0070712_100058839 | 3300006175 | Bacteria | 2704 |
| 102 | Ga0075362_10001513 | 3300006177 | Bacteria | 7478 |
| 103 | Ga0075367_10110137 | 3300006178 | Bacteria | 1689 |
| 104 | Ga0075366_10011078 | 3300006195 | Bacteria | 5080 |
| 105 | Ga0097621_100122698 | 3300006237 | Bacteria | 2205 |
| 106 | Ga0075370_10099694 | 3300006353 | Bacteria | 1680 |
| 107 | Ga0068871_100029523 | 3300006358 | Bacteria | 4307 |
| 108 | Ga0075431_100007067 | 3300006847 | Bacteria | 11151 |
| 109 | Ga0075431_100010451 | 3300006847 | Bacteria | 9333 |
| 110 | Ga0075433_10079274 | 3300006852 | Bacteria | 2894 |
| 111 | Ga0075434_100018441 | 3300006871 | Bacteria | 6743 |
| 112 | Ga0075434_100046859 | 3300006871 | Bacteria | 4289 |
| 113 | Ga0075429_100044375 | 3300006880 | Bacteria | 3867 |
| 114 | Ga0068865_100028670 | 3300006881 | Bacteria | 3687 |
| 115 | Ga0099825_1029851 | 3300006941 | Bacteria | 2481 |
| 116 | Ga0099824_1025839 | 3300006942 | Bacteria | 3139 |
| 117 | Ga0075435_100000827 | 3300007076 | Bacteria | 19283 |
| 118 | Ga0075435_100032914 | 3300007076 | Bacteria | 4097 |
| 119 | Ga0099795_10000521 | 3300007788 | Bacteria | 7219 |
| 120 | Ga0099795_10001501 | 3300007788 | Bacteria | 5093 |
| 121 | Ga0105240_10005341 | 3300009093 | Bacteria | 19162 |
| 122 | Ga0105240_10012605 | 3300009093 | Bacteria | 11658 |
| 123 | Ga0105240_10164491 | 3300009093 | Bacteria | 2632 |
| 124 | Ga0105240_10187496 | 3300009093 | Bacteria | 2435 |
| 125 | Ga0111539_10052427 | 3300009094 | Bacteria | 4856 |
| 126 | Ga0105245_10165592 | 3300009098 | Bacteria | 2101 |
| 127 | Ga0105245_10217310 | 3300009098 | Bacteria | 1842 |
| 128 | Ga0114129_10017485 | 3300009147 | Bacteria | 10210 |
| 129 | Ga0114129_10611758 | 3300009147 | Bacteria | 1410 |
| 130 | Ga0105243_10017871 | 3300009148 | Bacteria | 5365 |
| 131 | Ga0105241_10077937 | 3300009174 | Bacteria | 2588 |
| 132 | Ga0105241_10161752 | 3300009174 | Bacteria | 1841 |
| 133 | Ga0105248_10072817 | 3300009177 | Bacteria | 3862 |
| 134 | Ga0105237_10023811 | 3300009545 | Bacteria | 6268 |
| 135 | Ga0105237_10215828 | 3300009545 | Bacteria | 1918 |
| 136 | Ga0105238_10064921 | 3300009551 | Bacteria | 3651 |
| 137 | Ga0105238_10259151 | 3300009551 | Bacteria | 1718 |
| 138 | Ga0105249_10350717 | 3300009553 | Bacteria | 1495 |
| 139 | Ga0099796_10000086 | 3300010159 | Bacteria | 15528 |
| 140 | Ga0105239_10002676 | 3300010375 | Bacteria | 22436 |
| 141 | Ga0105239_10048001 | 3300010375 | Bacteria | 4680 |
| 142 | Ga0105239_10059881 | 3300010375 | Bacteria | 4178 |
| 143 | Ga0105239_10147202 | 3300010375 | Bacteria | 2628 |
| 144 | Ga0105246_10017870 | 3300011119 | Bacteria | 4512 |
| 145 | Ga0105246_10129020 | 3300011119 | Bacteria | 1885 |
| 146 | Ga0157370_10062573 | 3300013104 | Bacteria | 3528 |
| 147 | Ga0171462_1037 | 3300013250 | Bacteria | 78452 |
| 148 | Ga0157374_10010944 | 3300013296 | Bacteria | 7832 |
| 149 | Ga0157374_10013272 | 3300013296 | Bacteria | 7188 |
| 150 | Ga0157374_10105256 | 3300013296 | Bacteria | 2709 |
| 151 | Ga0157378_10006214 | 3300013297 | Bacteria | 10456 |
| 152 | Ga0157372_10240915 | 3300013307 | Bacteria | 2099 |
| 153 | Ga0157375_10178475 | 3300013308 | Bacteria | 2275 |
| 154 | Ga0157375_10312234 | 3300013308 | Bacteria | 1736 |
| 155 | Ga0163163_10006000 | 3300014325 | Bacteria | 10568 |
| 156 | Ga0163163_10040601 | 3300014325 | Bacteria | 4544 |
| 157 | Ga0163163_10246906 | 3300014325 | Bacteria | 1835 |
| 158 | Ga0163163_10325423 | 3300014325 | Bacteria | 1591 |
| 159 | Ga0157380_10075964 | 3300014326 | Bacteria | 2732 |
| 160 | Ga0197907_11280375 | 3300020069 | Bacteria | 3083 |
| 161 | Ga0206350_10193835 | 3300020080 | Bacteria | 1867 |
| 162 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 163 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 164 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 165 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 166 | Ga0213876_10001215 | 3300021384 | Bacteria | 16252 |
| 167 | Ga0228598_1000979 | 3300024227 | Bacteria | 6226 |
| 168 | Ga0209130_1000125 | 3300025284 | Bacteria | 124425 |
| 169 | Ga0209675_1001197 | 3300025291 | Bacteria | 15731 |
| 170 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 171 | Ga0209025_1001183 | 3300025294 | Bacteria | 36933 |
| 172 | Ga0209564_1000105 | 3300025295 | Bacteria | 218124 |
| 173 | Ga0209564_1000179 | 3300025295 | Bacteria | 151032 |
| 174 | Ga0209758_1002544 | 3300025297 | Bacteria | 18390 |
| 175 | Ga0209256_1000055 | 3300025299 | Bacteria | 295530 |
| 176 | Ga0209257_1017751 | 3300025304 | Bacteria | 2784 |
| 177 | Ga0207697_10012580 | 3300025315 | Bacteria | 3545 |
| 178 | Ga0207692_10000116 | 3300025898 | Bacteria | 23998 |
| 179 | Ga0207692_10001592 | 3300025898 | Bacteria | 8547 |
| 180 | Ga0207692_10074954 | 3300025898 | Bacteria | 1794 |
| 181 | Ga0207642_10023479 | 3300025899 | Bacteria | 2464 |
| 182 | Ga0207710_10007078 | 3300025900 | Bacteria | 4761 |
| 183 | Ga0207710_10011722 | 3300025900 | Bacteria | 3687 |
| 184 | Ga0207688_10115569 | 3300025901 | Bacteria | 1561 |
| 185 | Ga0207647_10011073 | 3300025904 | Bacteria | 6339 |
| 186 | Ga0207685_10002629 | 3300025905 | Bacteria | 4168 |
| 187 | Ga0207699_10007380 | 3300025906 | Bacteria | 5377 |
| 188 | Ga0207699_10009773 | 3300025906 | Bacteria | 4791 |
| 189 | Ga0207699_10148625 | 3300025906 | Bacteria | 1548 |
| 190 | Ga0207645_10076135 | 3300025907 | Bacteria | 2148 |
| 191 | Ga0207684_10058004 | 3300025910 | Bacteria | 3285 |
| 192 | Ga0207654_10000308 | 3300025911 | Bacteria | 29561 |
| 193 | Ga0207654_10008665 | 3300025911 | Bacteria | 5155 |
| 194 | Ga0207654_10091644 | 3300025911 | Bacteria | 1854 |
| 195 | Ga0207707_10034699 | 3300025912 | Bacteria | 4413 |
| 196 | Ga0207707_10060434 | 3300025912 | Bacteria | 3297 |
| 197 | Ga0207695_10001719 | 3300025913 | Bacteria | 35011 |
| 198 | Ga0207695_10001812 | 3300025913 | Bacteria | 33654 |
| 199 | Ga0207695_10015101 | 3300025913 | Bacteria | 9111 |
| 200 | Ga0207695_10141323 | 3300025913 | Bacteria | 2355 |
| 201 | Ga0207695_10277579 | 3300025913 | Bacteria | 1570 |
| 202 | Ga0207671_10008038 | 3300025914 | Bacteria | 9019 |
| 203 | Ga0207671_10026027 | 3300025914 | Bacteria | 4388 |
| 204 | Ga0207671_10043689 | 3300025914 | Bacteria | 3314 |
| 205 | Ga0207693_10000936 | 3300025915 | Bacteria | 26200 |
| 206 | Ga0207693_10015310 | 3300025915 | Bacteria | 6155 |
| 207 | Ga0207693_10055385 | 3300025915 | Bacteria | 3111 |
| 208 | Ga0207693_10089262 | 3300025915 | Bacteria | 2416 |
| 209 | Ga0207693_10097802 | 3300025915 | Bacteria | 2302 |
| 210 | Ga0207663_10001209 | 3300025916 | Bacteria | 11925 |
| 211 | Ga0207663_10004152 | 3300025916 | Bacteria | 7169 |
| 212 | Ga0207660_10098393 | 3300025917 | Bacteria | 2182 |
| 213 | Ga0207657_10121768 | 3300025919 | Bacteria | 2146 |
| 214 | Ga0207652_10011414 | 3300025921 | Bacteria | 7162 |
| 215 | Ga0207652_10053499 | 3300025921 | Bacteria | 3468 |
| 216 | Ga0207694_10000157 | 3300025924 | Bacteria | 70076 |
| 217 | Ga0207694_10070529 | 3300025924 | Bacteria | 2730 |
| 218 | Ga0207694_10137111 | 3300025924 | Bacteria | 1966 |
| 219 | Ga0207694_10175526 | 3300025924 | Bacteria | 1736 |
| 220 | Ga0207650_10005423 | 3300025925 | Bacteria | 8704 |
| 221 | Ga0207687_10135380 | 3300025927 | Bacteria | 1863 |
| 222 | Ga0207700_10000380 | 3300025928 | Bacteria | 25773 |
| 223 | Ga0207700_10034366 | 3300025928 | Bacteria | 3639 |
| 224 | Ga0207700_10058979 | 3300025928 | Bacteria | 2901 |
| 225 | Ga0207664_10003152 | 3300025929 | Bacteria | 10955 |
| 226 | Ga0207664_10008858 | 3300025929 | Bacteria | 7040 |
| 227 | Ga0207644_10113219 | 3300025931 | Bacteria | 2054 |
| 228 | Ga0207706_10171579 | 3300025933 | Bacteria | 1906 |
| 229 | Ga0207709_10003187 | 3300025935 | Bacteria | 9854 |
| 230 | Ga0207669_10025941 | 3300025937 | Bacteria | 3178 |
| 231 | Ga0207669_10077289 | 3300025937 | Bacteria | 2116 |
| 232 | Ga0207665_10001402 | 3300025939 | Bacteria | 16207 |
| 233 | Ga0207665_10035413 | 3300025939 | Bacteria | 3314 |
| 234 | Ga0207711_10058835 | 3300025941 | Bacteria | 3309 |
