F479153

General Info

Members Datasets Scaffolds Average Seq Length
752 459 632 340

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10000196|Ga0105243_100001962
Length 413
Sequence VLTPDVALPAHGDARSAVRTCLSPRSRRVRAARPAVVAPWCRSGRRFLIWIKARHRRISDGAVTRSPKECCMNKTMKAAVVREFGKPLTIEEVEVPRPQAGDILVKIEACGVCHTDLHAAEGDWPVKPNPPFIPGHEGVGHVVAVGAGVGHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEAQQNSGYSVNGGFAEYALANADYVGHLPKNIGFVEVAPILCAGVTVYKGLKVTDTKPGNWVVISGIGGLGHMAVQYAKAMGLNVAAVDVDDAKLALARRLGATVTVNALTTDPVAYLKKEIGGAHGALVTAVSPKAFEQAIGMVRRGGTVSLNGLPPGQFPLDIFGMVLNGVTVRGSIVGTRLDLQESLDFAEQGKVAATVATATLENINEVFARMRAGQIEGRIVLDMAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
14 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
15 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
16 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
17 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
18 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
19 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
20 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
21 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
22 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
23 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
24 2643221569 Achromobacter sp. Root565 Isolate Unclassified
25 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
26 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
27 2643221594 Achromobacter sp. Root170 Isolate Unclassified
28 2643221621 Achromobacter sp. Root83 Isolate Unclassified
29 2643221645 Massilia sp. Root351 Isolate Unclassified
30 2643221664 Massilia sp. Root418 Isolate Unclassified
31 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
32 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
33 2721755523 Delftia sp. HK171 Isolate Unclassified
34 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
35 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
36 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
37 2751185800 Brucella pituitosa AA2 Isolate Unclassified
38 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
39 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
40 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
41 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
42 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
43 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
44 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
45 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
46 2818991457 Xanthomonas translucens 569 Isolate Unclassified
47 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
48 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
49 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
50 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
51 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
52 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
53 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
54 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
55 2855730933 Achromobacter sp. HZ28 Isolate Nodule
56 2855767633 Achromobacter sp. HZ34 Isolate Nodule
57 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
58 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
59 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
60 2858950400 Achromobacter sp. K91 Isolate Unclassified
61 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
62 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
63 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
64 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
65 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
66 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
67 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
68 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
69 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
70 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
71 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
72 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
73 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
74 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
75 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
76 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
77 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
78 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
79 2919513703 Luteimonas sp. 3794 Isolate Unclassified
80 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
81 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
82 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
83 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
84 2928058823 Ralstonia sp. 1138 Isolate Unclassified
85 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
86 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
87 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
88 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
89 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
90 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
91 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
92 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
93 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
94 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
95 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
96 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
97 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
98 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
99 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
100 2941479691
101 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
102 2952252522 Salinicola sp. DM10 Isolate Unclassified
103 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
104 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
105 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
106 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
107 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
108 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
109 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
110 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
111 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
112 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
113 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
114 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
115 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
116 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
119 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
120 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
121 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
122 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
123 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
124 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
125 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
126 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
127 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
128 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
129 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
130 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
131 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
132 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
133 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
134 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
135 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
136 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
137 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
138 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
139 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
140 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
141 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
142 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
143 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
144 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
145 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
146 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
147 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
148 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
149 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
150 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
151 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
152 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
153 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
154 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
155 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
156 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
157 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
158 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
159 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
160 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
161 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
162 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
163 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
164 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
165 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
166 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
167 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
168 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
169 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
170 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
171 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
172 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
173 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
174 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
175 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
176 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
177 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
178 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
179 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
180 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
181 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
182 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
183 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
184 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
185 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
186 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
187 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
188 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
194 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
195 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
196 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
197 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
198 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
199 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
200 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
201 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
202 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
203 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
204 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
205 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
206 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
207 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
208 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
209 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
210 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
211 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
212 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
213 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
214 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
215 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
216 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
217 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
219 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
