F479153
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 752 | 459 | 632 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10000196|Ga0105243_100001962 |
| Length | 413 |
| Sequence | VLTPDVALPAHGDARSAVRTCLSPRSRRVRAARPAVVAPWCRSGRRFLIWIKARHRRISDGAVTRSPKECCMNKTMKAAVVREFGKPLTIEEVEVPRPQAGDILVKIEACGVCHTDLHAAEGDWPVKPNPPFIPGHEGVGHVVAVGAGVGHVKEGDRVGIPWLYSACGHCEHCLGGWETLCEAQQNSGYSVNGGFAEYALANADYVGHLPKNIGFVEVAPILCAGVTVYKGLKVTDTKPGNWVVISGIGGLGHMAVQYAKAMGLNVAAVDVDDAKLALARRLGATVTVNALTTDPVAYLKKEIGGAHGALVTAVSPKAFEQAIGMVRRGGTVSLNGLPPGQFPLDIFGMVLNGVTVRGSIVGTRLDLQESLDFAEQGKVAATVATATLENINEVFARMRAGQIEGRIVLDMAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 3 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 5 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 6 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 7 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 8 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 9 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 10 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 11 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 12 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 13 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 14 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 15 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 16 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 17 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 18 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 19 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 20 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 21 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 22 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 23 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 24 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 25 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 26 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 27 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 28 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 29 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 30 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 31 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 32 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 33 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 34 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 35 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 36 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 37 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 38 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 39 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 40 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 41 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 42 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 43 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 44 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 45 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 46 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 47 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 48 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 49 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 50 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 51 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 52 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 53 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 54 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 55 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 56 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 57 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 58 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 59 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 60 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 61 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 62 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 63 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 64 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 65 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 66 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 67 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 68 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 69 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 70 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 71 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 72 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 73 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 74 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 75 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 76 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 77 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 78 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 79 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 80 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 81 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 82 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 83 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 84 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 85 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 86 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 87 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 88 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 89 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 90 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 91 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 92 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 93 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 94 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 95 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 96 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 97 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 98 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 99 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 100 | 2941479691 | |||