| 235 | Ga0207667_10008116 | 3300025949 | Bacteria | 12512 |
| 236 | Ga0207667_10092805 | 3300025949 | Bacteria | 3118 |
| 237 | Ga0207667_10151627 | 3300025949 | Bacteria | 2385 |
| 238 | Ga0207667_10229954 | 3300025949 | Bacteria | 1899 |
| 239 | Ga0207651_10003242 | 3300025960 | Bacteria | 7964 |
| 240 | Ga0207640_10060288 | 3300025981 | Bacteria | 2507 |
| 241 | Ga0207677_10063534 | 3300026023 | Bacteria | 2567 |
| 242 | Ga0207677_10093801 | 3300026023 | Bacteria | 2189 |
| 243 | Ga0207703_10077402 | 3300026035 | Bacteria | 2761 |
| 244 | Ga0207703_10096486 | 3300026035 | Bacteria | 2496 |
| 245 | Ga0207703_10170351 | 3300026035 | Bacteria | 1915 |
| 246 | Ga0207639_10010722 | 3300026041 | Bacteria | 6347 |
| 247 | Ga0207678_10077767 | 3300026067 | Bacteria | 2842 |
| 248 | Ga0207678_10171583 | 3300026067 | Bacteria | 1852 |
| 249 | Ga0207678_10227417 | 3300026067 | Bacteria | 1597 |
| 250 | Ga0207708_10032968 | 3300026075 | Bacteria | 3933 |
| 251 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 252 | Ga0207702_10009353 | 3300026078 | Bacteria | 8233 |
| 253 | Ga0207702_10026824 | 3300026078 | Bacteria | 4784 |
| 254 | Ga0207648_10066627 | 3300026089 | Bacteria | 3140 |
| 255 | Ga0207676_10146220 | 3300026095 | Bacteria | 2030 |
| 256 | Ga0207676_10153198 | 3300026095 | Bacteria | 1988 |
| 257 | Ga0207674_10009623 | 3300026116 | Bacteria | 11024 |
| 258 | Ga0207674_10075571 | 3300026116 | Bacteria | 3378 |
| 259 | Ga0207674_10274519 | 3300026116 | Bacteria | 1633 |
| 260 | Ga0207675_100011052 | 3300026118 | Bacteria | 8456 |
| 261 | Ga0207675_100021910 | 3300026118 | Bacteria | 5949 |
| 262 | Ga0207675_100241457 | 3300026118 | Bacteria | 1746 |
| 263 | Ga0207683_10190253 | 3300026121 | Bacteria | 1863 |
| 264 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 265 | Ga0209389_1000292 | 3300027296 | Bacteria | 31202 |
| 266 | Ga0209589_1001423 | 3300027357 | Bacteria | 39445 |
| 267 | Ga0209489_100096 | 3300027361 | Bacteria | 122075 |
| 268 | Ga0209489_100333 | 3300027361 | Bacteria | 82975 |
| 269 | Ga0209700_100062 | 3300027363 | Bacteria | 145471 |
| 270 | Ga0209179_1001675 | 3300027512 | Bacteria | 2801 |
| 271 | Ga0209968_1007374 | 3300027526 | Bacteria | 1664 |
| 272 | Ga0209971_1002819 | 3300027682 | Bacteria | 4152 |
| 273 | Ga0209974_10006149 | 3300027876 | Bacteria | 4206 |
| 274 | Ga0207428_10048166 | 3300027907 | Bacteria | 3420 |
| 275 | Ga0268266_10008946 | 3300028379 | Bacteria | 8862 |
| 276 | Ga0268266_10029812 | 3300028379 | Bacteria | 4635 |
| 277 | Ga0268266_10117217 | 3300028379 | Bacteria | 2366 |
| 278 | Ga0268266_10178603 | 3300028379 | Bacteria | 1931 |
| 279 | Ga0268266_10271922 | 3300028379 | Bacteria | 1573 |
| 280 | Ga0268264_10359309 | 3300028381 | Bacteria | 1389 |
| 281 | Ga0265340_10003545 | 3300031247 | Bacteria | 8783 |
| 282 | Ga0265331_10003122 | 3300031250 | Bacteria | 10827 |
| 283 | Ga0265327_10005683 | 3300031251 | Bacteria | 10314 |
| 284 | Ga0265316_10016635 | 3300031344 | Bacteria | 6375 |
| 285 | Ga0265342_10035774 | 3300031712 | Bacteria | 3036 |
| 286 | Ga0307406_10065258 | 3300031901 | Bacteria | 2365 |
| 287 | Ga0307406_10203175 | 3300031901 | Bacteria | 1460 |
| 288 | Ga0307411_10236984 | 3300032005 | Bacteria | 1426 |
| 289 | Ga0307510_10069887 | 3300033180 | Bacteria | 3512 |
| 290 | Ga0373923_0023152 | 3300035111 | Bacteria | 2442 |
| 291 | Ga0373936_0022889 | 3300035113 | Bacteria | 2433 |
| 292 | Ga0373945_0003120 | 3300035116 | Bacteria | 5203 |
| 293 | Ga0373945_0034614 | 3300035116 | Bacteria | 1801 |
| 294 | Ga0373953_0001976 | 3300035117 | Bacteria | 6102 |
| 295 | Ga0373954_0000070 | 3300035118 | Bacteria | 36271 |
| 296 | Ga0373956_0001764 | 3300035119 | Bacteria | 8915 |
| 297 | Ga0373957_0002936 | 3300035120 | Bacteria | 4940 |
| 298 | Ga0373955_0000771 | 3300035172 | Bacteria | 13748 |
| 299 | Ga0373924_0005902 | 3300035410 | Bacteria | 4365 |
| 300 | Ga0373924_0007507 | 3300035410 | Bacteria | 3939 |
| 301 | Ga0373931_0029484 | 3300035691 | Bacteria | 2817 |
| 302 | Ga0373935_0068712 | 3300035692 | Bacteria | 2280 |
| 303 | Ga0373927_0025168 | 3300035695 | Bacteria | 3891 |
| 304 | Ga0373933_0006540 | 3300035724 | Bacteria | 6349 |
| 305 | Ga0373947_0001951 | 3300035725 | Bacteria | 12629 |
| 306 | Ga0373947_0035703 | 3300035725 | Bacteria | 2944 |
| 307 | Ga0373947_0057404 | 3300035725 | Bacteria | 2355 |
| 308 | Ga0373937_0034207 | 3300036401 | Bacteria | 4622 |
| 309 | Ga0373925_0000183 | 3300037068 | Bacteria | 68921 |
| 310 | Ga0373925_0056552 | 3300037068 | Bacteria | 2939 |
| 311 | Ga0395905_0089264 | 3300037471 | Bacteria | 2889 |
| 312 | Ga0436364_0351634 | 3300037853 | Bacteria | 1494 |
| 313 | Ga0436364_0617696 | 3300037853 | Bacteria | 3167 |
| 314 | Ga0436365_0389941 | 3300039437 | Bacteria | 2445 |
| 315 | Ga0436365_0903497 | 3300039437 | Bacteria | 4459 |
| 316 | Ga0436365_1136865 | 3300039437 | Bacteria | 22786 |
| 317 | Ga0436365_1625412 | 3300039437 | Bacteria | 5828 |
| 318 | Ga0436365_1781597 | 3300039437 | Bacteria | 4648 |
| 319 | Ga0436360_0689838 | 3300039438 | Bacteria | 1882 |
| 320 | Ga0436360_1287647 | 3300039438 | Bacteria | 2821 |
| 321 | Ga0436363_0716857 | 3300039450 | Bacteria | 1750 |
| 322 | Ga0436363_0801798 | 3300039450 | Bacteria | 3203 |
| 323 | Ga0436362_0188545 | 3300039453 | Bacteria | 4150 |
| 324 | Ga0451577_0113078 | 3300042876 | Bacteria | 2430 |
| 325 | Ga0466969_0025258 | 3300044656 | Bacteria | 3056 |
| 326 | Ga0466972_0005717 | 3300044658 | Bacteria | 6232 |
| 327 | Ga0466966_0013591 | 3300044684 | Bacteria | 5385 |
| 328 | Ga0466963_0002381 | 3300044694 | Bacteria | 10510 |
| 329 | Ga0466963_0237853 | 3300044694 | Bacteria | 1277 |
| 330 | Ga0466971_0032723 | 3300044719 | Bacteria | 2330 |
| 331 | Ga0466968_0024730 | 3300044735 | Bacteria | 2456 |
| 332 | Ga0466960_0008985 | 3300044901 | Bacteria | 4107 |
| 333 | Ga0466959_0002189 | 3300045049 | Bacteria | 12429 |
| 334 | Ga0451576_0214044 | 3300045051 | Bacteria | 2012 |
| 335 | Ga0466958_0036218 | 3300045836 | Bacteria | 2953 |
| 336 | Ga0466967_0080868 | 3300045976 | Bacteria | 2934 |
| 337 | Ga0495592_0022090 | 3300046454 | Bacteria | 4840 |
| 338 | Ga0495592_0106036 | 3300046454 | Bacteria | 1995 |
| 339 | Ga0495603_0017433 | 3300046455 | Bacteria | 4345 |
| 340 | Ga0495603_0116667 | 3300046455 | Bacteria | 1556 |
| 341 | Ga0495629_0000005 | 3300046459 | Bacteria | 404868 |
| 342 | Ga0495629_0002263 | 3300046459 | Bacteria | 14836 |
| 343 | Ga0495629_0006304 | 3300046459 | Bacteria | 8802 |
| 344 | Ga0495629_0136933 | 3300046459 | Bacteria | 1704 |
| 345 | Ga0495629_0152292 | 3300046459 | Bacteria | 1607 |
| 346 | Ga0495638_0063568 | 3300046460 | Bacteria | 2275 |
| 347 | Ga0495641_0037933 | 3300046461 | Bacteria | 2254 |
| 348 | Ga0495651_0001805 | 3300046462 | Bacteria | 16510 |
| 349 | Ga0495651_0039119 | 3300046462 | Bacteria | 3692 |
| 350 | Ga0495651_0110241 | 3300046462 | Bacteria | 2036 |
| 351 | Ga0495653_0003677 | 3300046463 | Bacteria | 12388 |
| 352 | Ga0495653_0047853 | 3300046463 | Bacteria | 3305 |
| 353 | Ga0495653_0147798 | 3300046463 | Bacteria | 1645 |
| 354 | Ga0495580_0026326 | 3300046472 | Bacteria | 4242 |
| 355 | Ga0495639_0000842 | 3300046475 | Bacteria | 13990 |
| 356 | Ga0495662_0001038 | 3300046476 | Bacteria | 13621 |
| 357 | Ga0495664_0000168 | 3300046477 | Bacteria | 31977 |
| 358 | Ga0495664_0025332 | 3300046477 | Bacteria | 3453 |
| 359 | Ga0495664_0046258 | 3300046477 | Bacteria | 2582 |
| 360 | Ga0495584_0072545 | 3300046491 | Bacteria | 1730 |
| 361 | Ga0495594_0077008 | 3300046499 | Bacteria | 1860 |
| 362 | Ga0495596_0049332 | 3300046500 | Bacteria | 1650 |
| 363 | Ga0495607_0049959 | 3300046501 | Bacteria | 2437 |
| 364 | Ga0495608_0001870 | 3300046511 | Bacteria | 15052 |
| 365 | Ga0495608_0006442 | 3300046511 | Bacteria | 8335 |
| 366 | Ga0495608_0152486 | 3300046511 | Bacteria | 1472 |
| 367 | Ga0495610_0027626 | 3300046512 | Bacteria | 3013 |
| 368 | Ga0495618_0017854 | 3300046514 | Bacteria | 4353 |
| 369 | Ga0495628_0002643 | 3300046516 | Bacteria | 16072 |