225 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
227 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
228 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
231 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
232 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
234 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
235 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
237 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
238 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
281 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
284 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
285 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
286 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
287 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
288 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
291 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
292 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
293 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
294 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
295 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
296 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
297 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
300 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
301 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
302 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
303 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
304 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
305 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
306 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
307 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
308 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
309 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
310 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
311 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
314 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
315 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
316 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
317 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
318 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
319 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
320 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
321 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
322 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
323 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
324 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
325 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
326 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
327 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
328 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
329 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
330 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
331 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
332 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
333 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
334 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
335 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
336 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
337 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
338 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
339 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
340 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
341 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
342 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
343 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
344 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
345 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
346 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
347 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
348 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
352 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
353 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
354 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
355 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
356 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
357 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
358 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
359 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
360 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
361 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
362 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
363 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
364 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
365 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
366 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
367 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
368 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
369 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
370 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
371 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
372 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
373 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
374 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
375 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
376 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
377 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
378 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
379 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
380 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
381 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
382 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
383 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
386 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
390 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
391 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
392 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
393 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
394 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
395 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
396 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
399 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
400 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
401 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
402 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
403 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
404 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
405 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
426 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
427 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
428 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
429 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
434 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
435 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
436 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
440 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
441 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
442 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
443 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
444 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
445 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
446 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
447 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
448 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
449 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
451 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
452 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
453 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
454 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
455 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
456 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
457 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
458 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
459 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.85
Metatranscriptomes 1.2
Isolates 15.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 10.77
Nodule 1.2
Rhizoplane 5.98
Rhizosphere 61.3
Stem 0
Stem Tuber 0
Unclassified 20.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1398166 2162886007 Bacteria 1555
2 SwRhRL2b_contig_3013297 2162886007 Bacteria 1610
3 JGI24741J21665_1000701 3300001915 Bacteria 10112
4 JGI24740J21852_10001102 3300001979 Bacteria 12202
5 JGI24740J21852_10001979 3300001979 Bacteria 9363
6 JGI24740J21852_10003569 3300001979 Bacteria 6808
7 JGI25156J39149_1002620 3300002705 Bacteria 6325
8 JGI25162J39368_1005203 3300002737 Bacteria 2650
9 JGI25152J39213_1002500 3300002773 Bacteria 6953
10 JGI25151J46595_10004949 3300003187 Bacteria 6953
11 JGI25153J46596_10005084 3300003215 Bacteria 6953
12 rootH2_10049822 3300003320 Bacteria 1837
13 rootL2_10004265 3300003322 Bacteria 2802
14 rootL2_10057367 3300003322 Bacteria 13355
15 rootH1_10002003 3300003323 Bacteria 1671
16 Ga0006554J51385_1020996 3300003567 Bacteria 3496
17 Ga0006562J51391_1002671 3300003578 Bacteria 7880
18 Ga0006562J51391_1003719 3300003578 Bacteria 3527
19 Ga0006562J51391_1042671 3300003578 Bacteria 2383
20 Ga0006562J51391_1060129 3300003578 Bacteria 3320
21 Ga0055538_1001920 3300003751 Bacteria 3440
22 Ga0055538_1002774 3300003751 Bacteria 2426
23 Ga0055539_1000073 3300003752 Bacteria 131094
24 Ga0055533_1000850 3300003756 Bacteria 9348
25 Ga0055533_1002700 3300003756 Bacteria 3911
26 Ga0055533_1004145 3300003756 Bacteria 2698
27 Ga0055532_1000090 3300003758 Bacteria 104391
28 Ga0055525_1000387 3300003759 Bacteria 28280
29 Ga0055535_1000085 3300003761 Bacteria 104391
30 Ga0055542_1000847 3300003762 Bacteria 21499
31 Ga0055529_1000134 3300003763 Bacteria 104391
32 Ga0055536_1000208 3300003781 Bacteria 48172
33 Ga0055536_1004486 3300003781 Bacteria 7120
34 Ga0055536_1004496 3300003781 Bacteria 7105
35 Ga0055536_1008760 3300003781 Bacteria 4291
36 Ga0055536_1014629 3300003781 Bacteria 2736
37 Ga0055530_10003547 3300003791 Bacteria 8791
38 Ga0055530_10014085 3300003791 Bacteria 2687
39 Ga0055531_10002440 3300003794 Bacteria 12445
40 Ga0055531_10007366 3300003794 Bacteria 6028
41 Ga0055541_1001417 3300003841 Bacteria 5211
42 Ga0055541_1004035 3300003841 Bacteria 2702
43 Ga0058692_1000005 3300003856 Bacteria 398815
44 Ga0058692_1000087 3300003856 Bacteria 64301
45 Ga0065714_10007259 3300005288 Bacteria 3168
46 Ga0065704_10074978 3300005289 Bacteria 5870
47 Ga0065704_10132396 3300005289 Bacteria 1613
48 Ga0070658_10085520 3300005327 Bacteria 2594
49 Ga0070676_10015876 3300005328 Bacteria 4154
50 Ga0070670_100016372 3300005331 Bacteria 6368
51 Ga0070670_100264853 3300005331 Bacteria 1499
52 Ga0070670_100273742 3300005331 Bacteria 1474
53 Ga0070670_100277919 3300005331 Bacteria 1462
54 Ga0070670_100337027 3300005331 Bacteria 1323
55 Ga0070677_10004983 3300005333 Bacteria 4362
56 Ga0068869_100236838 3300005334 Bacteria 1453
57 Ga0070666_10019893 3300005335 Bacteria 4336
58 Ga0070661_100000141 3300005344 Bacteria 58825
59 Ga0070668_100000632 3300005347 Bacteria 23654
60 Ga0070668_100034112 3300005347 Bacteria 3878
61 Ga0070669_100059488 3300005353 Bacteria 2805
62 Ga0070669_100201742 3300005353 Bacteria 1565
63 Ga0070675_100014679 3300005354 Bacteria 6178
64 Ga0070671_100032521 3300005355 Bacteria 4312
65 Ga0070674_100016361 3300005356 Bacteria 4648
66 Ga0070673_100020953 3300005364 Bacteria 4726
67 Ga0070659_100001430 3300005366 Bacteria 17218
68 Ga0070667_100086224 3300005367 Bacteria 2693
69 Ga0070709_10272069 3300005434 Bacteria 1228
70 Ga0070714_100308894 3300005435 Bacteria 1476
71 Ga0070663_100000034 3300005455 Bacteria 68516
72 Ga0070663_100028245 3300005455 Bacteria 3817
73 Ga0070678_100042276 3300005456 Bacteria 3238
74 Ga0070678_100159662 3300005456 Bacteria 1825
75 Ga0070706_100068908 3300005467 Bacteria 3272