| 101 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 102 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 103 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 104 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 105 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 106 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 107 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 108 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 109 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 110 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 111 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 112 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 113 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 114 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 115 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 116 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 117 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 118 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 119 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 120 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 121 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 122 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 123 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 124 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 125 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 126 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 127 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 128 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 129 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 130 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 131 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 132 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 133 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 134 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 135 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 136 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 137 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 138 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 143 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 162 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 164 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 166 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 168 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 169 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 170 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 172 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 173 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 174 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 175 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 176 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 177 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 178 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 179 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 180 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 181 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 182 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 183 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 184 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 185 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 186 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 212 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 213 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 214 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 215 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 217 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 219 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 228 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 231 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 232 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 235 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 281 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 284 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 286 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 287 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 288 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 289 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 290 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 291 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 292 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 293 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 295 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 296 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 297 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 300 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 301 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 302 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 303 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 304 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 306 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 307 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 309 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 310 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 311 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 316 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 317 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 318 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 319 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 320 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 326 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 327 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 328 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 329 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 330 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 331 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 332 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 333 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 334 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 335 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 336 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 405 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 408 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 409 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 410 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 411 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 412 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 413 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 414 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 415 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 416 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 417 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 418 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 419 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 420 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 421 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 422 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 423 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 424 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 439 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 445 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 447 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 448 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 449 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 451 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 452 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 453 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 454 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 455 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 456 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 457 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 458 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 459 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.85 |
| Metatranscriptomes | 1.2 |
| Isolates | 15.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 10.77 |
| Nodule | 1.2 |
| Rhizoplane | 5.98 |
| Rhizosphere | 61.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1398166 | 2162886007 | Bacteria | 1555 |
| 2 | SwRhRL2b_contig_3013297 | 2162886007 | Bacteria | 1610 |
| 3 | JGI24741J21665_1000701 | 3300001915 | Bacteria | 10112 |
| 4 | JGI24740J21852_10001102 | 3300001979 | Bacteria | 12202 |
| 5 | JGI24740J21852_10001979 | 3300001979 | Bacteria | 9363 |
| 6 | JGI24740J21852_10003569 | 3300001979 | Bacteria | 6808 |
| 7 | JGI25156J39149_1002620 | 3300002705 | Bacteria | 6325 |
| 8 | JGI25162J39368_1005203 | 3300002737 | Bacteria | 2650 |
| 9 | JGI25152J39213_1002500 | 3300002773 | Bacteria | 6953 |
| 10 | JGI25151J46595_10004949 | 3300003187 | Bacteria | 6953 |
| 11 | JGI25153J46596_10005084 | 3300003215 | Bacteria | 6953 |
| 12 | rootH2_10049822 | 3300003320 | Bacteria | 1837 |
| 13 | rootL2_10004265 | 3300003322 | Bacteria | 2802 |
| 14 | rootL2_10057367 | 3300003322 | Bacteria | 13355 |
| 15 | rootH1_10002003 | 3300003323 | Bacteria | 1671 |
| 16 | Ga0006554J51385_1020996 | 3300003567 | Bacteria | 3496 |
| 17 | Ga0006562J51391_1002671 | 3300003578 | Bacteria | 7880 |
| 18 | Ga0006562J51391_1003719 | 3300003578 | Bacteria | 3527 |
| 19 | Ga0006562J51391_1042671 | 3300003578 | Bacteria | 2383 |
| 20 | Ga0006562J51391_1060129 | 3300003578 | Bacteria | 3320 |
| 21 | Ga0055538_1001920 | 3300003751 | Bacteria | 3440 |
| 22 | Ga0055538_1002774 | 3300003751 | Bacteria | 2426 |
| 23 | Ga0055539_1000073 | 3300003752 | Bacteria | 131094 |
| 24 | Ga0055533_1000850 | 3300003756 | Bacteria | 9348 |
| 25 | Ga0055533_1002700 | 3300003756 | Bacteria | 3911 |
| 26 | Ga0055533_1004145 | 3300003756 | Bacteria | 2698 |
| 27 | Ga0055532_1000090 | 3300003758 | Bacteria | 104391 |
| 28 | Ga0055525_1000387 | 3300003759 | Bacteria | 28280 |
| 29 | Ga0055535_1000085 | 3300003761 | Bacteria | 104391 |
| 30 | Ga0055542_1000847 | 3300003762 | Bacteria | 21499 |
| 31 | Ga0055529_1000134 | 3300003763 | Bacteria | 104391 |
| 32 | Ga0055536_1000208 | 3300003781 | Bacteria | 48172 |
| 33 | Ga0055536_1004486 | 3300003781 | Bacteria | 7120 |
| 34 | Ga0055536_1004496 | 3300003781 | Bacteria | 7105 |
| 35 | Ga0055536_1008760 | 3300003781 | Bacteria | 4291 |
| 36 | Ga0055536_1014629 | 3300003781 | Bacteria | 2736 |
| 37 | Ga0055530_10003547 | 3300003791 | Bacteria | 8791 |
| 38 | Ga0055530_10014085 | 3300003791 | Bacteria | 2687 |
| 39 | Ga0055531_10002440 | 3300003794 | Bacteria | 12445 |
| 40 | Ga0055531_10007366 | 3300003794 | Bacteria | 6028 |
| 41 | Ga0055541_1001417 | 3300003841 | Bacteria | 5211 |
| 42 | Ga0055541_1004035 | 3300003841 | Bacteria | 2702 |
| 43 | Ga0058692_1000005 | 3300003856 | Bacteria | 398815 |
| 44 | Ga0058692_1000087 | 3300003856 | Bacteria | 64301 |
| 45 | Ga0065714_10007259 | 3300005288 | Bacteria | 3168 |
| 46 | Ga0065704_10074978 | 3300005289 | Bacteria | 5870 |
| 47 | Ga0065704_10132396 | 3300005289 | Bacteria | 1613 |
| 48 | Ga0070658_10085520 | 3300005327 | Bacteria | 2594 |
| 49 | Ga0070676_10015876 | 3300005328 | Bacteria | 4154 |
| 50 | Ga0070670_100016372 | 3300005331 | Bacteria | 6368 |
| 51 | Ga0070670_100264853 | 3300005331 | Bacteria | 1499 |
| 52 | Ga0070670_100273742 | 3300005331 | Bacteria | 1474 |
| 53 | Ga0070670_100277919 | 3300005331 | Bacteria | 1462 |
| 54 | Ga0070670_100337027 | 3300005331 | Bacteria | 1323 |
| 55 | Ga0070677_10004983 | 3300005333 | Bacteria | 4362 |
| 56 | Ga0068869_100236838 | 3300005334 | Bacteria | 1453 |
| 57 | Ga0070666_10019893 | 3300005335 | Bacteria | 4336 |
| 58 | Ga0070661_100000141 | 3300005344 | Bacteria | 58825 |
| 59 | Ga0070668_100000632 | 3300005347 | Bacteria | 23654 |