| 370 | Ga0495628_0013414 | 3300046516 | Bacteria | 6893 |
| 371 | Ga0495643_0009568 | 3300046522 | Bacteria | 6015 |
| 372 | Ga0495643_0025025 | 3300046522 | Bacteria | 3381 |
| 373 | Ga0495644_0055063 | 3300046523 | Bacteria | 1494 |
| 374 | Ga0495663_0011517 | 3300046525 | Bacteria | 2460 |
| 375 | Ga0495666_0000024 | 3300046526 | Bacteria | 57339 |
| 376 | Ga0495652_0031409 | 3300046529 | Bacteria | 4651 |
| 377 | Ga0495652_0089619 | 3300046529 | Bacteria | 2518 |
| 378 | Ga0495640_0002929 | 3300046533 | Bacteria | 13739 |
| 379 | Ga0495640_0095851 | 3300046533 | Bacteria | 1952 |
| 380 | Ga0495586_0001169 | 3300046535 | Bacteria | 14718 |
| 381 | Ga0495586_0048074 | 3300046535 | Bacteria | 2304 |
| 382 | Ga0495587_0001351 | 3300046536 | Bacteria | 16275 |
| 383 | Ga0495587_0008371 | 3300046536 | Bacteria | 6655 |
| 384 | Ga0495621_0013236 | 3300046539 | Bacteria | 2588 |
| 385 | Ga0495645_0003263 | 3300046543 | Bacteria | 11010 |
| 386 | Ga0495645_0008453 | 3300046543 | Bacteria | 7190 |
| 387 | Ga0495645_0016949 | 3300046543 | Bacteria | 5213 |
| 388 | Ga0495645_0024685 | 3300046543 | Bacteria | 4362 |
| 389 | Ga0495622_0011772 | 3300046557 | Bacteria | 4044 |
| 390 | Ga0495667_0000926 | 3300046559 | Bacteria | 18989 |
| 391 | Ga0495667_0028061 | 3300046559 | Bacteria | 3790 |
| 392 | Ga0495667_0131178 | 3300046559 | Bacteria | 1616 |
| 393 | Ga0495656_0020832 | 3300046615 | Bacteria | 2547 |
| 394 | Ga0495634_0003658 | 3300046642 | Bacteria | 12265 |
| 395 | Ga0495634_0007605 | 3300046642 | Bacteria | 8118 |
| 396 | Ga0495634_0008514 | 3300046642 | Bacteria | 7627 |
| 397 | Ga0495634_0061030 | 3300046642 | Bacteria | 2508 |
| 398 | Ga0495635_0004011 | 3300046663 | Bacteria | 10224 |
| 399 | Ga0495635_0004483 | 3300046663 | Bacteria | 9674 |
| 400 | Ga0495635_0058336 | 3300046663 | Bacteria | 2655 |
| 401 | Ga0495588_0030709 | 3300046674 | Bacteria | 2702 |
| 402 | Ga0495657_0001016 | 3300046675 | Bacteria | 24742 |
| 403 | Ga0495657_0052531 | 3300046675 | Bacteria | 2731 |
| 404 | Ga0495599_0000637 | 3300046678 | Bacteria | 19794 |
| 405 | Ga0495623_0003015 | 3300046679 | Bacteria | 11083 |
| 406 | Ga0495623_0005023 | 3300046679 | Bacteria | 8674 |
| 407 | Ga0495623_0096301 | 3300046679 | Bacteria | 1808 |
| 408 | Ga0495646_0001926 | 3300046680 | Bacteria | 12482 |
| 409 | Ga0495646_0033730 | 3300046680 | Bacteria | 3182 |
| 410 | Ga0495646_0079815 | 3300046680 | Bacteria | 1909 |
| 411 | Ga0495647_0013552 | 3300046681 | Bacteria | 2827 |
| 412 | Ga0495613_0074181 | 3300046689 | Bacteria | 2478 |
| 413 | Ga0495600_0002398 | 3300046809 | Bacteria | 10736 |
| 414 | Ga0495581_0007505 | 3300047315 | Bacteria | 6307 |
| 415 | Ga0495604_0013258 | 3300047317 | Bacteria | 6565 |
| 416 | Ga0495604_0032291 | 3300047317 | Bacteria | 4151 |
| 417 | Ga0495604_0034842 | 3300047317 | Bacteria | 3979 |
| 418 | Ga0495674_0000138 | 3300047319 | Bacteria | 55916 |
| 419 | Ga0495674_0011842 | 3300047319 | Bacteria | 8222 |
| 420 | Ga0495672_0000437 | 3300047320 | Bacteria | 49739 |
| 421 | Ga0495672_0049705 | 3300047320 | Bacteria | 2480 |
| 422 | Ga0495676_0001542 | 3300047321 | Bacteria | 19955 |
| 423 | Ga0495676_0036897 | 3300047321 | Bacteria | 4076 |
| 424 | Ga0495676_0049376 | 3300047321 | Bacteria | 3384 |
| 425 | Ga0495680_0004188 | 3300047322 | Bacteria | 13854 |
| 426 | Ga0495680_0013222 | 3300047322 | Bacteria | 7211 |
| 427 | Ga0495680_0015409 | 3300047322 | Bacteria | 6597 |
| 428 | Ga0495683_0072960 | 3300047323 | Bacteria | 1684 |
| 429 | Ga0495687_005957 | 3300047443 | Bacteria | 7606 |
| 430 | Ga0495675_0001543 | 3300047444 | Bacteria | 13904 |
| 431 | Ga0495675_0035239 | 3300047444 | Bacteria | 3197 |
| 432 | Ga0495677_0017922 | 3300047445 | Bacteria | 2567 |
| 433 | Ga0495673_0019085 | 3300047469 | Bacteria | 3442 |
| 434 | Ga0495684_0000380 | 3300047471 | Bacteria | 36351 |
| 435 | Ga0495593_0001866 | 3300047673 | Bacteria | 12550 |
| 436 | Ga0495593_0075992 | 3300047673 | Bacteria | 1741 |
| 437 | Ga0495602_0010536 | 3300048088 | Bacteria | 9594 |
| 438 | Ga0495602_0053726 | 3300048088 | Bacteria | 3564 |
| 439 | Ga0495614_0034246 | 3300048089 | Bacteria | 2184 |
| 440 | Ga0496100_0020098 | 3300048903 | Bacteria | 3998 |
| 441 | Ga0496100_0048366 | 3300048903 | Bacteria | 2745 |
| 442 | Ga0496100_0113210 | 3300048903 | Bacteria | 1888 |
| 443 | Ga0496101_0130235 | 3300048904 | Bacteria | 1910 |
| 444 | Ga0496102_0003736 | 3300048905 | Bacteria | 12868 |
| 445 | Ga0496102_0032222 | 3300048905 | Bacteria | 4709 |
| 446 | Ga0496102_0225135 | 3300048905 | Bacteria | 1768 |
| 447 | Ga0496102_0229928 | 3300048905 | Bacteria | 1748 |
| 448 | Ga0496102_0242557 | 3300048905 | Bacteria | 1699 |
| 449 | Ga0496103_0002281 | 3300048906 | Bacteria | 12123 |
| 450 | Ga0496103_0092083 | 3300048906 | Bacteria | 1913 |
| 451 | Ga0496104_0000035 | 3300048907 | Bacteria | 181792 |
| 452 | Ga0496104_0003085 | 3300048907 | Bacteria | 14356 |
| 453 | Ga0496104_0004213 | 3300048907 | Bacteria | 12488 |
| 454 | Ga0496104_0014054 | 3300048907 | Bacteria | 7226 |
| 455 | Ga0496104_0108133 | 3300048907 | Bacteria | 2665 |
| 456 | Ga0496104_0138124 | 3300048907 | Bacteria | 2342 |
| 457 | Ga0496104_0209020 | 3300048907 | Bacteria | 1863 |
| 458 | Ga0496105_0000029 | 3300048908 | Bacteria | 139338 |
| 459 | Ga0496105_0000279 | 3300048908 | Bacteria | 33711 |
| 460 | Ga0496105_0034896 | 3300048908 | Bacteria | 4139 |
| 461 | Ga0496105_0057759 | 3300048908 | Bacteria | 3203 |
| 462 | Ga0496105_0184635 | 3300048908 | Bacteria | 1707 |
| 463 | Ga0496105_0235873 | 3300048908 | Bacteria | 1485 |
| 464 | Ga0496106_0076211 | 3300048909 | Bacteria | 2570 |
| 465 | Ga0496106_0222586 | 3300048909 | Bacteria | 1505 |
| 466 | Ga0496107_0015807 | 3300048910 | Bacteria | 5294 |
| 467 | Ga0496107_0058123 | 3300048910 | Bacteria | 2796 |
| 468 | Ga0496107_0089789 | 3300048910 | Bacteria | 2244 |
| 469 | Ga0496107_0262791 | 3300048910 | Bacteria | 1284 |
| 470 | Ga0496108_0057566 | 3300048911 | Bacteria | 3266 |
| 471 | Ga0496108_0075853 | 3300048911 | Bacteria | 2841 |
| 472 | Ga0496108_0095615 | 3300048911 | Bacteria | 2530 |
| 473 | Ga0496108_0322718 | 3300048911 | Bacteria | 1346 |
| 474 | Ga0496108_0324142 | 3300048911 | Bacteria | 1343 |
| 475 | Ga0496109_0015089 | 3300048912 | Bacteria | 6724 |
| 476 | Ga0496109_0093643 | 3300048912 | Bacteria | 2780 |
| 477 | Ga0496109_0140849 | 3300048912 | Bacteria | 2255 |
| 478 | Ga0496110_0018675 | 3300048913 | Bacteria | 5818 |
| 479 | Ga0496110_0064949 | 3300048913 | Bacteria | 3226 |
| 480 | Ga0496110_0225231 | 3300048913 | Bacteria | 1705 |
| 481 | Ga0496110_0462982 | 3300048913 | Bacteria | 1155 |
| 482 | Ga0496111_0023631 | 3300048914 | Bacteria | 4318 |
| 483 | Ga0496111_0071890 | 3300048914 | Bacteria | 2518 |
| 484 | Ga0496111_0102036 | 3300048914 | Bacteria | 2108 |
| 485 | Ga0496111_0151566 | 3300048914 | Bacteria | 1719 |
| 486 | Ga0496112_0005015 | 3300048915 | Bacteria | 11365 |
| 487 | Ga0496112_0005456 | 3300048915 | Bacteria | 11004 |
| 488 | Ga0496112_0011944 | 3300048915 | Bacteria | 7958 |
| 489 | Ga0496112_0060843 | 3300048915 | Bacteria | 3721 |
| 490 | Ga0496112_0102019 | 3300048915 | Bacteria | 2839 |
| 491 | Ga0496113_0002755 | 3300048916 | Bacteria | 10329 |
| 492 | Ga0496113_0084898 | 3300048916 | Bacteria | 2431 |
| 493 | Ga0496113_0097950 | 3300048916 | Bacteria | 2269 |
| 494 | Ga0496113_0162957 | 3300048916 | Bacteria | 1763 |
| 495 | Ga0496113_0225831 | 3300048916 | Bacteria | 1493 |
| 496 | Ga0496114_0026635 | 3300048917 | Bacteria | 4735 |
| 497 | Ga0496114_0056707 | 3300048917 | Bacteria | 3270 |
| 498 | Ga0496114_0066371 | 3300048917 | Bacteria | 3025 |
| 499 | Ga0496115_0001490 | 3300048918 | Bacteria | 16832 |
| 500 | Ga0496115_0027232 | 3300048918 | Bacteria | 4469 |
| 501 | Ga0496115_0183061 | 3300048918 | Bacteria | 1731 |
| 502 | Ga0496115_0199642 | 3300048918 | Bacteria | 1652 |
| 503 | Ga0496115_0239386 | 3300048918 | Bacteria | 1496 |
| 504 | Ga0496117_0035460 | 3300048920 | Bacteria | 3744 |