76 Ga0070706_100199661 3300005467 Bacteria 1868
77 Ga0070698_100000844 3300005471 Bacteria 33554
78 Ga0070699_100022461 3300005518 Bacteria 5438
79 Ga0070699_100103088 3300005518 Bacteria 2502
80 Ga0070697_100000201 3300005536 Bacteria 48972
81 Ga0068853_100051148 3300005539 Bacteria 3556
82 Ga0070672_100141408 3300005543 Bacteria 1985
83 Ga0070695_100117092 3300005545 Bacteria 1817
84 Ga0070665_100011695 3300005548 Bacteria 8868
85 Ga0070665_100036789 3300005548 Bacteria 4922
86 Ga0070665_100257302 3300005548 Bacteria 1747
87 Ga0070665_100329479 3300005548 Bacteria 1531
88 Ga0068855_100001118 3300005563 Bacteria 33353
89 Ga0068855_100252115 3300005563 Bacteria 1968
90 Ga0070664_100000057 3300005564 Bacteria 68516
91 Ga0068857_100009494 3300005577 Bacteria 8449
92 Ga0068857_100169737 3300005577 Bacteria 1983
93 Ga0068854_100000299 3300005578 Bacteria 32817
94 Ga0068854_100014660 3300005578 Bacteria 5170
95 Ga0068854_100036124 3300005578 Bacteria 3462
96 Ga0068856_100000811 3300005614 Bacteria 33756
97 Ga0070702_100125785 3300005615 Bacteria 1611
98 Ga0068852_100145249 3300005616 Bacteria 2200
99 Ga0068851_10003172 3300005834 Bacteria 7286
100 Ga0068870_10043231 3300005840 Bacteria 2349
101 Ga0068858_100166850 3300005842 Bacteria 2075
102 Ga0081540_1069939 3300005983 Bacteria 1628
103 Ga0081539_10006532 3300005985 Bacteria 11123
104 Ga0075365_10002875 3300006038 Bacteria 8664
105 Ga0075364_10000276 3300006051 Bacteria 25091
106 Ga0075432_10033221 3300006058 Bacteria 1789
107 Ga0070712_100138658 3300006175 Bacteria 1853
108 Ga0075369_10026420 3300006186 Bacteria 2420
109 Ga0075428_100049522 3300006844 Bacteria 4609
110 Ga0075431_100094668 3300006847 Bacteria 3083
111 Ga0068865_100259213 3300006881 Bacteria 1376
112 Ga0079104_1000004 3300006946 Bacteria 444549
113 Ga0105251_10000821 3300009011 Bacteria 27865
114 Ga0105251_10008083 3300009011 Bacteria 6371
115 Ga0105244_10006402 3300009036 Bacteria 7637
116 Ga0105244_10017652 3300009036 Bacteria 4027
117 Ga0105244_10020719 3300009036 Bacteria 3647
118 Ga0105244_10139238 3300009036 Bacteria 1168
119 Ga0105250_10021928 3300009092 Bacteria 2576
120 Ga0105250_10025648 3300009092 Bacteria 2375
121 Ga0105240_10006539 3300009093 Bacteria 17111
122 Ga0105240_10023229 3300009093 Bacteria 8209
123 Ga0105240_10036630 3300009093 Bacteria 6308
124 Ga0111539_10054304 3300009094 Bacteria 4767
125 Ga0114129_10087196 3300009147 Bacteria 4328
126 Ga0114129_10110850 3300009147 Bacteria 3788
127 Ga0105243_10000196 3300009148 Bacteria 71069
128 Ga0105243_10026584 3300009148 Bacteria 4431
129 Ga0105243_10041778 3300009148 Bacteria 3586
130 Ga0105243_10125346 3300009148 Bacteria 2172
131 Ga0105241_10007804 3300009174 Bacteria 7868
132 Ga0105242_10048898 3300009176 Bacteria 3438
133 Ga0105242_10312352 3300009176 Bacteria 1439
134 Ga0105248_10044318 3300009177 Bacteria 4990
135 Ga0105248_10052388 3300009177 Bacteria 4579
136 Ga0105237_10000010 3300009545 Bacteria 324528
137 Ga0105237_10000850 3300009545 Bacteria 41539
138 Ga0105237_10315012 3300009545 Bacteria 1568
139 Ga0105238_10007711 3300009551 Bacteria 10761
140 Ga0105238_10096300 3300009551 Bacteria 2945
141 Ga0105238_10170518 3300009551 Bacteria 2152
142 Ga0105249_10058788 3300009553 Bacteria 3524
143 Ga0105249_10092216 3300009553 Bacteria 2836
144 Ga0105249_10093359 3300009553 Bacteria 2819
145 Ga0105249_10407113 3300009553 Bacteria 1392
146 Ga0105239_10002448 3300010375 Bacteria 23666
147 Ga0105239_10009822 3300010375 Bacteria 10755
148 Ga0105239_10024465 3300010375 Bacteria 6654
149 Ga0105246_10008423 3300011119 Bacteria 6337
150 Ga0105246_10303430 3300011119 Bacteria 1290
151 Ga0157373_10011643 3300013100 Bacteria 6462
152 Ga0157371_10000323 3300013102 Bacteria 61980
153 Ga0157371_10000896 3300013102 Bacteria 33556
154 Ga0157371_10016092 3300013102 Bacteria 5591
155 Ga0157371_10040986 3300013102 Bacteria 3306
156 Ga0157371_10044860 3300013102 Bacteria 3147
157 Ga0157371_10088033 3300013102 Bacteria 2198
158 Ga0157370_10000038 3300013104 Bacteria 135182
159 Ga0157370_10018866 3300013104 Bacteria 6937
160 Ga0157369_10008841 3300013105 Bacteria 11536
161 Ga0157369_10014336 3300013105 Bacteria 8951
162 Ga0157369_10250363 3300013105 Bacteria 1849
163 Ga0157374_10322933 3300013296 Bacteria 1530
164 Ga0157378_10168830 3300013297 Bacteria 2050
165 Ga0163162_10012665 3300013306 Bacteria 8236
166 Ga0163162_10046721 3300013306 Bacteria 4340
167 Ga0163162_10061533 3300013306 Bacteria 3792
168 Ga0163162_10132160 3300013306 Bacteria 2605
169 Ga0163162_10442528 3300013306 Bacteria 1432
170 Ga0157372_10002748 3300013307 Bacteria 19019
171 Ga0157375_10065595 3300013308 Bacteria 3620
172 Ga0157375_10191793 3300013308 Bacteria 2198
173 Ga0157375_10580559 3300013308 Bacteria 1281
174 Ga0163163_10422730 3300014325 Bacteria 1392
175 Ga0182008_10000083 3300014497 Bacteria 73635
176 Ga0182006_1011481 3300015261 Bacteria 3894
177 Ga0182006_1012808 3300015261 Bacteria 3659
178 Ga0182007_10000117 3300015262 Bacteria 54576
179 Ga0182005_1000220 3300015265 Bacteria 37719
180 Ga0182005_1003904 3300015265 Bacteria 4934
181 Ga0163161_10007088 3300017792 Bacteria 7751
182 Ga0163161_10049876 3300017792 Bacteria 3027
183 Ga0163161_10122805 3300017792 Bacteria 1953
184 Ga0206349_1540627 3300020075 Bacteria 1379
185 Ga0154015_1546600 3300020610 Bacteria 6538
186 Ga0213872_10046939 3300021361 Bacteria 1965
187 Ga0213872_10070055 3300021361 Bacteria 1581
188 Ga0209784_100006 3300025224 Bacteria 930704
189 Ga0209784_100108 3300025224 Bacteria 94409
190 Ga0209784_100846 3300025224 Bacteria 6784
191 Ga0209566_100002 3300025225 Bacteria 2614868
192 Ga0209566_100602 3300025225 Bacteria 22518
193 Ga0209566_103317 3300025225 Bacteria 2521
194 Ga0209674_100097 3300025226 Bacteria 167285
195 Ga0209674_100168 3300025226 Bacteria 84107
196 Ga0209674_100981 3300025226 Bacteria 8854
197 Ga0209674_101230 3300025226 Bacteria 7288
198 Ga0209147_100018 3300025229 Bacteria 515719
199 Ga0209563_100041 3300025230 Bacteria 407467
200 Ga0209563_104405 3300025230 Bacteria 2698
201 Ga0209437_101206 3300025233 Bacteria 7471
202 Ga0209258_100028 3300025242 Bacteria 515719
203 Ga0207425_1000015 3300025245 Bacteria 466368
204 Ga0209646_1000153 3300025246 Bacteria 96707
205 Ga0209677_100007 3300025253 Bacteria 1021332
206 Ga0209677_107409 3300025253 Bacteria 2341
207 Ga0209148_1000297 3300025254 Bacteria 72735
208 Ga0209148_1002278 3300025254 Bacteria 6926
209 Ga0209759_1002551 3300025256 Bacteria 7905
210 Ga0209759_1002829 3300025256 Bacteria 7322
211 Ga0209759_1009032 3300025256 Bacteria 3053
212 Ga0209759_1014014 3300025256 Bacteria 2141
213 Ga0209129_1000131 3300025258 Bacteria 127801
214 Ga0209455_1000107 3300025272 Bacteria 195136
215 Ga0207673_1004250 3300025290 Bacteria 1704
216 Ga0209675_1003920 3300025291 Bacteria 6829
217 Ga0209676_1000104 3300025292 Bacteria 226581
218 Ga0209676_1000128 3300025292 Bacteria 188099
219 Ga0209676_1000151 3300025292 Bacteria 167307
220 Ga0209676_1005600 3300025292 Bacteria 6489
221 Ga0209025_1000002 3300025294 Bacteria 1393142
222 Ga0209025_1037849 3300025294 Bacteria 2132
223 Ga0209025_1040985 3300025294 Bacteria 1992
224 Ga0209758_1000003 3300025297 Bacteria 1398533
225 Ga0209758_1020232 3300025297 Bacteria 3161
226 Ga0209050_1000796 3300025298 Bacteria 44614
227 Ga0209050_1000985 3300025298 Bacteria 36261
228 Ga0209050_1003203 3300025298 Bacteria 12387
229 Ga0209050_1007470 3300025298 Bacteria 6119
230 Ga0209051_1003539 3300025303 Bacteria 10180
231 Ga0209051_1007550 3300025303 Bacteria 5924
232 Ga0209257_1000413 3300025304 Bacteria 82516
233 Ga0209257_1000434 3300025304 Bacteria 80353
234 Ga0209257_1000796 3300025304 Bacteria 46060
235 Ga0209257_1002077 3300025304 Bacteria 21100
236 Ga0209257_1014808 3300025304 Bacteria 3310
237 Ga0207697_10004112 3300025315 Bacteria 7024
238 Ga0207697_10018043 3300025315 Bacteria 2897
239 Ga0207656_10007972 3300025321 Bacteria 3883
240 Ga0207696_1016340 3300025711 Bacteria 2485
241 Ga0207655_1002897 3300025728 Bacteria 13240
242 Ga0207655_1006892 3300025728 Bacteria 7456
243 Ga0207655_1008231 3300025728 Bacteria 6645
244 Ga0207655_1016757 3300025728 Bacteria 3992
245 Ga0207655_1044630 3300025728 Bacteria 1860
246 Ga0207655_1046046 3300025728 Bacteria 1815
247 Ga0207655_1062978 3300025728 Bacteria 1423
248 Ga0207713_1000535 3300025735 Bacteria 38232
249 Ga0207713_1011252 3300025735 Bacteria 4879
250 Ga0207682_10000870 3300025893 Bacteria 14001
251 Ga0207647_10004266 3300025904 Bacteria 10602
252 Ga0207647_10045620 3300025904 Bacteria 2734
253 Ga0207647_10087403 3300025904 Bacteria 1862
254 Ga0207645_10005766 3300025907 Bacteria 8932
255 Ga0207643_10027172 3300025908 Bacteria 3171
256 Ga0207654_10006004 3300025911 Bacteria 6111
257 Ga0207695_10009088 3300025913 Bacteria 12340
258 Ga0207695_10012681 3300025913 Bacteria 10095
259 Ga0207695_10012956 3300025913 Bacteria 9967
260 Ga0207671_10000013 3300025914 Bacteria 478458
261 Ga0207671_10004397 3300025914 Bacteria 13516
262 Ga0207671_10026987 3300025914 Bacteria 4297
263 Ga0207693_10243509 3300025915 Bacteria 1412
264 Ga0207649_10000111 3300025920 Bacteria 68568
265 Ga0207681_10072066 3300025923 Bacteria 2411
266 Ga0207694_10004579 3300025924 Bacteria 10775
267 Ga0207694_10020419 3300025924 Bacteria 5013
268 Ga0207650_10017851 3300025925 Bacteria 4971
269 Ga0207650_10109287 3300025925 Bacteria 2138
270 Ga0207659_10026798 3300025926 Bacteria 3894
271 Ga0207644_10041097 3300025931 Bacteria 3269
272 Ga0207690_10001080 3300025932 Bacteria 17433
273 Ga0207686_10021887 3300025934 Bacteria 3675
274 Ga0207709_10000019 3300025935 Bacteria 402225
275 Ga0207709_10000954 3300025935 Bacteria 21622
276 Ga0207709_10001101 3300025935 Bacteria 19831
277 Ga0207709_10025527 3300025935 Bacteria 3384
278 Ga0207669_10053122 3300025937 Bacteria 2438
279 Ga0207691_10014615 3300025940 Bacteria 7483
280 Ga0207711_10108645 3300025941 Bacteria 2464
281 Ga0207689_10097761 3300025942 Bacteria 2412
282 Ga0207679_10000105 3300025945 Bacteria 68561
283 Ga0207667_10000047 3300025949 Bacteria 240471
284 Ga0207667_10262627 3300025949 Bacteria 1765
285 Ga0207712_10062854 3300025961 Bacteria 2641
286 Ga0207668_10098422 3300025972 Bacteria 2167
287 Ga0207640_10000154 3300025981 Bacteria 49637
288 Ga0207640_10001091 3300025981 Bacteria 15000
289 Ga0207640_10062050 3300025981 Bacteria 2478
290 Ga0207640_10073870 3300025981 Bacteria 2306
291 Ga0207658_10038290 3300025986 Bacteria 3453
292 Ga0207658_10198646 3300025986 Bacteria 1673
293 Ga0207639_10040742 3300026041 Bacteria 3469
294 Ga0207639_10041821 3300026041 Bacteria 3432
295 Ga0207678_10000106 3300026067 Bacteria 68474
296 Ga0207678_10018900 3300026067 Bacteria 6054
297 Ga0207702_10000135 3300026078 Bacteria 88092
298 Ga0207702_10048334 3300026078 Bacteria 3588
299 Ga0207674_10069548 3300026116 Bacteria 3540
300 Ga0207675_100005953 3300026118 Bacteria 11620
301 Ga0207683_10017060 3300026121 Bacteria 6179
302 Ga0207698_10113019 3300026142 Bacteria 2281
303 Ga0209281_1000005 3300027111 Bacteria 1242284
304 Ga0209371_1000031 3300027312 Bacteria 399263
305 Ga0209371_1000066 3300027312 Bacteria 212660
306 Ga0209371_1000256 3300027312 Bacteria 64355
307 Ga0268266_10011682 3300028379 Bacteria 7622
308 Ga0307515_10033048 3300028794 Bacteria 8537
309 Ga0307515_10195808 3300028794 Bacteria 1914
310 Ga0265338_10000518 3300028800 Bacteria 68023
311 Ga0265338_10000713 3300028800 Bacteria 56791
312 Ga0265338_10003827 3300028800 Bacteria 20906
313 Ga0265324_10032631 3300029957 Bacteria 1818
314 Ga0268256_1000034 3300030500 Bacteria 398909
315 Ga0268256_1000063 3300030500 Bacteria 212660
316 Ga0268256_1000216 3300030500 Bacteria 64353
317 Ga0268256_1008755 3300030500 Bacteria 3439
318 Ga0316176_1150308 3300030732 Bacteria 1679
319 Ga0307513_10247978 3300031456 Bacteria 1580
320 Ga0307513_10359283 3300031456 Bacteria 1202
321 Ga0307408_100000002 3300031548 Bacteria 827227
322 Ga0307408_100007242 3300031548 Bacteria 7338
323 Ga0307408_100034513 3300031548 Bacteria 3543
324 Ga0307408_100100331 3300031548 Bacteria 2204
325 Ga0307514_10000225 3300031649 Bacteria 151002