| 505 | Ga0496117_0039537 | 3300048920 | Bacteria | 3480 |
| 506 | Ga0496118_0141233 | 3300048921 | Bacteria | 1526 |
| 507 | Ga0496118_0142351 | 3300048921 | Bacteria | 1517 |
| 508 | Ga0496119_0004200 | 3300048922 | Bacteria | 14477 |
| 509 | Ga0496119_0013974 | 3300048922 | Bacteria | 6328 |
| 510 | Ga0496120_0016201 | 3300048923 | Bacteria | 4878 |
| 511 | Ga0496121_0001335 | 3300048924 | Bacteria | 42241 |
| 512 | Ga0496121_0062065 | 3300048924 | Bacteria | 3063 |
| 513 | Ga0496121_0081839 | 3300048924 | Bacteria | 2554 |
| 514 | Ga0496121_0147726 | 3300048924 | Bacteria | 1734 |
| 515 | Ga0496122_0038402 | 3300048925 | Bacteria | 3837 |
| 516 | Ga0496122_0083768 | 3300048925 | Bacteria | 2209 |
| 517 | Ga0496123_0044483 | 3300048926 | Bacteria | 3036 |
| 518 | Ga0496124_0086603 | 3300048927 | Bacteria | 2563 |
| 519 | Ga0496125_0017244 | 3300048928 | Bacteria | 6898 |
| 520 | Ga0496125_0066790 | 3300048928 | Bacteria | 2839 |
| 521 | Ga0496126_0033274 | 3300048929 | Bacteria | 4850 |
| 522 | Ga0496126_0118098 | 3300048929 | Bacteria | 2303 |
| 523 | Ga0496126_0277399 | 3300048929 | Bacteria | 1389 |
| 524 | Ga0501033_0059632 | 3300049570 | Bacteria | 2818 |
| 525 | Ga0501034_0069571 | 3300049571 | Bacteria | 3531 |
| 526 | Ga0501038_0143722 | 3300049574 | Bacteria | 1950 |
| 527 | Ga0501039_0019916 | 3300049575 | Bacteria | 5143 |
| 528 | Ga0501041_0057803 | 3300049577 | Bacteria | 2372 |
| 529 | Ga0501046_0145826 | 3300049580 | Bacteria | 1788 |
| 530 | Ga0501067_0018349 | 3300049583 | Bacteria | 3876 |
| 531 | Ga0501069_0002306 | 3300049585 | Bacteria | 9628 |
| 532 | Ga0501070_0010686 | 3300049586 | Bacteria | 7762 |
| 533 | Ga0501070_0018160 | 3300049586 | Bacteria | 5899 |
| 534 | Ga0501071_0063145 | 3300049587 | Bacteria | 2685 |
| 535 | Ga0501072_0016161 | 3300049588 | Bacteria | 5725 |
| 536 | Ga0501072_0099754 | 3300049588 | Bacteria | 2308 |
| 537 | Ga0501073_0028653 | 3300049589 | Bacteria | 3979 |
| 538 | Ga0501073_0030390 | 3300049589 | Bacteria | 3857 |
| 539 | Ga0501074_0170349 | 3300049590 | Bacteria | 1554 |
| 540 | Ga0501076_0104514 | 3300049592 | Bacteria | 2285 |
| 541 | Ga0501077_0026564 | 3300049593 | Bacteria | 3674 |
| 542 | Ga0501079_0086329 | 3300049741 | Bacteria | 2429 |
| 543 | Ga0501080_0108722 | 3300049742 | Bacteria | 2570 |
| 544 | Ga0501081_0044304 | 3300049743 | Bacteria | 3054 |
| 545 | Ga0501083_0094571 | 3300049744 | Bacteria | 1973 |
| 546 | Ga0501035_0158737 | 3300049822 | Bacteria | 1959 |
| 547 | Ga0501044_0051380 | 3300049823 | Bacteria | 4250 |
| 548 | Ga0501045_0012068 | 3300049824 | Bacteria | 6077 |
| 549 | nmdc:mga03683_6669_c1 | 3300050489 | Bacteria | 3966 |
| 550 | nmdc:mga03n38_5710_c1 | 3300050490 | Bacteria | 4264 |
| 551 | nmdc:mga06z11_61277_c1 | 3300050494 | Bacteria | 1962 |
| 552 | nmdc:mga05p37_53000_c1 | 3300050507 | Bacteria | 4989 |
| 553 | nmdc:mga06r32_33248_c1 | 3300050510 | Bacteria | 4857 |
| 554 | nmdc:mga06r32_370813_c1 | 3300050510 | Bacteria | 1415 |
| 555 | nmdc:mga08y16_126616_c1 | 3300050511 | Bacteria | 2657 |
| 556 | nmdc:mga0n895_2487_c1 | 3300050512 | Bacteria | 14415 |
| 557 | nmdc:mga0n895_82764_c1 | 3300050512 | Bacteria | 3199 |
| 558 | nmdc:mga0n895_83942_c1 | 3300050512 | Bacteria | 3178 |
| 559 | nmdc:mga0n895_87383_c1 | 3300050512 | Bacteria | 3115 |
| 560 | nmdc:mga0n895_98008_c1 | 3300050512 | Bacteria | 2938 |
| 561 | nmdc:mga0rr50_26478_c1 | 3300050513 | Bacteria | 4047 |
| 562 | nmdc:mga0rr50_56681_c1 | 3300050513 | Bacteria | 2928 |
| 563 | nmdc:mga0rr50_88078_c1 | 3300050513 | Bacteria | 2411 |
| 564 | nmdc:mga08x19_136569_c1 | 3300050514 | Bacteria | 1653 |
| 565 | nmdc:mga08x19_54355_c1 | 3300050514 | Bacteria | 2577 |
| 566 | nmdc:mga0a205_134501_c1 | 3300050515 | Bacteria | 2373 |
| 567 | nmdc:mga0a205_134526_c1 | 3300050515 | Bacteria | 2372 |
| 568 | nmdc:mga0a205_2871_c1 | 3300050515 | Bacteria | 15239 |
| 569 | nmdc:mga0a205_348195_c1 | 3300050515 | Bacteria | 1349 |
| 570 | nmdc:mga0a205_99582_c1 | 3300050515 | Bacteria | 2805 |
| 571 | Ga0495601_0005765 | 3300053077 | Bacteria | 7224 |
| 572 | Ga0495612_0001072 | 3300053078 | Bacteria | 11201 |
| 573 | Ga0495595_0002657 | 3300053084 | Bacteria | 7012 |
| 574 | Ga0495595_0006491 | 3300053084 | Bacteria | 4773 |
| 575 | Ga0495619_0000355 | 3300053085 | Bacteria | 32054 |
| 576 | Ga0495619_0036614 | 3300053085 | Bacteria | 3195 |
| 577 | Ga0495619_0076078 | 3300053085 | Bacteria | 2253 |
| 578 | Ga0500643_000032 | 3300053087 | Bacteria | 200350 |
| 579 | Ga0500566_0000026 | 3300053094 | Bacteria | 77138 |
| 580 | Ga0500566_0001584 | 3300053094 | Bacteria | 13387 |
| 581 | Ga0500566_0008786 | 3300053094 | Bacteria | 5975 |
| 582 | Ga0500640_002218 | 3300053095 | Bacteria | 6337 |
| 583 | Ga0500555_005056 | 3300053103 | Bacteria | 3743 |
| 584 | Ga0500557_000087 | 3300053105 | Bacteria | 32155 |
| 585 | Ga0500595_009653 | 3300053119 | Bacteria | 3885 |
| 586 | Ga0500614_000135 | 3300053123 | Bacteria | 18032 |
| 587 | Ga0500642_0001017 | 3300053130 | Bacteria | 8061 |
| 588 | Ga0500652_034780 | 3300053131 | Bacteria | 1998 |
| 589 | Ga0500559_0004957 | 3300053136 | Bacteria | 6188 |
| 590 | Ga0500559_0010760 | 3300053136 | Bacteria | 3922 |
| 591 | Ga0500559_0038877 | 3300053136 | Bacteria | 2068 |
| 592 | Ga0500590_011029 | 3300053148 | Bacteria | 4574 |
| 593 | Ga0500603_000591 | 3300053150 | Bacteria | 9040 |
| 594 | Ga0500616_0015563 | 3300053153 | Bacteria | 4346 |
| 595 | Ga0500616_0038525 | 3300053153 | Bacteria | 2581 |
| 596 | Ga0500619_003290 | 3300053154 | Bacteria | 3284 |
| 597 | Ga0500622_0004721 | 3300053156 | Bacteria | 8421 |
| 598 | Ga0500639_000939 | 3300053163 | Bacteria | 14837 |
| 599 | Ga0500636_0000978 | 3300053177 | Bacteria | 15335 |
| 600 | Ga0500636_0039374 | 3300053177 | Bacteria | 2795 |
| 601 | Ga0500637_0013976 | 3300053178 | Bacteria | 4223 |
| 602 | Ga0500637_0027839 | 3300053178 | Bacteria | 3122 |
| 603 | Ga0500625_007369 | 3300053729 | Bacteria | 4780 |
| 604 | Ga0500596_002113 | 3300053735 | Bacteria | 3960 |
| 605 | Ga0500601_000801 | 3300053737 | Bacteria | 3947 |
| 606 | Ga0501084_0050929 | 3300054114 | Bacteria | 3465 |
| 607 | Ga0530510_0081050 | 3300061734 | Bacteria | 2362 |
| 608 | 8057529777 | 8057529695 | Bacteria | 6306553 |
| 609 | 2509150578 | 2508501128 | Bacteria | 8613869 |
| 610 | 2513625501 | 2513237092 | Bacteria | 8341956 |
| 611 | 2513644502 | 2513237094 | Bacteria | 8789602 |
| 612 | 2513658049 | 2513237096 | Bacteria | 8722461 |
| 613 | 2513703767 | 2513237102 | Bacteria | 7703324 |
| 614 | 2513717176 | 2513237104 | Bacteria | 10034502 |
| 615 | 2513872891 | 2513237139 | Bacteria | 8737671 |
| 616 | 2513919857 | 2513237145 | Bacteria | 8979722 |
| 617 | 2517107454 | 2517093001 | Bacteria | 9002274 |
| 618 | 2517892291 | 2517572143 | Bacteria | 9484767 |
| 619 | 2528849947 | 2528768022 | Bacteria | 10457665 |
| 620 | 2617375644 | 2617270741 | Bacteria | 8201522 |
| 621 | 2644728719 | 2643221733 | Bacteria | 5690728 |
| 622 | 2644735931 | 2643221734 | Bacteria | 5365412 |
| 623 | 2644747204 | 2643221736 | Bacteria | 6608466 |
| 624 | 2723844935 | 2721755755 | Bacteria | 8322773 |
| 625 | 2728747354 | 2728368998 | Bacteria | 8720350 |
| 626 | 2793065384 | 2791355196 | Bacteria | 7323613 |
| 627 | 2793072366 | 2791355197 | Bacteria | 8420563 |
| 628 | 2793082193 | |||
| 629 | 2805915211 | 2802429603 | Bacteria | 8777136 |
| 630 | 2819718137 | 2818991467 | Bacteria | 5893227 |
| 631 | 2824608905 | 2824600985 | Bacteria | 8488197 |
| 632 | 2824617684 | 2824609381 | Bacteria | 8672835 |
| 633 | 2824626133 | 2824617872 | Bacteria | 8814715 |
| 634 | 2824635070 | 2824626560 | Bacteria | 8813858 |
| 635 | 2824643803 | 2824635225 | Bacteria | 8785348 |
| 636 | 2824652498 | 2824644064 | Bacteria | 8743947 |
| 637 | 2824661118 | 2824653114 | Bacteria | 8493680 |
| 638 | 2824670952 | 2824661429 | Bacteria | 9877870 |
| 639 | 2824686735 | 2824679649 | Bacteria | 8248951 |
| 640 | 2824703550 | 2824696289 | Bacteria | 8335049 |
| 641 | 2824722987 | 2824714736 | Bacteria | 8717648 |
| 642 | 2824731795 | 2824723954 | Bacteria | 8758240 |
| 643 | 2824739442 | 2824732956 | Bacteria | 7810675 |
| 644 | 2824753446 | 2824746037 | Bacteria | 7911610 |
| 645 | 2838123618 | 2838122688 | Bacteria | 8803140 |
| 646 | 2841762060 | 2841760612 | Bacteria | 6454112 |
| 647 | 2841916513 | 2841911363 | Bacteria | 6173697 |
| 648 | 2841922410 | 2841917233 | Bacteria | 6173500 |
| 649 | 2841946738 | 2841941048 | Bacteria | 8688029 |
| 650 | 2841949717 | 2841949485 | Bacteria | 8680857 |
| 651 | 2841958786 | 2841957949 | Bacteria | 8652217 |
| 652 | 2841971777 | 2841966195 | Bacteria | 8673214 |
| 653 | 2841974878 | 2841974524 | Bacteria | 8931498 |
| 654 | 2841983559 | 2841983080 | Bacteria | 8395090 |
| 655 | 2842038937 | 2842038055 | Bacteria | 8002051 |
| 656 | 2842048117 | 2842045827 | Bacteria | 8006841 |
| 657 | 2844105085 | 2844104063 | Bacteria | 6440972 |
| 658 | 2844319200 | 2844315083 | Bacteria | 8138177 |
| 659 | 2847936343 | 2847930680 | Bacteria | 9342022 |
| 660 | 2847946690 | 2847939898 | Bacteria | 8606328 |
| 661 | 2851183435 | 2851182111 | Bacteria | 6047226 |
| 662 | 2851248073 | 2851246043 | Bacteria | 6439203 |
| 663 | 2857514183 | 2857509624 | Bacteria | 7472071 |
| 664 | 2874615052 | 2874612657 | Bacteria | 8252029 |
| 665 | 2876764635 | 2876761206 | Bacteria | 10111113 |
| 666 | 2879090581 | 2879083081 | Bacteria | 8587928 |
| 667 | 2879105783 | 2879099564 | Bacteria | 10442239 |
| 668 | 2881368709 | 2881364244 | Bacteria | 7710352 |
| 669 | 2881673550 | 2881665667 | Bacteria | 8175609 |
| 670 | 2885411379 | 2885409591 | Bacteria | 9235467 |
| 671 | 2888384191 | 2888378607 | Bacteria | 9652610 |
| 672 | 2888424659 | 2888419890 | Bacteria | 7857137 |
| 673 | 2891091442 | 2891088606 | Bacteria | 4762464 |
| 674 | 2903731042 | 2903727486 | Bacteria | 8281579 |
| 675 | 2906608177 | 2906602504 | Bacteria | 8295279 |
| 676 | 2906626934 | 2906626472 | Bacteria | 8826946 |
| 677 | 2906637435 | 2906635258 | Bacteria | 8601019 |
| 678 | 2906649203 | 2906643746 | Bacteria | 8722424 |
| 679 | 2906666266 | 2906660503 | Bacteria | 8595048 |
| 680 | 2908780307 | 2908775508 | Bacteria | 8092255 |
| 681 | 2917699457 | 2917699015 | Bacteria | 7043791 |
| 682 | 2922365490 | 2922361189 | Bacteria | 7436256 |
| 683 | 2922374532 | |||
| 684 | 2922391113 | 2922386360 | Bacteria | 7017218 |
| 685 | 2922400672 | 2922393267 | Bacteria | 8285685 |
| 686 | 2929632386 | 2929624759 | Bacteria | 9339455 |
| 687 | 2932790492 | 2932784394 | Bacteria | 9704911 |
| 688 | 2932799830 | 2932794094 | Bacteria | 7915132 |
| 689 | 2932802671 | 2932801729 | Bacteria | 7987968 |
| 690 | 2932810913 | 2932809354 | Bacteria | 9135765 |
| 691 | 2932823757 | 2932818245 | Bacteria | 9955613 |
| 692 | 2932830123 | 2932828146 | Bacteria | 9745859 |
| 693 | 2935622651 | 2935616580 | Bacteria | 9032984 |
| 694 | 2935642549 | 2935638405 | Bacteria | 10015038 |
| 695 | 2935668147 | 2935665750 | Bacteria | 9571747 |
| 696 | 2935676181 | 2935675223 | Bacteria | 9928132 |
| 697 | 2935686163 | 2935684952 | Bacteria | 9590419 |
| 698 | 2935701210 | 2935694250 | Bacteria | 9291695 |
| 699 | 2935706007 | 2935703347 | Bacteria | 10242284 |
| 700 | 2935714715 | 2935713505 | Bacteria | 9608509 |
| 701 | 2935725334 | 2935722832 | Bacteria | 9608746 |
| 702 | 2935732306 | 2935732158 | Bacteria | 9706831 |
| 703 | 2935741685 | 2935741537 | Bacteria | 9707219 |
| 704 | 2935752128 | 2935750917 | Bacteria | 9590372 |
| 705 | 2935766477 | 2935760218 | Bacteria | 9817913 |
| 706 | 2935771923 | 2935769743 | Bacteria | 7878163 |
| 707 | 2935778645 | 2935777560 | Bacteria | 8077691 |
| 708 | 2935788969 | 2935785616 | Bacteria | 7962367 |
| 709 | 2935795230 | 2935793552 | Bacteria | 8012592 |
| 710 | 2935803006 | 2935801545 | Bacteria | 9301974 |
| 711 | 2935814323 | 2935810662 | Bacteria | 9401221 |
| 712 | 2935831460 | 2935827899 | Bacteria | 10038562 |
| 713 | 2935838320 | 2935837841 | Bacteria | 9454360 |
| 714 | 2935860900 | 2935855204 | Bacteria | 9035059 |
| 715 | 2935869763 | 2935864058 | Bacteria | 9784707 |
| 716 | 2935878818 | 2935873716 | Bacteria | 9632195 |
| 717 | 2935886957 | 2935883170 | Bacteria | 7964738 |
| 718 | 2935994786 | 2935992306 | Bacteria | 9802711 |
| 719 | 2936003428 | 2936002035 | Bacteria | 9362176 |
| 720 | 2936039879 | 2936037263 | Bacteria | 9446081 |
| 721 | 2940557069 | 2940556831 | Bacteria | 9590747 |
| 722 | 2941532944 | 2941531003 | Bacteria | 7653939 |
| 723 | 2941539012 | 2941538514 | Bacteria | 9402094 |
| 724 | 3005484440 | 3005483717 | Bacteria | 7877331 |
| 725 | 3005510449 | 3005506211 | Bacteria | 6943378 |
| 726 | 3005587914 | 3005587118 | Bacteria | 7794411 |
| 727 | 3005599365 | 3005594810 | Bacteria | 8716512 |
| 728 | 3005715028 | 3005710791 | Bacteria | 7622528 |
| 729 | 3005722442 | 3005718088 | Bacteria | 8283608 |
| 730 | 8006931848 | 8006926726 | Bacteria | 6749210 |
| 731 | 8006967188 | 8006964411 | Bacteria | 8966052 |
| 732 | 8016522189 | 8016511872 | Bacteria | 9921665 |
| 733 | 8016529499 | 8016522445 | Bacteria | 8156687 |
| 734 | 8016534709 | 8016530956 | Bacteria | 8155261 |
| 735 | 8016547926 | 8016539877 | Bacteria | 8155419 |
| 736 | 8016554204 | 8016548790 | Bacteria | 8155074 |
| 737 | 8016562579 | 8016557553 | Bacteria | 8154380 |
| 738 | 8016573059 | 8016566248 | Bacteria | 8158151 |
| 739 | 8016577205 | 8016575299 | Bacteria | 8154085 |
| 740 | 8016591609 | 8016583857 | Bacteria | 10421953 |
| 741 | 8016600367 | 8016595262 | Bacteria | 8149947 |
| 742 | 8016610371 | 8016603502 | Bacteria | 8731218 |
| 743 | 8016614560 | 8016613128 | Bacteria | 8794220 |
| 744 | 8016626440 | 8016622563 | Bacteria | 7999408 |
| 745 | 8017063481 | 8017057580 | Bacteria | 10023680 |
| 746 | 8019534476 | 8019530166 | Bacteria | 8155624 |
| 747 | 8019544996 | 8019538911 | Bacteria | 7872763 |
| 748 | 8019553532 | 8019547302 | Bacteria | 7996444 |
| 749 | 8019582800 | 8019576017 | Bacteria | 10049540 |
| 750 | 8019590590 | 8019586578 | Bacteria | 10212056 |
| 751 | 8019600762 | 8019597564 | Bacteria | 10041141 |
| 752 | 8019617790 | 8019608314 | Bacteria | 10042931 |
| 753 | 8019658536 | 8019648815 | Bacteria | 10014479 |
| 754 | 8056968158 | 8056967851 | Bacteria | 9038162 |
| 755 | JGI24740J21852_10013233 | |||
| 756 | JGI24737J22298_10008734 | |||
| 757 | JGI24735J21928_10014231 | |||
| 758 | JGI25151J46595_10000136 | |||
| 759 | JGI25151J46595_10000217 | |||
| 760 | Ga0055526_1000896 | |||
| 761 | Ga0055526_1000904 | |||
| 762 | Ga0055524_1000078 | |||
| 763 | Ga0055543_1004114 | |||
| 764 | Ga0058859_11782272 | |||
| 765 | Ga0058860_12209077 | |||
| 766 | Ga0065165_1000072 | |||
| 767 | Ga0065165_1002278 | |||
| 768 | Ga0065712_10000361 | |||
| 769 | Ga0065715_10000318 | |||
| 770 | Ga0070676_10024166 | |||
| 771 | Ga0070676_10052658 | |||
| 772 | Ga0070676_10112763 | |||
| 773 | Ga0070670_100013797 | |||
| 774 | Ga0068869_100163677 | |||
| 775 | Ga0070680_100116556 | |||
| 776 | Ga0070680_100270185 | |||
| 777 | Ga0068868_100030944 | |||
| 778 | Ga0070689_100139626 | |||
| 779 | Ga0070687_100054905 | |||
| 780 | Ga0070671_100007858 | |||
| 781 | Ga0070674_100082407 | |||
| 782 | Ga0070673_100258065 | |||
| 783 | Ga0070667_100081780 | |||
| 784 | Ga0070703_10009308 | |||
| 785 | Ga0070709_10000348 | |||
| 786 | Ga0070709_10013740 | |||
| 787 | Ga0070714_100000490 | |||
| 788 | Ga0070714_100008940 | |||
| 789 | Ga0070714_100067032 | |||
| 790 | Ga0070713_100000278 | |||
| 791 | Ga0070710_10001018 | |||
| 792 | Ga0070710_10003676 | |||
| 793 | Ga0070711_100003976 | |||
| 794 | Ga0070711_100017385 | |||
| 795 | Ga0070711_100104917 | |||
| 796 | Ga0070705_100056890 | |||
| 797 | Ga0070694_100007125 | |||
| 798 | Ga0070663_100040237 | |||
| 799 | Ga0070663_100047985 | |||
| 800 | Ga0070678_100057626 | |||
| 801 | Ga0070662_100060596 | |||
| 802 | Ga0070662_100125746 | |||
| 803 | Ga0070681_10040909 | |||
| 804 | Ga0068867_100046303 | |||
| 805 | Ga0070697_100000080 | |||
| 806 | Ga0070697_100194476 | |||
| 807 | Ga0068853_100169717 | |||
| 808 | Ga0068853_100174501 | |||
| 809 | Ga0068853_100218047 | |||