326 Ga0316576_10003440 3300031727 Bacteria 9272
327 Ga0316578_10129655 3300031728 Bacteria 1517
328 Ga0307405_10002186 3300031731 Bacteria 8544
329 Ga0307405_10011165 3300031731 Bacteria 4690
330 Ga0307405_10012857 3300031731 Bacteria 4447
331 Ga0307413_10016028 3300031824 Bacteria 3857
332 Ga0307413_10106611 3300031824 Bacteria 1865
333 Ga0307413_10141129 3300031824 Bacteria 1665
334 Ga0307413_10165447 3300031824 Bacteria 1559
335 Ga0307410_10000399 3300031852 Bacteria 17113
336 Ga0307410_10010980 3300031852 Bacteria 5158
337 Ga0307410_10025915 3300031852 Bacteria 3684
338 Ga0307406_10154302 3300031901 Bacteria 1642
339 Ga0307407_10009412 3300031903 Bacteria 4551
340 Ga0307412_10000460 3300031911 Bacteria 24510
341 Ga0307412_10003930 3300031911 Bacteria 8278
342 Ga0307412_10029554 3300031911 Bacteria 3441
343 Ga0307412_10050649 3300031911 Bacteria 2741
344 Ga0307412_10072313 3300031911 Bacteria 2356
345 Ga0307412_10105702 3300031911 Bacteria 2000
346 Ga0307409_100000390 3300031995 Bacteria 18601
347 Ga0307416_100012366 3300032002 Bacteria 5748
348 Ga0307416_100352796 3300032002 Bacteria 1489
349 Ga0307414_10016946 3300032004 Bacteria 4447
350 Ga0307414_10046005 3300032004 Bacteria 2992
351 Ga0307414_10196506 3300032004 Bacteria 1637
352 Ga0307414_10387071 3300032004 Bacteria 1211
353 Ga0307411_10035131 3300032005 Bacteria 3126
354 Ga0307415_100123357 3300032126 Bacteria 1947
355 Ga0373956_0207708 3300035119 Bacteria 929
356 Ga0373957_0064647 3300035120 Bacteria 1423
357 Ga0316574_0060982 3300035398 Bacteria 2368
358 Ga0373937_0072954 3300036401 Unclassified 3166
359 Ga0316584_0019598 3300036712 Bacteria 4891
360 Ga0395899_0026111 3300037312 Bacteria 4408
361 Ga0395900_0014044 3300037418 Bacteria 8178
362 Ga0395900_0059647 3300037418 Bacteria 3928
363 Ga0395900_0075227 3300037418 Bacteria 3471
364 Ga0395898_0192565 3300037466 Bacteria 1948
365 Ga0395898_0344843 3300037466 Bacteria 1420
366 Ga0395901_0000212 3300038443 Bacteria 73375
367 Ga0395901_0062253 3300038443 Bacteria 3883
368 Ga0395901_0070670 3300038443 Bacteria 3637
369 Ga0237819_00007 3300038705 Bacteria 74520
370 Ga0436361_0648767 3300039447 Bacteria 1580
371 Ga0436361_1075392 3300039447 Bacteria 1991
372 Ga0439436_0004053 3300041404 Bacteria 4490
373 Ga0439436_0014131 3300041404 Bacteria 2413
374 Ga0439438_005806 3300041405 Bacteria 4480
375 Ga0439439_0003616 3300041406 Bacteria 3424
376 Ga0439461_0007371 3300041410 Bacteria 1947
377 Ga0439466_0006254 3300041411 Bacteria 4531
378 Ga0451793_0257911 3300041452 Bacteria 1927
379 Ga0451800_1301053 3300041459 Bacteria 3690
380 Ga0451806_414687 3300041462 Bacteria 2583
381 Ga0451804_0787358 3300041463 Bacteria 2453
382 Ga0451807_1029248 3300041486 Bacteria 4389
383 Ga0439433_0000805 3300041999 Bacteria 6196
384 Ga0439433_0003329 3300041999 Bacteria 3443
385 Ga0439442_000590 3300042002 Bacteria 7857
386 Ga0439442_017738 3300042002 Bacteria 1469
387 Ga0439432_041056 3300042006 Bacteria 1466
388 Ga0439449_0000998 3300042007 Bacteria 11132
389 Ga0439452_016998 3300042010 Bacteria 1966
390 Ga0439457_004793 3300042014 Bacteria 3482
391 Ga0439457_016928 3300042014 Bacteria 1622
392 Ga0439462_0006897 3300042015 Bacteria 2833
393 Ga0450920_003213 3300042122 Bacteria 2821
394 Ga0450920_003277 3300042122 Bacteria 2796
395 Ga0450920_006491 3300042122 Bacteria 2105
396 Ga0450908_019332 3300042184 Bacteria 1200
397 Ga0439434_0016828 3300042435 Bacteria 2185
398 Ga0439434_0036096 3300042435 Bacteria 1511
399 Ga0439444_0015613 3300042437 Bacteria 1284
400 Ga0495627_012263 3300046453 Bacteria 3048
401 Ga0495592_0012285 3300046454 Bacteria 6501
402 Ga0495603_0181321 3300046455 Bacteria 1218
403 Ga0495590_0000005 3300046457 Bacteria 384276
404 Ga0495591_042630 3300046458 Bacteria 1282
405 Ga0495629_0001627 3300046459 Bacteria 17647
406 Ga0495638_0000349 3300046460 Bacteria 57958
407 Ga0495638_0002006 3300046460 Bacteria 17383
408 Ga0495651_0001597 3300046462 Bacteria 17529
409 Ga0495651_0002705 3300046462 Bacteria 13761
410 Ga0495653_0009962 3300046463 Bacteria 7776
411 Ga0495653_0041454 3300046463 Bacteria 3593
412 Ga0495650_0001852 3300046471 Bacteria 18928
413 Ga0495650_0004198 3300046471 Bacteria 9983
414 Ga0495650_0017063 3300046471 Bacteria 3652
415 Ga0495580_0174226 3300046472 Bacteria 1486
416 Ga0495582_0029359 3300046473 Bacteria 3019
417 Ga0495605_0062900 3300046474 Bacteria 1772
418 Ga0495639_0026961 3300046475 Bacteria 2542
419 Ga0495639_0035054 3300046475 Bacteria 2245
420 Ga0495664_0151612 3300046477 Bacteria 1406
421 Ga0495607_0007029 3300046501 Bacteria 7827
422 Ga0495607_0009895 3300046501 Bacteria 6429
423 Ga0495583_0000209 3300046506 Bacteria 98671
424 Ga0495583_0000995 3300046506 Bacteria 32418
425 Ga0495608_0003597 3300046511 Bacteria 11120
426 Ga0495616_0031233 3300046513 Bacteria 2791
427 Ga0495628_0025729 3300046516 Bacteria 4806
428 Ga0495631_0059012 3300046518 Bacteria 1668
429 Ga0495648_0000002 3300046524 Bacteria 593972
430 Ga0495648_0000375 3300046524 Bacteria 48984
431 Ga0495642_0003109 3300046528 Bacteria 6589
432 Ga0495642_0003167 3300046528 Bacteria 6523
433 Ga0495652_0003836 3300046529 Bacteria 14669
434 Ga0495652_0006773 3300046529 Bacteria 10623
435 Ga0495652_0336003 3300046529 Bacteria 1087
436 Ga0495665_0021062 3300046531 Bacteria 3503
437 Ga0495586_0021160 3300046535 Bacteria 3465
438 Ga0495587_0007588 3300046536 Bacteria 7018
439 Ga0495587_0154958 3300046536 Bacteria 1305
440 Ga0495598_0024486 3300046537 Bacteria 1637
441 Ga0495609_0044388 3300046538 Bacteria 1993
442 Ga0495645_0060911 3300046543 Bacteria 2735
443 Ga0495645_0086426 3300046543 Bacteria 2244
444 Ga0495622_0000402 3300046557 Bacteria 29185
445 Ga0495633_0000888 3300046558 Bacteria 25638
446 Ga0495633_0031307 3300046558 Bacteria 2580
447 Ga0495667_0001544 3300046559 Bacteria 15256
448 Ga0495667_0014924 3300046559 Bacteria 5249
449 Ga0495656_0016425 3300046615 Bacteria 2808
450 Ga0495668_0000719 3300046616 Bacteria 39799
451 Ga0495625_0000124 3300046660 Bacteria 120849
452 Ga0495635_0019665 3300046663 Bacteria 4702
453 Ga0495661_0064693 3300046665 Bacteria 2157
454 Ga0495588_0004262 3300046674 Bacteria 6307
455 Ga0495588_0033239 3300046674 Bacteria 2604
456 Ga0495657_0002665 3300046675 Bacteria 14916
457 Ga0495599_0064677 3300046678 Bacteria 2285
458 Ga0495599_0156691 3300046678 Bacteria 1409
459 Ga0495646_0059292 3300046680 Bacteria 2286
460 Ga0495646_0074194 3300046680 Bacteria 1997
461 Ga0495669_0058797 3300046684 Bacteria 1735
462 Ga0495669_0070470 3300046684 Bacteria 1592
463 Ga0495613_0026618 3300046689 Bacteria 4308
464 Ga0495589_0143784 3300046794 Bacteria 1141
465 Ga0495600_0012206 3300046809 Bacteria 5367
466 Ga0495600_0129405 3300046809 Bacteria 1641
467 Ga0495660_0000684 3300046810 Bacteria 25952
468 Ga0495660_0159541 3300046810 Bacteria 1107
469 Ga0495581_0003631 3300047315 Bacteria 8882
470 Ga0495581_0008930 3300047315 Bacteria 5802
471 Ga0495581_0031319 3300047315 Bacteria 3082
472 Ga0495581_0136656 3300047315 Bacteria 1429
473 Ga0495604_0025317 3300047317 Bacteria 4729
474 Ga0495604_0035559 3300047317 Bacteria 3934
475 Ga0495636_0030713 3300047318 Bacteria 2198
476 Ga0495674_0006069 3300047319 Bacteria 11595
477 Ga0495674_0036696 3300047319 Bacteria 4410
478 Ga0495674_0075318 3300047319 Bacteria 2904
479 Ga0495676_0009750 3300047321 Bacteria 8728
480 Ga0495680_0005496 3300047322 Bacteria 11906
481 Ga0495680_0134581 3300047322 Bacteria 1813
482 Ga0495675_0217698 3300047444 Bacteria 1157
483 Ga0495673_0000427 3300047469 Bacteria 47775
484 Ga0495681_0098629 3300047470 Bacteria 1280
485 Ga0495684_0019689 3300047471 Bacteria 5199
486 Ga0495686_0040674 3300047472 Bacteria 2963
487 Ga0495593_0056985 3300047673 Bacteria 2053
488 Ga0495602_0007375 3300048088 Bacteria 11513
489 Ga0495602_0040834 3300048088 Bacteria 4246
490 Ga0495614_0038641 3300048089 Bacteria 2048
491 Ga0495626_0039820 3300048091 Bacteria 2222
492 Ga0496100_0016500 3300048903 Bacteria 4338
493 Ga0496101_0016296 3300048904 Bacteria 5016
494 Ga0496102_0033322 3300048905 Bacteria 4628
495 Ga0496102_0040630 3300048905 Bacteria 4208
496 Ga0496102_0138920 3300048905 Bacteria 2277
497 Ga0496102_0297353 3300048905 Bacteria 1521
498 Ga0496102_0450985 3300048905 Bacteria 1207
499 Ga0496103_0026578 3300048906 Bacteria 3503
500 Ga0496103_0045262 3300048906 Bacteria 2715
501 Ga0496103_0061550 3300048906 Bacteria 2334
502 Ga0496104_0074077 3300048907 Bacteria 3241
503 Ga0496104_0196961 3300048907 Bacteria 1926
504 Ga0496104_0384812 3300048907 Bacteria 1315
505 Ga0496105_0022937 3300048908 Bacteria 5061
506 Ga0496105_0031284 3300048908 Bacteria 4363
507 Ga0496105_0063890 3300048908 Bacteria 3037
508 Ga0496107_0001472 3300048910 Bacteria 14564
509 Ga0496107_0016974 3300048910 Bacteria 5119
510 Ga0496107_0179394 3300048910 Bacteria 1572
511 Ga0496108_0213192 3300048911 Bacteria 1676
512 Ga0496109_0333773 3300048912 Bacteria 1431
513 Ga0496110_0040917 3300048913 Bacteria 4041
514 Ga0496110_0069866 3300048913 Bacteria 3110
515 Ga0496111_0029654 3300048914 Bacteria 3886
516 Ga0496112_0082633 3300048915 Bacteria 3176
517 Ga0496112_0234863 3300048915 Bacteria 1787
518 Ga0496113_0043686 3300048916 Bacteria 3317
519 Ga0496113_0082665 3300048916 Bacteria 2463
520 Ga0496113_0295913 3300048916 Bacteria 1295
521 Ga0496114_0058080 3300048917 Bacteria 3230
522 Ga0496114_0105752 3300048917 Bacteria 2407
523 Ga0496115_0037698 3300048918 Bacteria 3832
524 Ga0496115_0227974 3300048918 Bacteria 1537
525 Ga0496115_0262489 3300048918 Bacteria 1420
526 Ga0496116_0005857 3300048919 Bacteria 11292
527 Ga0496116_0007649 3300048919 Bacteria 9532
528 Ga0496116_0049894 3300048919 Bacteria 2793
529 Ga0496116_0171041 3300048919 Bacteria 1177
530 Ga0496117_0000369 3300048920 Bacteria 78448
531 Ga0496117_0000829 3300048920 Bacteria 47900
532 Ga0496117_0001338 3300048920 Bacteria 36231
533 Ga0496117_0005490 3300048920 Bacteria 13289
534 Ga0496117_0009239 3300048920 Bacteria 9218
535 Ga0496117_0021751 3300048920 Bacteria 5175
536 Ga0496117_0053757 3300048920 Bacteria 2827
537 Ga0496118_0000406 3300048921 Bacteria 71874
538 Ga0496118_0002325 3300048921 Bacteria 25790
539 Ga0496118_0002786 3300048921 Bacteria 22881
540 Ga0496118_0016572 3300048921 Bacteria 6756
541 Ga0496118_0054731 3300048921 Bacteria 3019
542 Ga0496118_0086813 3300048921 Bacteria 2172
543 Ga0496118_0147901 3300048921 Bacteria 1475
544 Ga0496119_0000301 3300048922 Bacteria 69339
545 Ga0496119_0006605 3300048922 Bacteria 10683
546 Ga0496119_0008842 3300048922 Bacteria 8758
547 Ga0496119_0035555 3300048922 Bacteria 3262
548 Ga0496120_0000402 3300048923 Bacteria 69322
549 Ga0496120_0002718 3300048923 Bacteria 17292
550 Ga0496120_0018130 3300048923 Bacteria 4544
551 Ga0496120_0024279 3300048923 Bacteria 3783
552 Ga0496121_0000164 3300048924 Bacteria 145421
553 Ga0496121_0002806 3300048924 Bacteria 25767
554 Ga0496121_0006928 3300048924 Bacteria 13816
555 Ga0496121_0008829 3300048924 Bacteria 11737
556 Ga0496121_0057224 3300048924 Bacteria 3233
557 Ga0496121_0098168 3300048924 Bacteria 2267
558 Ga0496122_0000227 3300048925 Bacteria 125743
559 Ga0496122_0001751 3300048925 Bacteria 33413
560 Ga0496122_0011096 3300048925 Bacteria 9184
561 Ga0496122_0014211 3300048925 Bacteria 7714
562 Ga0496122_0014373 3300048925 Bacteria 7659
563 Ga0496122_0060247 3300048925 Bacteria 2796
564 Ga0496122_0063183 3300048925 Bacteria 2704
565 Ga0496122_0077851 3300048925 Bacteria 2326
566 Ga0496122_0085595 3300048925 Bacteria 2174
567 Ga0496123_0000265 3300048926 Bacteria 104723
568 Ga0496123_0000795 3300048926 Bacteria 50979
569 Ga0496123_0004482 3300048926 Bacteria 14646
570 Ga0496123_0007554 3300048926 Bacteria 10189
571 Ga0496123_0009133 3300048926 Bacteria 8968
572 Ga0496123_0014808 3300048926 Bacteria 6438
573 Ga0496124_0000034 3300048927 Bacteria 325332
574 Ga0496124_0000991 3300048927 Bacteria 44959
575 Ga0496124_0002054 3300048927 Bacteria 27351
576 Ga0496124_0006990 3300048927 Bacteria 12099
577 Ga0496124_0008723 3300048927 Bacteria 10532
578 Ga0496124_0016659 3300048927 Bacteria 6973
579 Ga0496124_0026942 3300048927 Bacteria 5172