| 810 | Ga0068853_100272856 | |||
| 811 | Ga0070696_100053539 | |||
| 812 | Ga0070665_100050963 | |||
| 813 | Ga0070665_100100174 | |||
| 814 | Ga0070665_100119517 | |||
| 815 | Ga0070665_100150908 | |||
| 816 | Ga0070704_100008118 | |||
| 817 | Ga0068855_100019340 | |||
| 818 | Ga0068855_100042552 | |||
| 819 | Ga0068855_100144104 | |||
| 820 | Ga0068855_100266977 | |||
| 821 | Ga0070664_100169249 | |||
| 822 | Ga0068857_100075965 | |||
| 823 | Ga0068857_100182935 | |||
| 824 | Ga0068854_100125445 | |||
| 825 | Ga0068854_100126712 | |||
| 826 | Ga0068856_100152498 | |||
| 827 | Ga0068856_100230315 | |||
| 828 | Ga0068852_100089766 | |||
| 829 | Ga0068866_10040218 | |||
| 830 | Ga0068851_10004835 | |||
| 831 | Ga0068858_100028222 | |||
| 832 | Ga0068858_100245500 | |||
| 833 | Ga0068860_100026198 | |||
| 834 | Ga0081455_10008528 | |||
| 835 | Ga0081455_10008869 | |||
| 836 | Ga0081540_1004841 | |||
| 837 | Ga0081540_1005905 | |||
| 838 | Ga0081540_1009855 | |||
| 839 | Ga0081539_10000597 | |||
| 840 | Ga0081539_10000735 | |||
| 841 | Ga0081539_10013306 | |||
| 842 | Ga0081539_10033563 | |||
| 843 | Ga0070717_10000297 | |||
| 844 | Ga0070717_10036246 | |||
| 845 | Ga0075365_10142987 | |||
| 846 | Ga0075363_100016047 | |||
| 847 | Ga0075363_100041613 | |||
| 848 | Ga0070715_10005158 | |||
| 849 | Ga0070716_100001393 | |||
| 850 | Ga0070716_100045273 | |||
| 851 | Ga0070712_100005370 | |||
| 852 | Ga0070712_100006220 | |||
| 853 | Ga0070712_100010554 | |||
| 854 | Ga0070712_100011725 | |||
| 855 | Ga0070712_100058839 | |||
| 856 | Ga0075362_10001513 | |||
| 857 | Ga0075367_10110137 | |||
| 858 | Ga0075366_10011078 | |||
| 859 | Ga0097621_100122698 | |||
| 860 | Ga0075370_10099694 | |||
| 861 | Ga0068871_100029523 | |||
| 862 | Ga0075431_100007067 | |||
| 863 | Ga0075431_100010451 | |||
| 864 | Ga0075433_10079274 | |||
| 865 | Ga0075434_100018441 | |||
| 866 | Ga0075434_100046859 | |||
| 867 | Ga0075429_100044375 | |||
| 868 | Ga0068865_100028670 | |||
| 869 | Ga0099825_1029851 | |||
| 870 | Ga0099824_1025839 | |||
| 871 | Ga0075435_100000827 | |||
| 872 | Ga0075435_100032914 | |||
| 873 | Ga0099795_10000521 | |||
| 874 | Ga0099795_10001501 | |||
| 875 | Ga0105240_10005341 | |||
| 876 | Ga0105240_10012605 | |||
| 877 | Ga0105240_10164491 | |||
| 878 | Ga0105240_10187496 | |||
| 879 | Ga0111539_10052427 | |||
| 880 | Ga0105245_10165592 | |||
| 881 | Ga0105245_10217310 | |||
| 882 | Ga0114129_10017485 | |||
| 883 | Ga0114129_10611758 | |||
| 884 | Ga0105243_10017871 | |||
| 885 | Ga0105241_10077937 | |||
| 886 | Ga0105241_10161752 | |||
| 887 | Ga0105248_10072817 | |||
| 888 | Ga0105237_10023811 | |||
| 889 | Ga0105237_10215828 | |||
| 890 | Ga0105238_10064921 | |||
| 891 | Ga0105238_10259151 | |||
| 892 | Ga0105249_10350717 | |||
| 893 | Ga0099796_10000086 | |||
| 894 | Ga0105239_10002676 | |||
| 895 | Ga0105239_10048001 | |||
| 896 | Ga0105239_10059881 | |||
| 897 | Ga0105239_10147202 | |||
| 898 | Ga0105246_10017870 | |||
| 899 | Ga0105246_10129020 | |||
| 900 | Ga0157370_10062573 | |||
| 901 | Ga0171462_1037 | |||
| 902 | Ga0157374_10010944 | |||
| 903 | Ga0157374_10013272 | |||
| 904 | Ga0157374_10105256 | |||
| 905 | Ga0157378_10006214 | |||
| 906 | Ga0157372_10240915 | |||
| 907 | Ga0157375_10178475 | |||
| 908 | Ga0157375_10312234 | |||
| 909 | Ga0163163_10006000 | |||
| 910 | Ga0163163_10040601 | |||
| 911 | Ga0163163_10246906 | |||
| 912 | Ga0163163_10325423 | |||
| 913 | Ga0157380_10075964 | |||
| 914 | Ga0197907_11280375 | |||
| 915 | Ga0206350_10193835 | |||
| 916 | Ga0214544_1000002 | |||
| 917 | Ga0214542_1000001 | |||
| 918 | Ga0214545_1000001 | |||
| 919 | Ga0214543_1000001 | |||
| 920 | Ga0213876_10001215 | |||
| 921 | Ga0228598_1000979 | |||
| 922 | Ga0209130_1000125 | |||
| 923 | Ga0209675_1001197 | |||
| 924 | Ga0209025_1000014 | |||
| 925 | Ga0209025_1001183 | |||
| 926 | Ga0209564_1000105 | |||
| 927 | Ga0209564_1000179 | |||
| 928 | Ga0209758_1002544 | |||
| 929 | Ga0209256_1000055 | |||
| 930 | Ga0209257_1017751 | |||
| 931 | Ga0207697_10012580 | |||
| 932 | Ga0207692_10000116 | |||
| 933 | Ga0207692_10001592 | |||
| 934 | Ga0207692_10074954 | |||
| 935 | Ga0207642_10023479 | |||
| 936 | Ga0207710_10007078 | |||
| 937 | Ga0207710_10011722 | |||
| 938 | Ga0207688_10115569 | |||
| 939 | Ga0207647_10011073 | |||
| 940 | Ga0207685_10002629 | |||
| 941 | Ga0207699_10007380 | |||
| 942 | Ga0207699_10009773 | |||
| 943 | Ga0207699_10148625 | |||
| 944 | Ga0207645_10076135 | |||
| 945 | Ga0207684_10058004 | |||
| 946 | Ga0207654_10000308 | |||
| 947 | Ga0207654_10008665 | |||
| 948 | Ga0207654_10091644 | |||
| 949 | Ga0207707_10034699 | |||
| 950 | Ga0207707_10060434 | |||
| 951 | Ga0207695_10001719 | |||
| 952 | Ga0207695_10001812 | |||
| 953 | Ga0207695_10015101 | |||
| 954 | Ga0207695_10141323 | |||
| 955 | Ga0207695_10277579 | |||
| 956 | Ga0207671_10008038 | |||
| 957 | Ga0207671_10026027 | |||
| 958 | Ga0207671_10043689 | |||
| 959 | Ga0207693_10000936 | |||
| 960 | Ga0207693_10015310 | |||
| 961 | Ga0207693_10055385 | |||
| 962 | Ga0207693_10089262 | |||
| 963 | Ga0207693_10097802 | |||
| 964 | Ga0207663_10001209 | |||
| 965 | Ga0207663_10004152 | |||
| 966 | Ga0207660_10098393 | |||
| 967 | Ga0207657_10121768 | |||
| 968 | Ga0207652_10011414 | |||
| 969 | Ga0207652_10053499 | |||
| 970 | Ga0207694_10000157 | |||
| 971 | Ga0207694_10070529 | |||
| 972 | Ga0207694_10137111 | |||
| 973 | Ga0207694_10175526 | |||
| 974 | Ga0207650_10005423 | |||
| 975 | Ga0207687_10135380 | |||
| 976 | Ga0207700_10000380 | |||
| 977 | Ga0207700_10034366 | |||
| 978 | Ga0207700_10058979 | |||
| 979 | Ga0207664_10003152 | |||
| 980 | Ga0207664_10008858 | |||
| 981 | Ga0207644_10113219 | |||
| 982 | Ga0207706_10171579 | |||
| 983 | Ga0207709_10003187 | |||
| 984 | Ga0207669_10025941 | |||
| 985 | Ga0207669_10077289 | |||
| 986 | Ga0207665_10001402 | |||
| 987 | Ga0207665_10035413 | |||
| 988 | Ga0207711_10058835 | |||
| 989 | Ga0207667_10008116 | |||
| 990 | Ga0207667_10092805 | |||
| 991 | Ga0207667_10151627 | |||
| 992 | Ga0207667_10229954 | |||
| 993 | Ga0207651_10003242 | |||
| 994 | Ga0207640_10060288 | |||
| 995 | Ga0207677_10063534 | |||
| 996 | Ga0207677_10093801 | |||
| 997 | Ga0207703_10077402 | |||
| 998 | Ga0207703_10096486 | |||
| 999 | Ga0207703_10170351 | |||
| 1000 | Ga0207639_10010722 | |||
| 1001 | Ga0207678_10077767 | |||
| 1002 | Ga0207678_10171583 | |||
| 1003 | Ga0207678_10227417 | |||
| 1004 | Ga0207708_10032968 | |||
| 1005 | Ga0207702_10000002 | |||
| 1006 | Ga0207702_10009353 | |||
| 1007 | Ga0207702_10026824 | |||
| 1008 | Ga0207648_10066627 | |||
| 1009 | Ga0207676_10146220 | |||
| 1010 | Ga0207676_10153198 | |||
| 1011 | Ga0207674_10009623 | |||
| 1012 | Ga0207674_10075571 | |||
| 1013 | Ga0207674_10274519 | |||
| 1014 | Ga0207675_100011052 | |||
| 1015 | Ga0207675_100021910 | |||
| 1016 | Ga0207675_100241457 | |||
| 1017 | Ga0207683_10190253 | |||
| 1018 | Ga0209389_1000008 | |||
| 1019 | Ga0209389_1000292 | |||
| 1020 | Ga0209589_1001423 | |||
| 1021 | Ga0209489_100096 | |||
| 1022 | Ga0209489_100333 | |||
| 1023 | Ga0209700_100062 | |||
| 1024 | Ga0209179_1001675 | |||
| 1025 | Ga0209968_1007374 | |||
| 1026 | Ga0209971_1002819 | |||
| 1027 | Ga0209974_10006149 | |||
| 1028 | Ga0207428_10048166 | |||
| 1029 | Ga0268266_10008946 | |||
| 1030 | Ga0268266_10029812 | |||
| 1031 | Ga0268266_10117217 | |||
| 1032 | Ga0268266_10178603 | |||
| 1033 | Ga0268266_10271922 | |||
| 1034 | Ga0268264_10359309 | |||
| 1035 | Ga0265340_10003545 | |||
| 1036 | Ga0265331_10003122 | |||
| 1037 | Ga0265327_10005683 | |||
| 1038 | Ga0265316_10016635 | |||
| 1039 | Ga0265342_10035774 | |||
| 1040 | Ga0307406_10065258 | |||
| 1041 | Ga0307406_10203175 | |||
| 1042 | Ga0307411_10236984 | |||
| 1043 | Ga0307510_10069887 | |||
| 1044 | Ga0373923_0023152 | |||
| 1045 | Ga0373936_0022889 | |||
| 1046 | Ga0373945_0003120 | |||
| 1047 | Ga0373945_0034614 | |||
| 1048 | Ga0373953_0001976 | |||
| 1049 | Ga0373954_0000070 | |||
| 1050 | Ga0373956_0001764 | |||
| 1051 | Ga0373957_0002936 | |||
| 1052 | Ga0373955_0000771 | |||
| 1053 | Ga0373924_0005902 | |||
| 1054 | Ga0373924_0007507 | |||
| 1055 | Ga0373931_0029484 | |||
| 1056 | Ga0373935_0068712 | |||
| 1057 | Ga0373927_0025168 | |||
| 1058 | Ga0373933_0006540 | |||
| 1059 | Ga0373947_0001951 | |||
| 1060 | Ga0373947_0035703 | |||
| 1061 | Ga0373947_0057404 | |||
| 1062 | Ga0373937_0034207 | |||
| 1063 | Ga0373925_0000183 | |||
| 1064 | Ga0373925_0056552 | |||
| 1065 | Ga0395905_0089264 | |||
| 1066 | Ga0436364_0351634 | |||
| 1067 | Ga0436364_0617696 | |||
| 1068 | Ga0436365_0389941 | |||
| 1069 | Ga0436365_0903497 | |||
| 1070 | Ga0436365_1136865 | |||
| 1071 | Ga0436365_1625412 | |||
| 1072 | Ga0436365_1781597 | |||
| 1073 | Ga0436360_0689838 | |||
| 1074 | Ga0436360_1287647 | |||
| 1075 | Ga0436363_0716857 | |||
| 1076 | Ga0436363_0801798 | |||
| 1077 | Ga0436362_0188545 | |||
| 1078 | Ga0451577_0113078 | |||
| 1079 | Ga0466969_0025258 | |||
| 1080 | Ga0466972_0005717 | |||
| 1081 | Ga0466966_0013591 | |||
| 1082 | Ga0466963_0002381 | |||
| 1083 | Ga0466963_0237853 | |||
| 1084 | Ga0466971_0032723 | |||
| 1085 | Ga0466968_0024730 | |||
| 1086 | Ga0466960_0008985 | |||
| 1087 | Ga0466959_0002189 | |||
| 1088 | Ga0451576_0214044 | |||
| 1089 | Ga0466958_0036218 | |||
| 1090 | Ga0466967_0080868 | |||
| 1091 | Ga0495592_0022090 | |||
| 1092 | Ga0495592_0106036 | |||
| 1093 | Ga0495603_0017433 | |||
| 1094 | Ga0495603_0116667 | |||
| 1095 | Ga0495629_0000005 | |||
| 1096 | Ga0495629_0002263 | |||
| 1097 | Ga0495629_0006304 | |||
| 1098 | Ga0495629_0136933 | |||
| 1099 | Ga0495629_0152292 | |||
| 1100 | Ga0495638_0063568 | |||
| 1101 | Ga0495641_0037933 | |||
| 1102 | Ga0495651_0001805 | |||
| 1103 | Ga0495651_0039119 | |||
| 1104 | Ga0495651_0110241 | |||
| 1105 | Ga0495653_0003677 | |||
| 1106 | Ga0495653_0047853 | |||
| 1107 | Ga0495653_0147798 | |||
| 1108 | Ga0495580_0026326 | |||
| 1109 | Ga0495639_0000842 | |||
| 1110 | Ga0495662_0001038 | |||
| 1111 | Ga0495664_0000168 | |||
| 1112 | Ga0495664_0025332 | |||
| 1113 | Ga0495664_0046258 | |||
| 1114 | Ga0495584_0072545 | |||
| 1115 | Ga0495594_0077008 | |||
| 1116 | Ga0495596_0049332 | |||
| 1117 | Ga0495607_0049959 | |||
| 1118 | Ga0495608_0001870 | |||
| 1119 | Ga0495608_0006442 | |||
| 1120 | Ga0495608_0152486 | |||
| 1121 | Ga0495610_0027626 | |||
| 1122 | Ga0495618_0017854 | |||
| 1123 | Ga0495628_0002643 | |||
| 1124 | Ga0495628_0013414 | |||
| 1125 | Ga0495643_0009568 | |||
| 1126 | Ga0495643_0025025 | |||
| 1127 | Ga0495644_0055063 | |||
| 1128 | Ga0495663_0011517 | |||
| 1129 | Ga0495666_0000024 | |||
| 1130 | Ga0495652_0031409 | |||
| 1131 | Ga0495652_0089619 | |||
| 1132 | Ga0495640_0002929 | |||
| 1133 | Ga0495640_0095851 | |||
| 1134 | Ga0495586_0001169 | |||
| 1135 | Ga0495586_0048074 | |||
| 1136 | Ga0495587_0001351 | |||
| 1137 | Ga0495587_0008371 | |||
| 1138 | Ga0495621_0013236 | |||
| 1139 | Ga0495645_0003263 | |||
| 1140 | Ga0495645_0008453 | |||
| 1141 | Ga0495645_0016949 | |||
| 1142 | Ga0495645_0024685 | |||
| 1143 | Ga0495622_0011772 | |||
| 1144 | Ga0495667_0000926 | |||
| 1145 | Ga0495667_0028061 | |||
| 1146 | Ga0495667_0131178 | |||
| 1147 | Ga0495656_0020832 | |||
| 1148 | Ga0495634_0003658 | |||
| 1149 | Ga0495634_0007605 | |||
| 1150 | Ga0495634_0008514 | |||
| 1151 | Ga0495634_0061030 | |||
| 1152 | Ga0495635_0004011 | |||
| 1153 | Ga0495635_0004483 | |||
| 1154 | Ga0495635_0058336 | |||
| 1155 | Ga0495588_0030709 | |||
| 1156 | Ga0495657_0001016 | |||
| 1157 | Ga0495657_0052531 | |||
| 1158 | Ga0495599_0000637 | |||
| 1159 | Ga0495623_0003015 | |||
| 1160 | Ga0495623_0005023 | |||
| 1161 | Ga0495623_0096301 | |||
| 1162 | Ga0495646_0001926 | |||
| 1163 | Ga0495646_0033730 | |||
| 1164 | Ga0495646_0079815 | |||
| 1165 | Ga0495647_0013552 | |||
| 1166 | Ga0495613_0074181 | |||
| 1167 | Ga0495600_0002398 | |||
| 1168 | Ga0495581_0007505 | |||
| 1169 | Ga0495604_0013258 | |||
| 1170 | Ga0495604_0032291 | |||
| 1171 | Ga0495604_0034842 | |||
| 1172 | Ga0495674_0000138 | |||
| 1173 | Ga0495674_0011842 | |||
| 1174 | Ga0495672_0000437 | |||
| 1175 | Ga0495672_0049705 | |||
| 1176 | Ga0495676_0001542 | |||
| 1177 | Ga0495676_0036897 | |||
| 1178 | Ga0495676_0049376 | |||
| 1179 | Ga0495680_0004188 | |||
| 1180 | Ga0495680_0013222 | |||
| 1181 | Ga0495680_0015409 | |||
| 1182 | Ga0495683_0072960 | |||
| 1183 | Ga0495687_005957 | |||
| 1184 | Ga0495675_0001543 | |||
| 1185 | Ga0495675_0035239 | |||
| 1186 | Ga0495677_0017922 | |||
| 1187 | Ga0495673_0019085 | |||
| 1188 | Ga0495684_0000380 | |||
| 1189 | Ga0495593_0001866 | |||
| 1190 | Ga0495593_0075992 | |||
| 1191 | Ga0495602_0010536 | |||
| 1192 | Ga0495602_0053726 | |||
| 1193 | Ga0495614_0034246 | |||
| 1194 | Ga0496100_0020098 | |||
| 1195 | Ga0496100_0048366 | |||
| 1196 | Ga0496100_0113210 | |||
| 1197 | Ga0496101_0130235 | |||
| 1198 | Ga0496102_0003736 | |||
| 1199 | Ga0496102_0032222 | |||
| 1200 | Ga0496102_0225135 | |||
| 1201 | Ga0496102_0229928 | |||
| 1202 | Ga0496102_0242557 | |||
| 1203 | Ga0496103_0002281 | |||
| 1204 | Ga0496103_0092083 | |||
| 1205 | Ga0496104_0000035 | |||
| 1206 | Ga0496104_0003085 | |||
| 1207 | Ga0496104_0004213 | |||
| 1208 | Ga0496104_0014054 | |||
| 1209 | Ga0496104_0108133 | |||
| 1210 | Ga0496104_0138124 | |||
| 1211 | Ga0496104_0209020 | |||
| 1212 | Ga0496105_0000029 | |||
| 1213 | Ga0496105_0000279 | |||
| 1214 | Ga0496105_0034896 | |||
| 1215 | Ga0496105_0057759 | |||
| 1216 | Ga0496105_0184635 | |||
| 1217 | Ga0496105_0235873 | |||
| 1218 | Ga0496106_0076211 | |||
| 1219 | Ga0496106_0222586 | |||
| 1220 | Ga0496107_0015807 | |||
| 1221 | Ga0496107_0058123 | |||
| 1222 | Ga0496107_0089789 | |||
| 1223 | Ga0496107_0262791 | |||
| 1224 | Ga0496108_0057566 | |||
| 1225 | Ga0496108_0075853 | |||
| 1226 | Ga0496108_0095615 | |||
| 1227 | Ga0496108_0322718 | |||
| 1228 | Ga0496108_0324142 | |||
| 1229 | Ga0496109_0015089 | |||
| 1230 | Ga0496109_0093643 | |||
| 1231 | Ga0496109_0140849 | |||
| 1232 | Ga0496110_0018675 | |||
| 1233 | Ga0496110_0064949 | |||
| 1234 | Ga0496110_0225231 | |||
| 1235 | Ga0496110_0462982 | |||
| 1236 | Ga0496111_0023631 | |||
| 1237 | Ga0496111_0071890 | |||
| 1238 | Ga0496111_0102036 | |||
| 1239 | Ga0496111_0151566 | |||
| 1240 | Ga0496112_0005015 | |||
| 1241 | Ga0496112_0005456 | |||
| 1242 | Ga0496112_0011944 | |||
| 1243 | Ga0496112_0060843 | |||
| 1244 | Ga0496112_0102019 | |||
| 1245 | Ga0496113_0002755 | |||
| 1246 | Ga0496113_0084898 | |||
| 1247 | Ga0496113_0097950 | |||
| 1248 | Ga0496113_0162957 | |||
| 1249 | Ga0496113_0225831 | |||
| 1250 | Ga0496114_0026635 | |||
| 1251 | Ga0496114_0056707 | |||
| 1252 | Ga0496114_0066371 | |||
| 1253 | Ga0496115_0001490 | |||
| 1254 | Ga0496115_0027232 | |||
| 1255 | Ga0496115_0183061 | |||
| 1256 | Ga0496115_0199642 | |||
| 1257 | Ga0496115_0239386 | |||
| 1258 | Ga0496117_0035460 | |||
| 1259 | Ga0496117_0039537 | |||
| 1260 | Ga0496118_0141233 | |||
| 1261 | Ga0496118_0142351 | |||
| 1262 | Ga0496119_0004200 | |||
| 1263 | Ga0496119_0013974 | |||
| 1264 | Ga0496120_0016201 | |||
| 1265 | Ga0496121_0001335 | |||
| 1266 | Ga0496121_0062065 | |||
| 1267 | Ga0496121_0081839 | |||
| 1268 | Ga0496121_0147726 | |||
| 1269 | Ga0496122_0038402 | |||
| 1270 | Ga0496122_0083768 | |||
| 1271 | Ga0496123_0044483 | |||
| 1272 | Ga0496124_0086603 | |||
| 1273 | Ga0496125_0017244 | |||
| 1274 | Ga0496125_0066790 | |||
| 1275 | Ga0496126_0033274 | |||
| 1276 | Ga0496126_0118098 | |||
| 1277 | Ga0496126_0277399 | |||
| 1278 | Ga0501033_0059632 | |||
| 1279 | Ga0501034_0069571 | |||
| 1280 | Ga0501038_0143722 | |||
| 1281 | Ga0501039_0019916 | |||
| 1282 | Ga0501041_0057803 | |||
| 1283 | Ga0501046_0145826 | |||
| 1284 | Ga0501067_0018349 | |||
| 1285 | Ga0501069_0002306 | |||
| 1286 | Ga0501070_0010686 | |||
| 1287 | Ga0501070_0018160 | |||
| 1288 | Ga0501071_0063145 | |||
| 1289 | Ga0501072_0016161 | |||
| 1290 | Ga0501072_0099754 | |||
| 1291 | Ga0501073_0028653 | |||
| 1292 | Ga0501073_0030390 | |||
| 1293 | Ga0501074_0170349 | |||
| 1294 | Ga0501076_0104514 | |||