580 Ga0496124_0034367 3300048927 Bacteria 4451
581 Ga0496124_0077937 3300048927 Bacteria 2732
582 Ga0496124_0078881 3300048927 Bacteria 2712
583 Ga0496124_0156785 3300048927 Bacteria 1779
584 Ga0496124_0202515 3300048927 Bacteria 1508
585 Ga0496125_0000044 3300048928 Bacteria 296762
586 Ga0496125_0000190 3300048928 Bacteria 132540
587 Ga0496125_0002163 3300048928 Bacteria 26296
588 Ga0496125_0003842 3300048928 Bacteria 17821
589 Ga0496125_0007703 3300048928 Bacteria 11409
590 Ga0496125_0028908 3300048928 Bacteria 4992
591 Ga0496125_0034756 3300048928 Bacteria 4436
592 Ga0496126_0001069 3300048929 Bacteria 46093
593 Ga0496126_0004648 3300048929 Bacteria 16233
594 Ga0496126_0006225 3300048929 Bacteria 13340
595 Ga0496126_0025860 3300048929 Bacteria 5639
596 Ga0496126_0066238 3300048929 Bacteria 3230
597 Ga0496126_0079199 3300048929 Bacteria 2909
598 Ga0496126_0167205 3300048929 Bacteria 1876
599 Ga0501315_003829 3300049531 Bacteria 1533
600 Ga0501031_0040572 3300049568 Bacteria 3039
601 Ga0501032_0016464 3300049569 Bacteria 5200
602 Ga0501032_0062372 3300049569 Bacteria 2498
603 Ga0501033_0000839 3300049570 Bacteria 28060
604 Ga0501033_0042833 3300049570 Bacteria 3374
605 Ga0501034_0000798 3300049571 Bacteria 46906
606 Ga0501037_0000228 3300049573 Bacteria 49067
607 Ga0501037_0159036 3300049573 Bacteria 1611
608 Ga0501038_0001410 3300049574 Bacteria 22000
609 Ga0501039_0221615 3300049575 Bacteria 1487
610 Ga0501047_0051969 3300049581 Bacteria 3961
611 Ga0501047_0402763 3300049581 Bacteria 1201
612 Ga0501070_0288512 3300049586 Bacteria 1338
613 Ga0501079_0421293 3300049741 Bacteria 1048
614 Ga0501080_0095970 3300049742 Bacteria 2753
615 Ga0501035_0001120 3300049822 Bacteria 28018
616 Ga0501035_0301184 3300049822 Bacteria 1351
617 Ga0501044_0075508 3300049823 Bacteria 3422
618 nmdc:mga00v17_308_c1 3300050491 Bacteria 28036
619 nmdc:mga00v17_47857_c1 3300050491 Bacteria 2590
620 nmdc:mga0yw44_123233_c1 3300050492 Bacteria 1671
621 nmdc:mga0yw44_17954_c1 3300050492 Bacteria 3863
622 nmdc:mga05p37_55686_c1 3300050507 Bacteria 4868
623 nmdc:mga06r32_29282_c1 3300050510 Bacteria 5159
624 nmdc:mga08y16_47829_c1 3300050511 Bacteria 4477
625 nmdc:mga0n895_221882_c1 3300050512 Bacteria 1919
626 nmdc:mga0sz30_15652_c1 3300050516 Bacteria 2999
627 Ga0495601_0107032 3300053077 Bacteria 1809
628 Ga0500644_0000306 3300053088 Bacteria 25948
629 Ga0500618_001158 3300053125 Bacteria 12766
630 Ga0500618_002275 3300053125 Bacteria 7423
631 Ga0500616_0000667 3300053153 Bacteria 40674
632 Ga0587072_001000 3300059643 Bacteria 3293

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0207708 Ga0373956_0207708_77_889 269
2 3300005455 Ga0070663_100028245 Ga0070663_1000282455 318
3 3300005548 Ga0070665_100011695 Ga0070665_1000116958 318
4 3300005563 Ga0068855_100252115 Ga0068855_1002521152 318
5 3300005578 Ga0068854_100014660 Ga0068854_1000146601 318
6 3300005616 Ga0068852_100145249 Ga0068852_1001452492 318
7 3300009093 Ga0105240_10036630 Ga0105240_100366308 318
8 3300009174 Ga0105241_10007804 Ga0105241_100078048 318
9 3300009545 Ga0105237_10315012 Ga0105237_103150122 318
10 3300009551 Ga0105238_10170518 Ga0105238_101705182 318
11 3300010375 Ga0105239_10024465 Ga0105239_100244659 318
12 3300013105 Ga0157369_10250363 Ga0157369_102503631 318
13 3300013296 Ga0157374_10322933 Ga0157374_103229332 318
14 3300025911 Ga0207654_10006004 Ga0207654_100060046 318
15 3300025913 Ga0207695_10012681 Ga0207695_1001268110 318
16 3300025914 Ga0207671_10004397 Ga0207671_1000439715 318
17 3300025924 Ga0207694_10004579 Ga0207694_100045793 318
18 3300025949 Ga0207667_10262627 Ga0207667_102626271 318
19 3300026041 Ga0207639_10041821 Ga0207639_100418214 318
20 3300026067 Ga0207678_10018900 Ga0207678_100189008 318
21 3300026078 Ga0207702_10048334 Ga0207702_100483341 318
22 3300026142 Ga0207698_10113019 Ga0207698_101130192 318
23 3300025904 Ga0207647_10087403 Ga0207647_100874031 319
24 3300025981 Ga0207640_10062050 Ga0207640_100620502 319
25 3300009551 Ga0105238_10096300 Ga0105238_100963002 323
26 3300005545 Ga0070695_100117092 Ga0070695_1001170922 328
27 3300003781 Ga0055536_1004496 Ga0055536_10044966 329
28 3300003791 Ga0055530_10003547 Ga0055530_100035474 329
29 3300025292 Ga0209676_1000128 Ga0209676_100012830 329
30 3300025298 Ga0209050_1000796 Ga0209050_100079611 329
31 3300025303 Ga0209051_1007550 Ga0209051_10075501 329
32 3300025304 Ga0209257_1014808 Ga0209257_10148081 329
33 3300046462 Ga0495651_0001597 Ga0495651_0001597_8333_9346 330
34 3300046516 Ga0495628_0025729 Ga0495628_0025729_3397_4410 330
35 3300046529 Ga0495652_0006773 Ga0495652_0006773_3208_4221 330
36 3300046543 Ga0495645_0086426 Ga0495645_0086426_308_1321 330
37 3300046678 Ga0495599_0156691 Ga0495599_0156691_367_1380 330
38 3300046809 Ga0495600_0012206 Ga0495600_0012206_2390_3403 330
39 3300047317 Ga0495604_0025317 Ga0495604_0025317_2506_3519 330
40 3300025728 Ga0207655_1016757 Ga0207655_10167572 331
41 3300025728 Ga0207655_1062978 Ga0207655_10629782 331
42 3300048922 Ga0496119_0008842 Ga0496119_0008842_495_1559 331
43 3300048923 Ga0496120_0024279 Ga0496120_0024279_16_1080 331
44 3300048925 Ga0496122_0060247 Ga0496122_0060247_178_1242 331
45 3300005331 Ga0070670_100273742 Ga0070670_1002737422 332
46 3300005543 Ga0070672_100141408 Ga0070672_1001414082 332
47 3300025728 Ga0207655_1002897 Ga0207655_10028973 332
48 3300046529 Ga0495652_0336003 Ga0495652_0336003_11_1009 332
49 iso_pu_bacteria 8002745576 8002749022 332
50 3300005334 Ga0068869_100236838 Ga0068869_1002368382 333
51 3300009176 Ga0105242_10312352 Ga0105242_103123521 333
52 3300009553 Ga0105249_10407113 Ga0105249_104071131 333
53 3300013306 Ga0163162_10442528 Ga0163162_104425282 333
54 3300014325 Ga0163163_10422730 Ga0163163_104227301 333
55 3300031548 Ga0307408_100034513 Ga0307408_1000345132 333
56 3300031731 Ga0307405_10012857 Ga0307405_100128574 333
57 3300031824 Ga0307413_10016028 Ga0307413_100160283 333
58 3300031852 Ga0307410_10025915 Ga0307410_100259152 333
59 3300031901 Ga0307406_10154302 Ga0307406_101543022 333
60 3300032002 Ga0307416_100012366 Ga0307416_1000123662 333
61 3300032005 Ga0307411_10035131 Ga0307411_100351312 333
62 3300050492 nmdc:mga0yw44_123233_c1 nmdc:mga0yw44_123233_c1_390_1406 333
63 iso_pu_bacteria 2858950400 2858956662 333
64 iso_pu_bacteria 2842391507 2842393436 334
65 iso_pu_bacteria 2884960567 2884961129 334
66 iso_pu_bacteria 2917832318 2917833192 334
67 3300035120 Ga0373957_0064647 Ga0373957_0064647_350_1360 335
68 3300036401 Ga0373937_0072954 Ga0373937_0072954_516_1532 335
69 3300046454 Ga0495592_0012285 Ga0495592_0012285_4458_5468 335
70 3300046462 Ga0495651_0002705 Ga0495651_0002705_1624_2634 335
71 3300046463 Ga0495653_0009962 Ga0495653_0009962_581_1591 335
72 3300046511 Ga0495608_0003597 Ga0495608_0003597_1461_2471 335
73 3300046529 Ga0495652_0003836 Ga0495652_0003836_8058_9068 335
74 3300046536 Ga0495587_0007588 Ga0495587_0007588_1735_2745 335
75 3300046543 Ga0495645_0060911 Ga0495645_0060911_377_1387 335
76 3300046559 Ga0495667_0001544 Ga0495667_0001544_8635_9645 335
77 3300046663 Ga0495635_0019665 Ga0495635_0019665_1994_3004 335
78 3300046675 Ga0495657_0002665 Ga0495657_0002665_8457_9467 335
79 3300046678 Ga0495599_0064677 Ga0495599_0064677_629_1639 335
80 3300046680 Ga0495646_0059292 Ga0495646_0059292_664_1674 335
81 3300047317 Ga0495604_0035559 Ga0495604_0035559_688_1698 335
82 3300047319 Ga0495674_0036696 Ga0495674_0036696_1302_2312 335
83 3300047322 Ga0495680_0005496 Ga0495680_0005496_2382_3392 335
84 3300047471 Ga0495684_0019689 Ga0495684_0019689_66_1076 335
85 3300048088 Ga0495602_0040834 Ga0495602_0040834_2489_3499 335
86 3300049586 Ga0501070_0288512 Ga0501070_0288512_175_1239 335
87 3300053077 Ga0495601_0107032 Ga0495601_0107032_683_1693 335
88 3300053153 Ga0500616_0000667 Ga0500616_0000667_28591_29607 335
89 iso_pu_bacteria 2904497146 2904500202 335
90 iso_pu_bacteria 2910809715 2910812527 335
91 iso_pu_bacteria 2919034639 2919036534 335
92 iso_pu_bacteria 2919538618 2919540995 335
93 iso_pu_bacteria 2932426870 2932427138 335
94 iso_pu_bacteria 2939674588 2939677282 335
95 iso_pu_bacteria 2945941187 2945941454 335
96 iso_pu_bacteria 2945941187 2945942723 335
97 iso_pu_bacteria 8054107350 8054109448 335
98 3300003322 rootL2_10057367 rootL2_100573673 336
99 3300005434 Ga0070709_10272069 Ga0070709_102720691 336
100 3300006175 Ga0070712_100138658 Ga0070712_1001386582 336
101 3300009036 Ga0105244_10006402 Ga0105244_100064023 336
102 3300009036 Ga0105244_10017652 Ga0105244_100176522 336
103 3300009148 Ga0105243_10125346 Ga0105243_101253462 336
104 3300009176 Ga0105242_10048898 Ga0105242_100488982 336
105 3300009553 Ga0105249_10093359 Ga0105249_100933592 336
106 3300013297 Ga0157378_10168830 Ga0157378_101688302 336
107 3300013306 Ga0163162_10132160 Ga0163162_101321602 336
108 3300025915 Ga0207693_10243509 Ga0207693_102435091 336
109 3300031727 Ga0316576_10003440 Ga0316576_100034403 336
110 3300031728 Ga0316578_10129655 Ga0316578_101296551 336
111 3300035398 Ga0316574_0060982 Ga0316574_0060982_31_1113 336
112 3300036712 Ga0316584_0019598 Ga0316584_0019598_3724_4806 336
113 3300037312 Ga0395899_0026111 Ga0395899_0026111_2716_3726 336
114 3300037418 Ga0395900_0059647 Ga0395900_0059647_1674_2684 336
115 3300037466 Ga0395898_0344843 Ga0395898_0344843_203_1213 336
116 3300041404 Ga0439436_0004053 Ga0439436_0004053_3186_4196 336
117 3300041404 Ga0439436_0014131 Ga0439436_0014131_1247_2257 336
118 3300041405 Ga0439438_005806 Ga0439438_005806_2111_3121 336
119 3300041406 Ga0439439_0003616 Ga0439439_0003616_503_1513 336
120 3300041410 Ga0439461_0007371 Ga0439461_0007371_606_1616 336
121 3300041999 Ga0439433_0000805 Ga0439433_0000805_3040_4050 336
122 3300041999 Ga0439433_0003329 Ga0439433_0003329_2224_3234 336
123 3300042002 Ga0439442_000590 Ga0439442_000590_4337_5347 336
124 3300042002 Ga0439442_017738 Ga0439442_017738_49_1059 336
125 3300042006 Ga0439432_041056 Ga0439432_041056_282_1292 336
126 3300042007 Ga0439449_0000998 Ga0439449_0000998_4891_5901 336
127 3300042010 Ga0439452_016998 Ga0439452_016998_864_1874 336
128 3300042014 Ga0439457_004793 Ga0439457_004793_261_1271 336
129 3300042014 Ga0439457_016928 Ga0439457_016928_492_1502 336
130 3300042015 Ga0439462_0006897 Ga0439462_0006897_215_1225 336
131 3300042122 Ga0450920_003213 Ga0450920_003213_164_1174 336
132 3300042122 Ga0450920_003277 Ga0450920_003277_1079_2089 336
133 3300042435 Ga0439434_0016828 Ga0439434_0016828_269_1279 336
134 3300042435 Ga0439434_0036096 Ga0439434_0036096_373_1383 336
135 3300046473 Ga0495582_0029359 Ga0495582_0029359_293_1303 336
136 3300046475 Ga0495639_0026961 Ga0495639_0026961_849_1859 336
137 3300046531 Ga0495665_0021062 Ga0495665_0021062_1857_2867 336
138 3300046535 Ga0495586_0021160 Ga0495586_0021160_204_1214 336
139 3300046674 Ga0495588_0004262 Ga0495588_0004262_308_1318 336
140 3300046809 Ga0495600_0129405 Ga0495600_0129405_488_1498 336
141 3300047315 Ga0495581_0003631 Ga0495581_0003631_6103_7113 336
142 3300047322 Ga0495680_0134581 Ga0495680_0134581_513_1523 336
143 3300047444 Ga0495675_0217698 Ga0495675_0217698_85_1095 336
144 3300047673 Ga0495593_0056985 Ga0495593_0056985_667_1677 336
145 3300048905 Ga0496102_0033322 Ga0496102_0033322_170_1180 336
146 3300048906 Ga0496103_0026578 Ga0496103_0026578_1276_2286 336
147 3300048906 Ga0496103_0045262 Ga0496103_0045262_1586_2596 336
148 3300048907 Ga0496104_0074077 Ga0496104_0074077_1999_3009 336
149 3300048908 Ga0496105_0063890 Ga0496105_0063890_332_1342 336
150 3300048911 Ga0496108_0213192 Ga0496108_0213192_235_1245 336
151 3300048912 Ga0496109_0333773 Ga0496109_0333773_62_1072 336
152 3300048913 Ga0496110_0069866 Ga0496110_0069866_1485_2495 336
153 3300048915 Ga0496112_0234863 Ga0496112_0234863_159_1169 336
154 3300048916 Ga0496113_0043686 Ga0496113_0043686_357_1367 336
155 3300048917 Ga0496114_0058080 Ga0496114_0058080_2080_3090 336
156 3300048918 Ga0496115_0262489 Ga0496115_0262489_12_1022 336
157 3300049531 Ga0501315_003829 Ga0501315_003829_334_1344 336
158 3300049569 Ga0501032_0062372 Ga0501032_0062372_370_1380 336
159 3300049573 Ga0501037_0159036 Ga0501037_0159036_442_1452 336
160 iso_pu_bacteria 2597490356 2599100420 336
161 iso_pu_bacteria 2599185178 2599448390 336
162 iso_pu_bacteria 2600254954 2600444353 336
163 iso_pu_bacteria 2600255389 2602008168 336
164 iso_pu_bacteria 2690315906 2691514942 336
165 iso_pu_bacteria 2728369097 2729145606 336
166 iso_pu_bacteria 2808606357 2808828049 336
167 iso_pu_bacteria 2808606360 2808853407 336
168 iso_pu_bacteria 2808606371 2808897399 336
169 iso_pu_bacteria 2811994881 2812369876 336
170 iso_pu_bacteria 2823421272 2823426007 336
171 iso_pu_bacteria 2857740372 2857744213 336
172 iso_pu_bacteria 2900577576 2900578504 336
173 iso_pu_bacteria 2904776348 2904777002 336
174 iso_pu_bacteria 2919059106 2919059453 336
175 iso_pu_bacteria 2919391150 2919392971 336
176 iso_pu_bacteria 2919501602 2919502752 336
177 iso_pu_bacteria 2923519811 2923523962 336
178 iso_pu_bacteria 2926063275 2926064425 336
179 iso_pu_bacteria 2928058823 2928060461 336
180 iso_pu_bacteria 2933418574 2933419762 336
181 iso_pu_bacteria 2939598168 2939599015 336
182 iso_pu_bacteria 2939647034 2939649842 336
183 iso_pu_bacteria 2953998280 2953999263 336
184 iso_pu_bacteria 3007315729 3007316363 336
185 iso_pu_bacteria 651053060 651174694 336
186 iso_pu_bacteria 8034962539 8034965326 336
187 3300006881 Ga0068865_100259213 Ga0068865_1002592131 337
188 3300028800 Ga0265338_10000518 Ga0265338_1000051847 337
189 3300029957 Ga0265324_10032631 Ga0265324_100326312 337
190 3300042437 Ga0439444_0015613 Ga0439444_0015613_132_1241 337
191 3300047319 Ga0495674_0006069 Ga0495674_0006069_6055_7068 337
192 3300049575 Ga0501039_0221615 Ga0501039_0221615_107_1120 337
193 3300049741 Ga0501079_0421293 Ga0501079_0421293_22_1035 337
194 iso_pu_bacteria 2524023250 2524612501 337
195 iso_pu_bacteria 2599185292 2599903911 337
196 iso_pu_bacteria 2643221569 2643863487 337
197 iso_pu_bacteria 2643221594 2643982674 337
198 iso_pu_bacteria 2643221621 2644120724 337
199 iso_pu_bacteria 2738543005 2739202762 337
200 iso_pu_bacteria 2808606395 2809034783 337
201 iso_pu_bacteria 2842333319 2842340965 337
202 iso_pu_bacteria 2858688981 2858695394 337
203 iso_pu_bacteria 2882456835 2882459401 337
204 iso_pu_bacteria 2928142448 2928143022 337
205 iso_pu_bacteria 2941479691 2941480543 337
206 3300005435 Ga0070714_100308894 Ga0070714_1003088942 338
207 3300005467 Ga0070706_100199661 Ga0070706_1001996611 338
208 3300009011 Ga0105251_10008083 Ga0105251_100080832 338
209 3300009036 Ga0105244_10020719 Ga0105244_100207192 338
210 3300013102 Ga0157371_10016092 Ga0157371_100160925 338
211 3300013102 Ga0157371_10088033 Ga0157371_100880333 338
212 3300013105 Ga0157369_10014336 Ga0157369_100143363 338
213 3300028800 Ga0265338_10003827 Ga0265338_1000382715 338
214 3300049570 Ga0501033_0042833 Ga0501033_0042833_2149_3216 338
215 3300049581 Ga0501047_0051969 Ga0501047_0051969_2327_3394 338
216 3300049823 Ga0501044_0075508 Ga0501044_0075508_2148_3215 338
217 iso_pu_bacteria 2501025501 2501072070 338
218 iso_pu_bacteria 2501025502 2501084401 338
219 iso_pu_bacteria 2510065053 2510284457 338
220 iso_pu_bacteria 2510065055 2510295576 338
221 iso_pu_bacteria 2510065058 2510312359 338
222 iso_pu_bacteria 2510917013 2511088519 338
223 iso_pu_bacteria 2510917014 2511100880 338
224 iso_pu_bacteria 2510917015 2511107361 338
225 iso_pu_bacteria 2513237082 2513553354 338
226 iso_pu_bacteria 2513237083 2513564974 338
227 iso_pu_bacteria 2515154189 2516020402 338
228 iso_pu_bacteria 2547132130 2547503097 338
229 iso_pu_bacteria 2554235132 2554818547 338
230 iso_pu_bacteria 2576861471 2578460326 338
231 iso_pu_bacteria 2593339238 2595446112 338
232 iso_pu_bacteria 2606217733 2608384213 338
233 iso_pu_bacteria 2643221579 2643906500 338
234 iso_pu_bacteria 2643221581 2643913990 338
235 iso_pu_bacteria 2643221645 2644253316 338
236 iso_pu_bacteria 2643221664 2644355640 338
237 iso_pu_bacteria 2687453129 2687580047 338
238 iso_pu_bacteria 2721755523 2722884494 338
239 iso_pu_bacteria 2747842428 2747951361 338
240 iso_pu_bacteria 2751185800 2753358544 338
241 iso_pu_bacteria 2751185897 2753767823 338
242 iso_pu_bacteria 2773857672 2774131640 338
243 iso_pu_bacteria 2816332141 2816519622 338
244 iso_pu_bacteria 2818991457 2819661991 338
245 iso_pu_bacteria 2839138175 2839143091 338
246 iso_pu_bacteria 2852649853 2852652826 338
247 iso_pu_bacteria 2852684882 2852688664 338
248 iso_pu_bacteria 2855730933 2855736993 338
249 iso_pu_bacteria 2855767633 2855767703 338
250 iso_pu_bacteria 2857442823 2857444113 338
251 iso_pu_bacteria 2874220319 2874224112 338
252 iso_pu_bacteria 2904479285 2904481132 338
253 iso_pu_bacteria 2919089067 2919089953 338
254 iso_pu_bacteria 2919125081 2919127326 338
255 iso_pu_bacteria 2919130084 2919133326 338
256 iso_pu_bacteria 2919134579 2919138246 338
257 iso_pu_bacteria 2919513703 2919514046 338
258 iso_pu_bacteria 2923516293 2923516455 338
259 iso_pu_bacteria 2928496128 2928499964 338
260 iso_pu_bacteria 2928531327 2928535599 338
261 iso_pu_bacteria 2929195423 2929195456 338
262 iso_pu_bacteria 2931380184 2931382728 338
263 iso_pu_bacteria 2937610967 2937613395 338
264 iso_pu_bacteria 2939622612 2939623238 338
265 iso_pu_bacteria 2939626828 2939628145 338
266 iso_pu_bacteria 2941475908 2941479180 338
267 iso_pu_bacteria 2952252522 2952253898 338
268 iso_pu_bacteria 2961047084 2961050876 338
269 iso_pu_bacteria 2961064222 2961067923 338
270 iso_pu_bacteria 2974298342 2974301886 338
271 iso_pu_bacteria 2984499530 2984500546 338
272 iso_pu_bacteria 2984504281 2984507063 338
273 iso_pu_bacteria 2987605356 2987607021 338
274 iso_pu_bacteria 8003955200 8003960345 338
275 iso_pu_bacteria 8016728285 8016730868 338
276 iso_pu_bacteria 8021622325 8021622453 338
277 iso_pu_bacteria 8021626552 8021628834 338
278 iso_pu_bacteria 8021648035 8021650990 338
279 3300003320 rootH2_10049822 rootH2_100498222 339
280 3300005288 Ga0065714_10007259 Ga0065714_100072593 339
281 3300005328 Ga0070676_10015876 Ga0070676_100158763 339
282 3300005331 Ga0070670_100337027 Ga0070670_1003370271 339
283 3300005333 Ga0070677_10004983 Ga0070677_100049831 339
284 3300005335 Ga0070666_10019893 Ga0070666_100198932 339
285 3300005347 Ga0070668_100034112 Ga0070668_1000341122 339
286 3300005353 Ga0070669_100201742 Ga0070669_1002017421 339
287 3300005354 Ga0070675_100014679 Ga0070675_1000146792 339
288 3300005355 Ga0070671_100032521 Ga0070671_1000325213 339
289 3300005356 Ga0070674_100016361 Ga0070674_1000163613 339
290 3300005364 Ga0070673_100020953 Ga0070673_1000209532 339
291 3300005367 Ga0070667_100086224 Ga0070667_1000862242 339
292 3300005456 Ga0070678_100042276 Ga0070678_1000422762 339
293 3300005615 Ga0070702_100125785 Ga0070702_1001257852 339
294 3300005840 Ga0068870_10043231 Ga0068870_100432312 339
295 3300009036 Ga0105244_10139238 Ga0105244_101392381 339
296 3300009148 Ga0105243_10026584 Ga0105243_100265842 339
297 3300009177 Ga0105248_10052388 Ga0105248_100523882 339
298 3300009553 Ga0105249_10092216 Ga0105249_100922162 339
299 3300011119 Ga0105246_10008423 Ga0105246_100084232 339
300 3300013102 Ga0157371_10040986 Ga0157371_100409863 339
301 3300013306 Ga0163162_10061533 Ga0163162_100615332 339
302 3300013308 Ga0157375_10065595 Ga0157375_100655953 339
303 3300013308 Ga0157375_10191793 Ga0157375_101917932 339
304 3300025290 Ga0207673_1004250 Ga0207673_10042502 339
305 3300025315 Ga0207697_10004112 Ga0207697_100041123 339
306 3300025728 Ga0207655_1008231 Ga0207655_10082312 339
307 3300025893 Ga0207682_10000870 Ga0207682_100008702 339
308 3300025907 Ga0207645_10005766 Ga0207645_100057666 339
309 3300025908 Ga0207643_10027172 Ga0207643_100271722 339
310 3300025923 Ga0207681_10072066 Ga0207681_100720662 339
311 3300025925 Ga0207650_10017851 Ga0207650_100178512 339
312 3300025926 Ga0207659_10026798 Ga0207659_100267982 339
313 3300025931 Ga0207644_10041097 Ga0207644_100410974 339
314 3300025934 Ga0207686_10021887 Ga0207686_100218872 339
315 3300025935 Ga0207709_10025527 Ga0207709_100255273 339
316 3300025937 Ga0207669_10053122 Ga0207669_100531222 339
317 3300025940 Ga0207691_10014615 Ga0207691_100146152 339
318 3300025941 Ga0207711_10108645 Ga0207711_101086451 339
319 3300025986 Ga0207658_10038290 Ga0207658_100382904 339
320 3300026121 Ga0207683_10017060 Ga0207683_100170605 339
321 3300031824 Ga0307413_10141129 Ga0307413_101411292 339
322 3300032004 Ga0307414_10387071 Ga0307414_103870712 339
323 3300041411 Ga0439466_0006254 Ga0439466_0006254_772_1791 339
324 3300046518 Ga0495631_0059012 Ga0495631_0059012_15_1034 339
325 3300047315 Ga0495581_0031319 Ga0495581_0031319_721_1740 339
326 3300047315 Ga0495581_0136656 Ga0495581_0136656_87_1142 339
327 3300048905 Ga0496102_0138920 Ga0496102_0138920_488_1507 339
328 3300048907 Ga0496104_0196961 Ga0496104_0196961_612_1631 339
329 3300048908 Ga0496105_0031284 Ga0496105_0031284_1033_2052 339
330 3300048910 Ga0496107_0179394 Ga0496107_0179394_379_1398 339
331 3300048913 Ga0496110_0040917 Ga0496110_0040917_1157_2176 339
332 3300048915 Ga0496112_0082633 Ga0496112_0082633_204_1223 339
333 3300048916 Ga0496113_0295913 Ga0496113_0295913_27_1046 339
334 3300048917 Ga0496114_0105752 Ga0496114_0105752_292_1311 339
335 3300048918 Ga0496115_0037698 Ga0496115_0037698_2706_3725 339
336 3300048927 Ga0496124_0034367 Ga0496124_0034367_3125_4144 339
337 iso_pu_bacteria 2928115317 2928119619 339
338 3300001915 JGI24741J21665_1000701 JGI24741J21665_10007014 340
339 3300001979 JGI24740J21852_10001102 JGI24740J21852_100011023 340
340 3300001979 JGI24740J21852_10003569 JGI24740J21852_100035693 340
341 3300002705 JGI25156J39149_1002620 JGI25156J39149_10026203 340
342 3300003323 rootH1_10002003 rootH1_100020031 340
343 3300003567 Ga0006554J51385_1020996 Ga0006554J51385_10209962 340
344 3300003578 Ga0006562J51391_1003719 Ga0006562J51391_10037193 340
345 3300003578 Ga0006562J51391_1042671 Ga0006562J51391_10426712 340
346 3300003578 Ga0006562J51391_1060129 Ga0006562J51391_10601291 340
347 3300003751 Ga0055538_1001920 Ga0055538_10019204 340
348 3300003751 Ga0055538_1002774 Ga0055538_10027743 340
349 3300003752 Ga0055539_1000073 Ga0055539_100007344 340
350 3300003756 Ga0055533_1000850 Ga0055533_10008502 340
351 3300003756 Ga0055533_1002700 Ga0055533_10027005 340
352 3300003756 Ga0055533_1004145 Ga0055533_10041453 340
353 3300003758 Ga0055532_1000090 Ga0055532_10000906 340
354 3300003759 Ga0055525_1000387 Ga0055525_100038725 340
355 3300003761 Ga0055535_1000085 Ga0055535_10000856 340
356 3300003762 Ga0055542_1000847 Ga0055542_100084718 340
357 3300003763 Ga0055529_1000134 Ga0055529_100013499 340
358 3300003841 Ga0055541_1001417 Ga0055541_10014172 340
359 3300003841 Ga0055541_1004035 Ga0055541_10040351 340
360 3300005331 Ga0070670_100264853 Ga0070670_1002648531 340
361 3300005331 Ga0070670_100277919 Ga0070670_1002779191 340
362 3300005344 Ga0070661_100000141 Ga0070661_1000001412 340
363 3300005366 Ga0070659_100001430 Ga0070659_1000014307 340
364 3300005455 Ga0070663_100000034 Ga0070663_10000003458 340
365 3300005518 Ga0070699_100103088 Ga0070699_1001030883 340
366 3300005548 Ga0070665_100329479 Ga0070665_1003294792 340
367 3300005564 Ga0070664_100000057 Ga0070664_10000005760 340
368 3300005577 Ga0068857_100009494 Ga0068857_1000094949 340
369 3300005578 Ga0068854_100000299 Ga0068854_1000002993 340
370 3300005614 Ga0068856_100000811 Ga0068856_1000008118 340
371 3300005983 Ga0081540_1069939 Ga0081540_10699391 340
372 3300006058 Ga0075432_10033221 Ga0075432_100332212 340
373 3300006844 Ga0075428_100049522 Ga0075428_1000495223 340
374 3300006847 Ga0075431_100094668 Ga0075431_1000946683 340
375 3300009092 Ga0105250_10025648 Ga0105250_100256482 340
376 3300009093 Ga0105240_10023229 Ga0105240_100232295 340
377 3300009094 Ga0111539_10054304 Ga0111539_100543041 340
378 3300009147 Ga0114129_10087196 Ga0114129_100871962 340
379 3300009147 Ga0114129_10110850 Ga0114129_101108502 340
380 3300009553 Ga0105249_10058788 Ga0105249_100587882 340
381 3300010375 Ga0105239_10009822 Ga0105239_100098225 340
382 3300013100 Ga0157373_10011643 Ga0157373_100116435 340
383 3300013102 Ga0157371_10000323 Ga0157371_1000032351 340