| 1295 | Ga0501077_0026564 | |||
| 1296 | Ga0501079_0086329 | |||
| 1297 | Ga0501080_0108722 | |||
| 1298 | Ga0501081_0044304 | |||
| 1299 | Ga0501083_0094571 | |||
| 1300 | Ga0501035_0158737 | |||
| 1301 | Ga0501044_0051380 | |||
| 1302 | Ga0501045_0012068 | |||
| 1303 | nmdc:mga03683_6669_c1 | |||
| 1304 | nmdc:mga03n38_5710_c1 | |||
| 1305 | nmdc:mga06z11_61277_c1 | |||
| 1306 | nmdc:mga05p37_53000_c1 | |||
| 1307 | nmdc:mga06r32_33248_c1 | |||
| 1308 | nmdc:mga06r32_370813_c1 | |||
| 1309 | nmdc:mga08y16_126616_c1 | |||
| 1310 | nmdc:mga0n895_2487_c1 | |||
| 1311 | nmdc:mga0n895_82764_c1 | |||
| 1312 | nmdc:mga0n895_83942_c1 | |||
| 1313 | nmdc:mga0n895_87383_c1 | |||
| 1314 | nmdc:mga0n895_98008_c1 | |||
| 1315 | nmdc:mga0rr50_26478_c1 | |||
| 1316 | nmdc:mga0rr50_56681_c1 | |||
| 1317 | nmdc:mga0rr50_88078_c1 | |||
| 1318 | nmdc:mga08x19_136569_c1 | |||
| 1319 | nmdc:mga08x19_54355_c1 | |||
| 1320 | nmdc:mga0a205_134501_c1 | |||
| 1321 | nmdc:mga0a205_134526_c1 | |||
| 1322 | nmdc:mga0a205_2871_c1 | |||
| 1323 | nmdc:mga0a205_348195_c1 | |||
| 1324 | nmdc:mga0a205_99582_c1 | |||
| 1325 | Ga0495601_0005765 | |||
| 1326 | Ga0495612_0001072 | |||
| 1327 | Ga0495595_0002657 | |||
| 1328 | Ga0495595_0006491 | |||
| 1329 | Ga0495619_0000355 | |||
| 1330 | Ga0495619_0036614 | |||
| 1331 | Ga0495619_0076078 | |||
| 1332 | Ga0500643_000032 | |||
| 1333 | Ga0500566_0000026 | |||
| 1334 | Ga0500566_0001584 | |||
| 1335 | Ga0500566_0008786 | |||
| 1336 | Ga0500640_002218 | |||
| 1337 | Ga0500555_005056 | |||
| 1338 | Ga0500557_000087 | |||
| 1339 | Ga0500595_009653 | |||
| 1340 | Ga0500614_000135 | |||
| 1341 | Ga0500642_0001017 | |||
| 1342 | Ga0500652_034780 | |||
| 1343 | Ga0500559_0004957 | |||
| 1344 | Ga0500559_0010760 | |||
| 1345 | Ga0500559_0038877 | |||
| 1346 | Ga0500590_011029 | |||
| 1347 | Ga0500603_000591 | |||
| 1348 | Ga0500616_0015563 | |||
| 1349 | Ga0500616_0038525 | |||
| 1350 | Ga0500619_003290 | |||
| 1351 | Ga0500622_0004721 | |||
| 1352 | Ga0500639_000939 | |||
| 1353 | Ga0500636_0000978 | |||
| 1354 | Ga0500636_0039374 | |||
| 1355 | Ga0500637_0013976 | |||
| 1356 | Ga0500637_0027839 | |||
| 1357 | Ga0500625_007369 | |||
| 1358 | Ga0500596_002113 | |||
| 1359 | Ga0500601_000801 | |||
| 1360 | Ga0501084_0050929 | |||
| 1361 | Ga0530510_0081050 | |||
| 1362 | 8057529777 | |||
| 1363 | 2509150578 | |||
| 1364 | 2513625501 | |||
| 1365 | 2513644502 | |||
| 1366 | 2513658049 | |||
| 1367 | 2513703767 | |||
| 1368 | 2513717176 | |||
| 1369 | 2513872891 | |||
| 1370 | 2513919857 | |||
| 1371 | 2517107454 | |||
| 1372 | 2517892291 | |||
| 1373 | 2528849947 | |||
| 1374 | 2617375644 | |||
| 1375 | 2644728719 | |||
| 1376 | 2644735931 | |||
| 1377 | 2644747204 | |||
| 1378 | 2723844935 | |||
| 1379 | 2728747354 | |||
| 1380 | 2793065384 | |||
| 1381 | 2793072366 | |||
| 1382 | 2793082193 | |||
| 1383 | 2805915211 | |||
| 1384 | 2819718137 | |||
| 1385 | 2824608905 | |||
| 1386 | 2824617684 | |||
| 1387 | 2824626133 | |||
| 1388 | 2824635070 | |||
| 1389 | 2824643803 | |||
| 1390 | 2824652498 | |||
| 1391 | 2824661118 | |||
| 1392 | 2824670952 | |||
| 1393 | 2824686735 | |||
| 1394 | 2824703550 | |||
| 1395 | 2824722987 | |||
| 1396 | 2824731795 | |||
| 1397 | 2824739442 | |||
| 1398 | 2824753446 | |||
| 1399 | 2838123618 | |||
| 1400 | 2841762060 | |||
| 1401 | 2841916513 | |||
| 1402 | 2841922410 | |||
| 1403 | 2841946738 | |||
| 1404 | 2841949717 | |||
| 1405 | 2841958786 | |||
| 1406 | 2841971777 | |||
| 1407 | 2841974878 | |||
| 1408 | 2841983559 | |||
| 1409 | 2842038937 | |||
| 1410 | 2842048117 | |||
| 1411 | 2844105085 | |||
| 1412 | 2844319200 | |||
| 1413 | 2847936343 | |||
| 1414 | 2847946690 | |||
| 1415 | 2851183435 | |||
| 1416 | 2851248073 | |||
| 1417 | 2857514183 | |||
| 1418 | 2874615052 | |||
| 1419 | 2876764635 | |||
| 1420 | 2879090581 | |||
| 1421 | 2879105783 | |||
| 1422 | 2881368709 | |||
| 1423 | 2881673550 | |||
| 1424 | 2885411379 | |||
| 1425 | 2888384191 | |||
| 1426 | 2888424659 | |||
| 1427 | 2891091442 | |||
| 1428 | 2903731042 | |||
| 1429 | 2906608177 | |||
| 1430 | 2906626934 | |||
| 1431 | 2906637435 | |||
| 1432 | 2906649203 | |||
| 1433 | 2906666266 | |||
| 1434 | 2908780307 | |||
| 1435 | 2917699457 | |||
| 1436 | 2922365490 | |||
| 1437 | 2922374532 | |||
| 1438 | 2922391113 | |||
| 1439 | 2922400672 | |||
| 1440 | 2929632386 | |||
| 1441 | 2932790492 | |||
| 1442 | 2932799830 | |||
| 1443 | 2932802671 | |||
| 1444 | 2932810913 | |||
| 1445 | 2932823757 | |||
| 1446 | 2932830123 | |||
| 1447 | 2935622651 | |||
| 1448 | 2935642549 | |||
| 1449 | 2935668147 | |||
| 1450 | 2935676181 | |||
| 1451 | 2935686163 | |||
| 1452 | 2935701210 | |||
| 1453 | 2935706007 | |||
| 1454 | 2935714715 | |||
| 1455 | 2935725334 | |||
| 1456 | 2935732306 | |||
| 1457 | 2935741685 | |||
| 1458 | 2935752128 | |||
| 1459 | 2935766477 | |||
| 1460 | 2935771923 | |||
| 1461 | 2935778645 | |||
| 1462 | 2935788969 | |||
| 1463 | 2935795230 | |||
| 1464 | 2935803006 | |||
| 1465 | 2935814323 | |||
| 1466 | 2935831460 | |||
| 1467 | 2935838320 | |||
| 1468 | 2935860900 | |||
| 1469 | 2935869763 | |||
| 1470 | 2935878818 | |||
| 1471 | 2935886957 | |||
| 1472 | 2935994786 | |||
| 1473 | 2936003428 | |||
| 1474 | 2936039879 | |||
| 1475 | 2940557069 | |||
| 1476 | 2941532944 | |||
| 1477 | 2941539012 | |||
| 1478 | 3005484440 | |||
| 1479 | 3005510449 | |||
| 1480 | 3005587914 | |||
| 1481 | 3005599365 | |||
| 1482 | 3005715028 | |||
| 1483 | 3005722442 | |||
| 1484 | 8006931848 | |||
| 1485 | 8006967188 | |||
| 1486 | 8016522189 | |||
| 1487 | 8016529499 | |||
| 1488 | 8016534709 | |||
| 1489 | 8016547926 | |||
| 1490 | 8016554204 | |||
| 1491 | 8016562579 | |||
| 1492 | 8016573059 | |||
| 1493 | 8016577205 | |||
| 1494 | 8016591609 | |||
| 1495 | 8016600367 | |||
| 1496 | 8016610371 | |||
| 1497 | 8016614560 | |||
| 1498 | 8016626440 | |||
| 1499 | 8017063481 | |||
| 1500 | 8019534476 | |||
| 1501 | 8019544996 | |||
| 1502 | 8019553532 | |||
| 1503 | 8019582800 | |||
| 1504 | 8019590590 | |||
| 1505 | 8019600762 | |||
| 1506 | 8019617790 | |||
| 1507 | 8019658536 | |||
| 1508 | 8056968158 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e60-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from bartonella henselae | 0.9868 | 1 | 412 |
| 3kzu-assembly2.cif.gz_C-2 | crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from brucella melitensis | 0.9854 | 1 | 412 |
| 3e60-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from bartonella henselae | 0.9845 | 1 | 412 |
| 3kzu-assembly2.cif.gz_C-2 | crystal structure of 3-oxoacyl-(acyl carrier protein) synthase ii from brucella melitensis | 0.9831 | 1 | 412 |
| 4jga-assembly1.cif.gz_B | x-ray crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase 2 from rickettsia rickettsii | 0.9691 | 1 | 412 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O94297_1_425_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9711 | 1 | 411 | 3.40.47.10 |
| af_O94297_1_425_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9665 | 1 | 411 | 3.40.47.10 |
| 4f32A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9634 | 5 | 251 | 3.40.47.10 |
| af_Q5ANC6_1_441_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9587 | 1 | 412 | 3.40.47.10 |
| af_Q0E328_1_239_3.40.47.10 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9569 | 178 | 408 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1N7L651-F1-model_v4 | Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) | 0.9867 | 1 | 412 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A3S1UKM1-F1-model_v4 | Beta-ketoacyl-ACP synthase II | 0.9849 | 238 | 412 |
GO:0004315
GO:0006633 |
| AF-A0A1N7L651-F1-model_v4 | Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) | 0.9844 | 1 | 412 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A3M1IYU0-F1-model_v4 | Beta-ketoacyl-ACP synthase II | 0.9835 | 210 | 412 |
GO:0004315
GO:0005829 GO:0006633 |
| AF-A0A176FMC8-F1-model_v4 | Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) | 0.9828 | 1 | 332 |
GO:0004315
GO:0006633 |