384 3300013104 Ga0157370_10000038 Ga0157370_1000003851 340
385 3300013105 Ga0157369_10008841 Ga0157369_100088415 340
386 3300013306 Ga0163162_10046721 Ga0163162_100467215 340
387 3300013307 Ga0157372_10002748 Ga0157372_100027489 340
388 3300013308 Ga0157375_10580559 Ga0157375_105805591 340
389 3300015261 Ga0182006_1011481 Ga0182006_10114812 340
390 3300020610 Ga0154015_1546600 Ga0154015_15466003 340
391 3300025224 Ga0209784_100006 Ga0209784_100006104 340
392 3300025224 Ga0209784_100108 Ga0209784_10010821 340
393 3300025224 Ga0209784_100846 Ga0209784_1008463 340
394 3300025225 Ga0209566_100002 Ga0209566_100002104 340
395 3300025225 Ga0209566_100602 Ga0209566_1006023 340
396 3300025225 Ga0209566_103317 Ga0209566_1033171 340
397 3300025226 Ga0209674_100097 Ga0209674_100097104 340
398 3300025226 Ga0209674_100168 Ga0209674_10016868 340
399 3300025226 Ga0209674_101230 Ga0209674_1012304 340
400 3300025229 Ga0209147_100018 Ga0209147_100018396 340
401 3300025230 Ga0209563_100041 Ga0209563_100041368 340
402 3300025230 Ga0209563_104405 Ga0209563_1044052 340
403 3300025242 Ga0209258_100028 Ga0209258_100028396 340
404 3300025246 Ga0209646_1000153 Ga0209646_100015351 340
405 3300025253 Ga0209677_100007 Ga0209677_100007104 340
406 3300025253 Ga0209677_107409 Ga0209677_1074092 340
407 3300025254 Ga0209148_1000297 Ga0209148_100029721 340
408 3300025256 Ga0209759_1002551 Ga0209759_10025513 340
409 3300025256 Ga0209759_1002829 Ga0209759_10028295 340
410 3300025256 Ga0209759_1009032 Ga0209759_10090322 340
411 3300025256 Ga0209759_1014014 Ga0209759_10140142 340
412 3300025272 Ga0209455_1000107 Ga0209455_100010796 340
413 3300025294 Ga0209025_1040985 Ga0209025_10409851 340
414 3300025303 Ga0209051_1003539 Ga0209051_10035397 340
415 3300025315 Ga0207697_10018043 Ga0207697_100180432 340
416 3300025728 Ga0207655_1006892 Ga0207655_10068922 340
417 3300025904 Ga0207647_10045620 Ga0207647_100456202 340
418 3300025913 Ga0207695_10009088 Ga0207695_100090885 340
419 3300025920 Ga0207649_10000111 Ga0207649_1000011158 340
420 3300025932 Ga0207690_10001080 Ga0207690_1000108010 340
421 3300025942 Ga0207689_10097761 Ga0207689_100977614 340
422 3300025945 Ga0207679_10000105 Ga0207679_100001058 340
423 3300025961 Ga0207712_10062854 Ga0207712_100628544 340
424 3300025981 Ga0207640_10000154 Ga0207640_100001546 340
425 3300025986 Ga0207658_10198646 Ga0207658_101986462 340
426 3300026067 Ga0207678_10000106 Ga0207678_1000010658 340
427 3300026078 Ga0207702_10000135 Ga0207702_1000013580 340
428 3300026118 Ga0207675_100005953 Ga0207675_1000059535 340
429 3300027312 Ga0209371_1000066 Ga0209371_100006611 340
430 3300030500 Ga0268256_1000063 Ga0268256_100006311 340
431 3300031548 Ga0307408_100000002 Ga0307408_100000002667 340
432 3300031548 Ga0307408_100007242 Ga0307408_1000072422 340
433 3300031548 Ga0307408_100100331 Ga0307408_1001003312 340
434 3300031731 Ga0307405_10002186 Ga0307405_100021869 340
435 3300031731 Ga0307405_10011165 Ga0307405_100111652 340
436 3300031824 Ga0307413_10106611 Ga0307413_101066112 340
437 3300031824 Ga0307413_10165447 Ga0307413_101654472 340
438 3300031852 Ga0307410_10000399 Ga0307410_1000039918 340
439 3300031852 Ga0307410_10010980 Ga0307410_100109804 340
440 3300031903 Ga0307407_10009412 Ga0307407_100094124 340
441 3300031911 Ga0307412_10003930 Ga0307412_100039305 340
442 3300031911 Ga0307412_10029554 Ga0307412_100295543 340
443 3300031911 Ga0307412_10050649 Ga0307412_100506492 340
444 3300031911 Ga0307412_10072313 Ga0307412_100723132 340
445 3300031911 Ga0307412_10105702 Ga0307412_101057023 340
446 3300031995 Ga0307409_100000390 Ga0307409_1000003908 340
447 3300032002 Ga0307416_100352796 Ga0307416_1003527961 340
448 3300032004 Ga0307414_10016946 Ga0307414_100169463 340
449 3300032004 Ga0307414_10196506 Ga0307414_101965061 340
450 3300032126 Ga0307415_100123357 Ga0307415_1001233572 340
451 3300037418 Ga0395900_0014044 Ga0395900_0014044_3970_4992 340
452 3300038443 Ga0395901_0070670 Ga0395901_0070670_660_1682 340
453 3300042122 Ga0450920_006491 Ga0450920_006491_395_1417 340
454 3300042184 Ga0450908_019332 Ga0450908_019332_117_1139 340
455 3300048903 Ga0496100_0016500 Ga0496100_0016500_3009_4091 340
456 3300048904 Ga0496101_0016296 Ga0496101_0016296_3646_4728 340
457 3300048905 Ga0496102_0297353 Ga0496102_0297353_96_1178 340
458 3300048905 Ga0496102_0450985 Ga0496102_0450985_10_1032 340
459 3300048906 Ga0496103_0061550 Ga0496103_0061550_1157_2239 340
460 3300048910 Ga0496107_0001472 Ga0496107_0001472_1075_2157 340
461 3300048914 Ga0496111_0029654 Ga0496111_0029654_2458_3540 340
462 3300049569 Ga0501032_0016464 Ga0501032_0016464_3424_4446 340
463 3300049570 Ga0501033_0000839 Ga0501033_0000839_5936_6958 340
464 3300049573 Ga0501037_0000228 Ga0501037_0000228_5724_6746 340
465 3300049574 Ga0501038_0001410 Ga0501038_0001410_11139_12161 340
466 3300049742 Ga0501080_0095970 Ga0501080_0095970_364_1386 340
467 3300049822 Ga0501035_0001120 Ga0501035_0001120_14178_15200 340
468 3300049822 Ga0501035_0301184 Ga0501035_0301184_81_1115 340
469 3300050507 nmdc:mga05p37_55686_c1 nmdc:mga05p37_55686_c1_3047_4069 340
470 3300050510 nmdc:mga06r32_29282_c1 nmdc:mga06r32_29282_c1_553_1575 340
471 3300050511 nmdc:mga08y16_47829_c1 nmdc:mga08y16_47829_c1_611_1633 340
472 3300050512 nmdc:mga0n895_221882_c1 nmdc:mga0n895_221882_c1_879_1901 340
473 3300059643 Ga0587072_001000 Ga0587072_001000_465_1487 340
474 iso_pu_bacteria 2846952575 2846958392 340
475 iso_pu_bacteria 2848858292 2848860644 340
476 iso_pu_bacteria 8011350971 8011354542 340
477 3300003322 rootL2_10004265 rootL2_100042652 341
478 3300005539 Ga0068853_100051148 Ga0068853_1000511483 341
479 3300011119 Ga0105246_10303430 Ga0105246_103034301 341
480 3300025298 Ga0209050_1000985 Ga0209050_100098517 341
481 3300025913 Ga0207695_10012956 Ga0207695_1001295610 341
482 3300025914 Ga0207671_10026987 Ga0207671_100269875 341
483 3300025924 Ga0207694_10020419 Ga0207694_100204193 341
484 3300026041 Ga0207639_10040742 Ga0207639_100407424 341
485 3300028794 Ga0307515_10195808 Ga0307515_101958081 341
486 3300031456 Ga0307513_10359283 Ga0307513_103592831 341
487 3300031911 Ga0307412_10000460 Ga0307412_1000046010 341
488 3300046455 Ga0495603_0181321 Ga0495603_0181321_22_1047 341
489 3300046459 Ga0495629_0001627 Ga0495629_0001627_3766_4791 341
490 3300046471 Ga0495650_0001852 Ga0495650_0001852_12898_13923 341
491 3300046472 Ga0495580_0174226 Ga0495580_0174226_153_1178 341
492 3300046475 Ga0495639_0035054 Ga0495639_0035054_300_1325 341
493 3300046477 Ga0495664_0151612 Ga0495664_0151612_98_1123 341
494 3300046528 Ga0495642_0003109 Ga0495642_0003109_1143_2168 341
495 3300046536 Ga0495587_0154958 Ga0495587_0154958_113_1138 341
496 3300046559 Ga0495667_0014924 Ga0495667_0014924_2532_3557 341
497 3300046674 Ga0495588_0033239 Ga0495588_0033239_788_1813 341
498 3300046684 Ga0495669_0070470 Ga0495669_0070470_182_1207 341
499 3300046689 Ga0495613_0026618 Ga0495613_0026618_1834_2859 341
500 3300046794 Ga0495589_0143784 Ga0495589_0143784_36_1061 341
501 3300047315 Ga0495581_0008930 Ga0495581_0008930_4368_5393 341
502 3300047319 Ga0495674_0075318 Ga0495674_0075318_1604_2629 341
503 3300047321 Ga0495676_0009750 Ga0495676_0009750_1697_2722 341
504 3300047470 Ga0495681_0098629 Ga0495681_0098629_131_1156 341
505 3300048089 Ga0495614_0038641 Ga0495614_0038641_361_1386 341
506 3300048919 Ga0496116_0005857 Ga0496116_0005857_8023_9048 341
507 3300048920 Ga0496117_0021751 Ga0496117_0021751_2591_3616 341
508 3300048921 Ga0496118_0054731 Ga0496118_0054731_271_1296 341
509 3300048922 Ga0496119_0035555 Ga0496119_0035555_751_1776 341
510 3300048923 Ga0496120_0018130 Ga0496120_0018130_3286_4311 341
511 3300048924 Ga0496121_0000164 Ga0496121_0000164_10969_11994 341
512 3300048924 Ga0496121_0057224 Ga0496121_0057224_1759_2784 341
513 3300048925 Ga0496122_0000227 Ga0496122_0000227_34598_35623 341
514 3300048925 Ga0496122_0085595 Ga0496122_0085595_659_1684 341
515 3300048926 Ga0496123_0000265 Ga0496123_0000265_48499_49524 341
516 3300048927 Ga0496124_0078881 Ga0496124_0078881_1313_2338 341
517 3300048927 Ga0496124_0156785 Ga0496124_0156785_124_1149 341
518 3300048928 Ga0496125_0000190 Ga0496125_0000190_6161_7186 341
519 3300048929 Ga0496126_0004648 Ga0496126_0004648_37_1062 341
520 3300048929 Ga0496126_0167205 Ga0496126_0167205_202_1227 341
521 3300053125 Ga0500618_002275 Ga0500618_002275_23_1048 341
522 2162886007 SwRhRL2b_contig_1398166 SwRhRL2b_0065.00006960 342
523 2162886007 SwRhRL2b_contig_3013297 SwRhRL2b_0575.00003230 342
524 3300001979 JGI24740J21852_10001979 JGI24740J21852_100019793 342
525 3300002737 JGI25162J39368_1005203 JGI25162J39368_10052032 342
526 3300002773 JGI25152J39213_1002500 JGI25152J39213_10025005 342
527 3300003187 JGI25151J46595_10004949 JGI25151J46595_100049495 342
528 3300003215 JGI25153J46596_10005084 JGI25153J46596_100050845 342
529 3300003578 Ga0006562J51391_1002671 Ga0006562J51391_10026714 342
530 3300003781 Ga0055536_1000208 Ga0055536_100020847 342
531 3300003781 Ga0055536_1004486 Ga0055536_10044866 342
532 3300003781 Ga0055536_1008760 Ga0055536_10087603 342
533 3300003781 Ga0055536_1014629 Ga0055536_10146293 342
534 3300003791 Ga0055530_10014085 Ga0055530_100140854 342
535 3300003794 Ga0055531_10002440 Ga0055531_100024409 342
536 3300003794 Ga0055531_10007366 Ga0055531_100073665 342
537 3300003856 Ga0058692_1000005 Ga0058692_1000005240 342
538 3300003856 Ga0058692_1000087 Ga0058692_100008746 342
539 3300005289 Ga0065704_10074978 Ga0065704_100749781 342
540 3300005289 Ga0065704_10132396 Ga0065704_101323962 342
541 3300005327 Ga0070658_10085520 Ga0070658_100855201 342
542 3300005331 Ga0070670_100016372 Ga0070670_1000163725 342
543 3300005347 Ga0070668_100000632 Ga0070668_10000063220 342
544 3300005353 Ga0070669_100059488 Ga0070669_1000594883 342
545 3300005456 Ga0070678_100159662 Ga0070678_1001596622 342
546 3300005467 Ga0070706_100068908 Ga0070706_1000689082 342
547 3300005471 Ga0070698_100000844 Ga0070698_10000084415 342
548 3300005518 Ga0070699_100022461 Ga0070699_1000224616 342
549 3300005536 Ga0070697_100000201 Ga0070697_10000020131 342
550 3300005548 Ga0070665_100036789 Ga0070665_1000367894 342
551 3300005548 Ga0070665_100257302 Ga0070665_1002573023 342
552 3300005563 Ga0068855_100001118 Ga0068855_10000111813 342
553 3300005577 Ga0068857_100169737 Ga0068857_1001697372 342
554 3300005578 Ga0068854_100036124 Ga0068854_1000361243 342
555 3300005834 Ga0068851_10003172 Ga0068851_100031726 342
556 3300005842 Ga0068858_100166850 Ga0068858_1001668501 342
557 3300005985 Ga0081539_10006532 Ga0081539_100065325 342
558 3300006038 Ga0075365_10002875 Ga0075365_100028754 342
559 3300006051 Ga0075364_10000276 Ga0075364_1000027616 342
560 3300006186 Ga0075369_10026420 Ga0075369_100264202 342
561 3300006946 Ga0079104_1000004 Ga0079104_100000465 342
562 3300009011 Ga0105251_10000821 Ga0105251_100008216 342
563 3300009092 Ga0105250_10021928 Ga0105250_100219282 342
564 3300009093 Ga0105240_10006539 Ga0105240_1000653913 342
565 3300009148 Ga0105243_10000196 Ga0105243_100001962 342
566 3300009148 Ga0105243_10041778 Ga0105243_100417782 342
567 3300009177 Ga0105248_10044318 Ga0105248_100443186 342
568 3300009545 Ga0105237_10000010 Ga0105237_10000010257 342
569 3300009545 Ga0105237_10000850 Ga0105237_100008506 342
570 3300009551 Ga0105238_10007711 Ga0105238_1000771112 342
571 3300010375 Ga0105239_10002448 Ga0105239_100024486 342
572 3300013102 Ga0157371_10000896 Ga0157371_1000089613 342
573 3300013102 Ga0157371_10044860 Ga0157371_100448602 342
574 3300013104 Ga0157370_10018866 Ga0157370_100188662 342
575 3300013306 Ga0163162_10012665 Ga0163162_100126653 342
576 3300014497 Ga0182008_10000083 Ga0182008_1000008344 342
577 3300015261 Ga0182006_1012808 Ga0182006_10128084 342
578 3300015262 Ga0182007_10000117 Ga0182007_1000011719 342
579 3300015265 Ga0182005_1000220 Ga0182005_100022026 342
580 3300015265 Ga0182005_1003904 Ga0182005_10039043 342
581 3300017792 Ga0163161_10007088 Ga0163161_100070888 342
582 3300017792 Ga0163161_10049876 Ga0163161_100498762 342
583 3300017792 Ga0163161_10122805 Ga0163161_101228052 342
584 3300020075 Ga0206349_1540627 Ga0206349_15406271 342
585 3300021361 Ga0213872_10046939 Ga0213872_100469392 342
586 3300021361 Ga0213872_10070055 Ga0213872_100700551 342
587 3300025226 Ga0209674_100981 Ga0209674_1009814 342
588 3300025233 Ga0209437_101206 Ga0209437_1012066 342
589 3300025245 Ga0207425_1000015 Ga0207425_1000015304 342
590 3300025254 Ga0209148_1002278 Ga0209148_10022786 342
591 3300025258 Ga0209129_1000131 Ga0209129_10001311 342
592 3300025291 Ga0209675_1003920 Ga0209675_10039204 342
593 3300025292 Ga0209676_1000104 Ga0209676_1000104100 342
594 3300025292 Ga0209676_1000151 Ga0209676_100015146 342
595 3300025292 Ga0209676_1005600 Ga0209676_10056003 342
596 3300025294 Ga0209025_1000002 Ga0209025_10000021202 342
597 3300025294 Ga0209025_1037849 Ga0209025_10378493 342
598 3300025297 Ga0209758_1000003 Ga0209758_10000031209 342
599 3300025297 Ga0209758_1020232 Ga0209758_10202324 342
600 3300025298 Ga0209050_1003203 Ga0209050_10032036 342
601 3300025298 Ga0209050_1007470 Ga0209050_10074703 342
602 3300025304 Ga0209257_1000413 Ga0209257_100041328 342
603 3300025304 Ga0209257_1000434 Ga0209257_100043439 342
604 3300025304 Ga0209257_1000796 Ga0209257_100079615 342
605 3300025304 Ga0209257_1002077 Ga0209257_10020778 342
606 3300025321 Ga0207656_10007972 Ga0207656_100079722 342
607 3300025711 Ga0207696_1016340 Ga0207696_10163402 342
608 3300025728 Ga0207655_1044630 Ga0207655_10446302 342
609 3300025728 Ga0207655_1046046 Ga0207655_10460462 342
610 3300025735 Ga0207713_1000535 Ga0207713_10005355 342
611 3300025735 Ga0207713_1011252 Ga0207713_10112523 342
612 3300025904 Ga0207647_10004266 Ga0207647_100042668 342
613 3300025914 Ga0207671_10000013 Ga0207671_10000013136 342
614 3300025925 Ga0207650_10109287 Ga0207650_101092873 342
615 3300025935 Ga0207709_10000019 Ga0207709_10000019177 342
616 3300025935 Ga0207709_10000954 Ga0207709_1000095412 342
617 3300025935 Ga0207709_10001101 Ga0207709_100011018 342
618 3300025949 Ga0207667_10000047 Ga0207667_1000004730 342
619 3300025972 Ga0207668_10098422 Ga0207668_100984222 342
620 3300025981 Ga0207640_10001091 Ga0207640_100010914 342
621 3300025981 Ga0207640_10073870 Ga0207640_100738702 342
622 3300026116 Ga0207674_10069548 Ga0207674_100695483 342
623 3300027111 Ga0209281_1000005 Ga0209281_1000005266 342
624 3300027312 Ga0209371_1000031 Ga0209371_1000031236 342
625 3300027312 Ga0209371_1000256 Ga0209371_100025615 342
626 3300028379 Ga0268266_10011682 Ga0268266_100116828 342
627 3300028794 Ga0307515_10033048 Ga0307515_100330487 342
628 3300028800 Ga0265338_10000713 Ga0265338_1000071314 342
629 3300030500 Ga0268256_1000034 Ga0268256_1000034115 342
630 3300030500 Ga0268256_1000216 Ga0268256_100021648 342
631 3300030500 Ga0268256_1008755 Ga0268256_10087554 342
632 3300030732 Ga0316176_1150308 Ga0316176_11503082 342
633 3300031456 Ga0307513_10247978 Ga0307513_102479782 342
634 3300031649 Ga0307514_10000225 Ga0307514_1000022560 342
635 3300032004 Ga0307414_10046005 Ga0307414_100460054 342
636 3300037418 Ga0395900_0075227 Ga0395900_0075227_1624_2658 342
637 3300037466 Ga0395898_0192565 Ga0395898_0192565_515_1549 342
638 3300038443 Ga0395901_0000212 Ga0395901_0000212_31403_32437 342
639 3300038443 Ga0395901_0062253 Ga0395901_0062253_317_1351 342
640 3300038705 Ga0237819_00007 Ga0237819_00007_22079_23107 342
641 3300039447 Ga0436361_0648767 Ga0436361_0648767_107_1135 342
642 3300039447 Ga0436361_1075392 Ga0436361_1075392_651_1679 342
643 3300041452 Ga0451793_0257911 Ga0451793_0257911_445_1473 342
644 3300041459 Ga0451800_1301053 Ga0451800_1301053_2116_3144 342
645 3300041462 Ga0451806_414687 Ga0451806_414687_547_1575 342
646 3300041463 Ga0451804_0787358 Ga0451804_0787358_877_1905 342
647 3300041486 Ga0451807_1029248 Ga0451807_1029248_2815_3843 342
648 3300046453 Ga0495627_012263 Ga0495627_012263_1110_2138 342
649 3300046457 Ga0495590_0000005 Ga0495590_0000005_78601_79638 342
650 3300046458 Ga0495591_042630 Ga0495591_042630_131_1159 342
651 3300046460 Ga0495638_0000349 Ga0495638_0000349_42750_43787 342
652 3300046460 Ga0495638_0002006 Ga0495638_0002006_851_1879 342
653 3300046463 Ga0495653_0041454 Ga0495653_0041454_494_1522 342
654 3300046471 Ga0495650_0004198 Ga0495650_0004198_7799_8836 342
655 3300046471 Ga0495650_0017063 Ga0495650_0017063_1045_2088 342
656 3300046474 Ga0495605_0062900 Ga0495605_0062900_215_1561 342
657 3300046501 Ga0495607_0007029 Ga0495607_0007029_5819_6847 342
658 3300046501 Ga0495607_0009895 Ga0495607_0009895_1910_2938 342
659 3300046506 Ga0495583_0000209 Ga0495583_0000209_2129_3157 342
660 3300046506 Ga0495583_0000995 Ga0495583_0000995_15990_17027 342
661 3300046513 Ga0495616_0031233 Ga0495616_0031233_130_1158 342
662 3300046524 Ga0495648_0000002 Ga0495648_0000002_331088_332125 342
663 3300046524 Ga0495648_0000375 Ga0495648_0000375_26134_27162 342
664 3300046528 Ga0495642_0003167 Ga0495642_0003167_890_1927 342
665 3300046537 Ga0495598_0024486 Ga0495598_0024486_147_1175 342
666 3300046538 Ga0495609_0044388 Ga0495609_0044388_576_1613 342
667 3300046557 Ga0495622_0000402 Ga0495622_0000402_14069_15106 342
668 3300046558 Ga0495633_0000888 Ga0495633_0000888_21891_22928 342
669 3300046558 Ga0495633_0031307 Ga0495633_0031307_393_1421 342
670 3300046615 Ga0495656_0016425 Ga0495656_0016425_1090_2118 342
671 3300046616 Ga0495668_0000719 Ga0495668_0000719_9433_10470 342
672 3300046660 Ga0495625_0000124 Ga0495625_0000124_52742_53779 342
673 3300046665 Ga0495661_0064693 Ga0495661_0064693_88_1116 342
674 3300046680 Ga0495646_0074194 Ga0495646_0074194_718_1746 342
675 3300046684 Ga0495669_0058797 Ga0495669_0058797_334_1362 342
676 3300046810 Ga0495660_0000684 Ga0495660_0000684_8714_9742 342
677 3300046810 Ga0495660_0159541 Ga0495660_0159541_51_1088 342
678 3300047318 Ga0495636_0030713 Ga0495636_0030713_864_1892 342
679 3300047469 Ga0495673_0000427 Ga0495673_0000427_23054_24082 342
680 3300047472 Ga0495686_0040674 Ga0495686_0040674_1802_2830 342
681 3300048088 Ga0495602_0007375 Ga0495602_0007375_6534_7562 342
682 3300048091 Ga0495626_0039820 Ga0495626_0039820_266_1294 342
683 3300048905 Ga0496102_0040630 Ga0496102_0040630_2422_3456 342
684 3300048907 Ga0496104_0384812 Ga0496104_0384812_100_1128 342
685 3300048908 Ga0496105_0022937 Ga0496105_0022937_595_1623 342
686 3300048910 Ga0496107_0016974 Ga0496107_0016974_793_1821 342
687 3300048916 Ga0496113_0082665 Ga0496113_0082665_256_1284 342
688 3300048918 Ga0496115_0227974 Ga0496115_0227974_475_1509 342
689 3300048919 Ga0496116_0007649 Ga0496116_0007649_8231_9259 342
690 3300048919 Ga0496116_0049894 Ga0496116_0049894_595_1623 342
691 3300048919 Ga0496116_0171041 Ga0496116_0171041_38_1066 342
692 3300048920 Ga0496117_0000369 Ga0496117_0000369_21329_22360 342
693 3300048920 Ga0496117_0000829 Ga0496117_0000829_17498_18526 342
694 3300048920 Ga0496117_0001338 Ga0496117_0001338_11587_12648 342
695 3300048920 Ga0496117_0005490 Ga0496117_0005490_5703_6731 342
696 3300048920 Ga0496117_0009239 Ga0496117_0009239_7910_8938 342
697 3300048920 Ga0496117_0053757 Ga0496117_0053757_420_1448 342
698 3300048921 Ga0496118_0000406 Ga0496118_0000406_17860_18888 342
699 3300048921 Ga0496118_0002325 Ga0496118_0002325_21566_22594 342
700 3300048921 Ga0496118_0002786 Ga0496118_0002786_13926_14954 342
701 3300048921 Ga0496118_0016572 Ga0496118_0016572_5259_6287 342
702 3300048921 Ga0496118_0086813 Ga0496118_0086813_433_1494 342
703 3300048921 Ga0496118_0147901 Ga0496118_0147901_431_1459 342
704 3300048922 Ga0496119_0000301 Ga0496119_0000301_30815_31843 342
705 3300048922 Ga0496119_0006605 Ga0496119_0006605_2901_3962 342
706 3300048923 Ga0496120_0000402 Ga0496120_0000402_30815_31843 342
707 3300048923 Ga0496120_0002718 Ga0496120_0002718_12800_13861 342
708 3300048924 Ga0496121_0002806 Ga0496121_0002806_3522_4553 342
709 3300048924 Ga0496121_0006928 Ga0496121_0006928_11967_12995 342
710 3300048924 Ga0496121_0008829 Ga0496121_0008829_5587_6615 342
711 3300048924 Ga0496121_0098168 Ga0496121_0098168_521_1549 342
712 3300048925 Ga0496122_0001751 Ga0496122_0001751_19404_20465 342
713 3300048925 Ga0496122_0011096 Ga0496122_0011096_293_1321 342
714 3300048925 Ga0496122_0014211 Ga0496122_0014211_121_1149 342
715 3300048925 Ga0496122_0014373 Ga0496122_0014373_4503_5543 342
716 3300048925 Ga0496122_0063183 Ga0496122_0063183_1624_2652 342
717 3300048925 Ga0496122_0077851 Ga0496122_0077851_921_1949 342
718 3300048926 Ga0496123_0000795 Ga0496123_0000795_19567_20628 342
719 3300048926 Ga0496123_0004482 Ga0496123_0004482_5720_6748 342
720 3300048926 Ga0496123_0007554 Ga0496123_0007554_4503_5534 342
721 3300048926 Ga0496123_0009133 Ga0496123_0009133_6852_7880 342
722 3300048926 Ga0496123_0014808 Ga0496123_0014808_4500_5528 342
723 3300048927 Ga0496124_0000034 Ga0496124_0000034_271277_272305 342
724 3300048927 Ga0496124_0000991 Ga0496124_0000991_38357_39385 342
725 3300048927 Ga0496124_0002054 Ga0496124_0002054_2302_3330 342
726 3300048927 Ga0496124_0006990 Ga0496124_0006990_1856_2884 342
727 3300048927 Ga0496124_0008723 Ga0496124_0008723_6742_7803 342
728 3300048927 Ga0496124_0016659 Ga0496124_0016659_1024_2052 342
729 3300048927 Ga0496124_0026942 Ga0496124_0026942_1867_2895 342
730 3300048927 Ga0496124_0077937 Ga0496124_0077937_1545_2579 342
731 3300048927 Ga0496124_0202515 Ga0496124_0202515_122_1150 342
732 3300048928 Ga0496125_0000044 Ga0496125_0000044_168764_169795 342
733 3300048928 Ga0496125_0002163 Ga0496125_0002163_15729_16757 342
734 3300048928 Ga0496125_0003842 Ga0496125_0003842_8844_9872 342
735 3300048928 Ga0496125_0007703 Ga0496125_0007703_9164_10192 342
736 3300048928 Ga0496125_0028908 Ga0496125_0028908_953_2020 342
737 3300048928 Ga0496125_0034756 Ga0496125_0034756_463_1491 342
738 3300048929 Ga0496126_0001069 Ga0496126_0001069_9497_10525 342
739 3300048929 Ga0496126_0006225 Ga0496126_0006225_648_1715 342
740 3300048929 Ga0496126_0025860 Ga0496126_0025860_573_1601 342
741 3300048929 Ga0496126_0066238 Ga0496126_0066238_307_1335 342
742 3300048929 Ga0496126_0079199 Ga0496126_0079199_214_1455 342
743 3300049568 Ga0501031_0040572 Ga0501031_0040572_384_1412 342
744 3300049571 Ga0501034_0000798 Ga0501034_0000798_833_1861 342
745 3300049581 Ga0501047_0402763 Ga0501047_0402763_53_1087 342
746 3300050491 nmdc:mga00v17_308_c1 nmdc:mga00v17_308_c1_14599_15627 342
747 3300050491 nmdc:mga00v17_47857_c1 nmdc:mga00v17_47857_c1_1190_2218 342
748 3300050492 nmdc:mga0yw44_17954_c1 nmdc:mga0yw44_17954_c1_39_1067 342
749 3300050516 nmdc:mga0sz30_15652_c1 nmdc:mga0sz30_15652_c1_1270_2304 342
750 3300053088 Ga0500644_0000306 Ga0500644_0000306_3491_4519 342
751 3300053125 Ga0500618_001158 Ga0500618_001158_11099_12130 342
752 iso_pu_bacteria 2883087390 2883089541 342

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

250

376

0.96

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

99

211

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z6k-assembly1.cif.gz_B alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 0.9923 5 341
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9902 5 340
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9898 4 342
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9873 5 340
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.987 1 340
ID Description Score Start End Superfamily
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9971 152 289 3.40.50.720
4gkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9944 154 289 3.40.50.720
1lluA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9899 152 289 3.40.50.720
1rjwC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9897 5 341 3.90.180.10
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9838 4 152 3.90.180.10
ID Description Score Start End GO Terms
AF-M5D5M4-F1-model_v4 deleted 0.9974 92 342
AF-M5D5M4-F1-model_v4 deleted 0.9935 92 342
AF-A0A0K1Q3C7-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9914 2 340 GO:0008270
GO:0016491
AF-A0A812YKR7-F1-model_v4 deleted 0.9906 1 342
AF-A0A3D5EPX3-F1-model_v4 Zinc-dependent alcohol dehydrogenase 0.9901 5 135 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.28 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map