| 60 | Ga0070668_100034112 | 3300005347 | Bacteria | 3878 |
| 61 | Ga0070669_100059488 | 3300005353 | Bacteria | 2805 |
| 62 | Ga0070669_100201742 | 3300005353 | Bacteria | 1565 |
| 63 | Ga0070675_100014679 | 3300005354 | Bacteria | 6178 |
| 64 | Ga0070671_100032521 | 3300005355 | Bacteria | 4312 |
| 65 | Ga0070674_100016361 | 3300005356 | Bacteria | 4648 |
| 66 | Ga0070673_100020953 | 3300005364 | Bacteria | 4726 |
| 67 | Ga0070659_100001430 | 3300005366 | Bacteria | 17218 |
| 68 | Ga0070667_100086224 | 3300005367 | Bacteria | 2693 |
| 69 | Ga0070709_10272069 | 3300005434 | Bacteria | 1228 |
| 70 | Ga0070714_100308894 | 3300005435 | Bacteria | 1476 |
| 71 | Ga0070663_100000034 | 3300005455 | Bacteria | 68516 |
| 72 | Ga0070663_100028245 | 3300005455 | Bacteria | 3817 |
| 73 | Ga0070678_100042276 | 3300005456 | Bacteria | 3238 |
| 74 | Ga0070678_100159662 | 3300005456 | Bacteria | 1825 |
| 75 | Ga0070706_100068908 | 3300005467 | Bacteria | 3272 |
| 76 | Ga0070706_100199661 | 3300005467 | Bacteria | 1868 |
| 77 | Ga0070698_100000844 | 3300005471 | Bacteria | 33554 |
| 78 | Ga0070699_100022461 | 3300005518 | Bacteria | 5438 |
| 79 | Ga0070699_100103088 | 3300005518 | Bacteria | 2502 |
| 80 | Ga0070697_100000201 | 3300005536 | Bacteria | 48972 |
| 81 | Ga0068853_100051148 | 3300005539 | Bacteria | 3556 |
| 82 | Ga0070672_100141408 | 3300005543 | Bacteria | 1985 |
| 83 | Ga0070695_100117092 | 3300005545 | Bacteria | 1817 |
| 84 | Ga0070665_100011695 | 3300005548 | Bacteria | 8868 |
| 85 | Ga0070665_100036789 | 3300005548 | Bacteria | 4922 |
| 86 | Ga0070665_100257302 | 3300005548 | Bacteria | 1747 |
| 87 | Ga0070665_100329479 | 3300005548 | Bacteria | 1531 |
| 88 | Ga0068855_100001118 | 3300005563 | Bacteria | 33353 |
| 89 | Ga0068855_100252115 | 3300005563 | Bacteria | 1968 |
| 90 | Ga0070664_100000057 | 3300005564 | Bacteria | 68516 |
| 91 | Ga0068857_100009494 | 3300005577 | Bacteria | 8449 |
| 92 | Ga0068857_100169737 | 3300005577 | Bacteria | 1983 |
| 93 | Ga0068854_100000299 | 3300005578 | Bacteria | 32817 |
| 94 | Ga0068854_100014660 | 3300005578 | Bacteria | 5170 |
| 95 | Ga0068854_100036124 | 3300005578 | Bacteria | 3462 |
| 96 | Ga0068856_100000811 | 3300005614 | Bacteria | 33756 |
| 97 | Ga0070702_100125785 | 3300005615 | Bacteria | 1611 |
| 98 | Ga0068852_100145249 | 3300005616 | Bacteria | 2200 |
| 99 | Ga0068851_10003172 | 3300005834 | Bacteria | 7286 |
| 100 | Ga0068870_10043231 | 3300005840 | Bacteria | 2349 |
| 101 | Ga0068858_100166850 | 3300005842 | Bacteria | 2075 |
| 102 | Ga0081540_1069939 | 3300005983 | Bacteria | 1628 |
| 103 | Ga0081539_10006532 | 3300005985 | Bacteria | 11123 |
| 104 | Ga0075365_10002875 | 3300006038 | Bacteria | 8664 |
| 105 | Ga0075364_10000276 | 3300006051 | Bacteria | 25091 |
| 106 | Ga0075432_10033221 | 3300006058 | Bacteria | 1789 |
| 107 | Ga0070712_100138658 | 3300006175 | Bacteria | 1853 |
| 108 | Ga0075369_10026420 | 3300006186 | Bacteria | 2420 |
| 109 | Ga0075428_100049522 | 3300006844 | Bacteria | 4609 |
| 110 | Ga0075431_100094668 | 3300006847 | Bacteria | 3083 |
| 111 | Ga0068865_100259213 | 3300006881 | Bacteria | 1376 |
| 112 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 113 | Ga0105251_10000821 | 3300009011 | Bacteria | 27865 |
| 114 | Ga0105251_10008083 | 3300009011 | Bacteria | 6371 |
| 115 | Ga0105244_10006402 | 3300009036 | Bacteria | 7637 |
| 116 | Ga0105244_10017652 | 3300009036 | Bacteria | 4027 |
| 117 | Ga0105244_10020719 | 3300009036 | Bacteria | 3647 |
| 118 | Ga0105244_10139238 | 3300009036 | Bacteria | 1168 |
| 119 | Ga0105250_10021928 | 3300009092 | Bacteria | 2576 |
| 120 | Ga0105250_10025648 | 3300009092 | Bacteria | 2375 |
| 121 | Ga0105240_10006539 | 3300009093 | Bacteria | 17111 |
| 122 | Ga0105240_10023229 | 3300009093 | Bacteria | 8209 |
| 123 | Ga0105240_10036630 | 3300009093 | Bacteria | 6308 |
| 124 | Ga0111539_10054304 | 3300009094 | Bacteria | 4767 |
| 125 | Ga0114129_10087196 | 3300009147 | Bacteria | 4328 |
| 126 | Ga0114129_10110850 | 3300009147 | Bacteria | 3788 |
| 127 | Ga0105243_10000196 | 3300009148 | Bacteria | 71069 |
| 128 | Ga0105243_10026584 | 3300009148 | Bacteria | 4431 |
| 129 | Ga0105243_10041778 | 3300009148 | Bacteria | 3586 |
| 130 | Ga0105243_10125346 | 3300009148 | Bacteria | 2172 |
| 131 | Ga0105241_10007804 | 3300009174 | Bacteria | 7868 |
| 132 | Ga0105242_10048898 | 3300009176 | Bacteria | 3438 |
| 133 | Ga0105242_10312352 | 3300009176 | Bacteria | 1439 |
| 134 | Ga0105248_10044318 | 3300009177 | Bacteria | 4990 |
| 135 | Ga0105248_10052388 | 3300009177 | Bacteria | 4579 |
| 136 | Ga0105237_10000010 | 3300009545 | Bacteria | 324528 |
| 137 | Ga0105237_10000850 | 3300009545 | Bacteria | 41539 |
| 138 | Ga0105237_10315012 | 3300009545 | Bacteria | 1568 |
| 139 | Ga0105238_10007711 | 3300009551 | Bacteria | 10761 |
| 140 | Ga0105238_10096300 | 3300009551 | Bacteria | 2945 |
| 141 | Ga0105238_10170518 | 3300009551 | Bacteria | 2152 |
| 142 | Ga0105249_10058788 | 3300009553 | Bacteria | 3524 |
| 143 | Ga0105249_10092216 | 3300009553 | Bacteria | 2836 |
| 144 | Ga0105249_10093359 | 3300009553 | Bacteria | 2819 |
| 145 | Ga0105249_10407113 | 3300009553 | Bacteria | 1392 |
| 146 | Ga0105239_10002448 | 3300010375 | Bacteria | 23666 |
| 147 | Ga0105239_10009822 | 3300010375 | Bacteria | 10755 |
| 148 | Ga0105239_10024465 | 3300010375 | Bacteria | 6654 |
| 149 | Ga0105246_10008423 | 3300011119 | Bacteria | 6337 |
| 150 | Ga0105246_10303430 | 3300011119 | Bacteria | 1290 |
| 151 | Ga0157373_10011643 | 3300013100 | Bacteria | 6462 |
| 152 | Ga0157371_10000323 | 3300013102 | Bacteria | 61980 |
| 153 | Ga0157371_10000896 | 3300013102 | Bacteria | 33556 |
| 154 | Ga0157371_10016092 | 3300013102 | Bacteria | 5591 |
| 155 | Ga0157371_10040986 | 3300013102 | Bacteria | 3306 |
| 156 | Ga0157371_10044860 | 3300013102 | Bacteria | 3147 |
| 157 | Ga0157371_10088033 | 3300013102 | Bacteria | 2198 |
| 158 | Ga0157370_10000038 | 3300013104 | Bacteria | 135182 |
| 159 | Ga0157370_10018866 | 3300013104 | Bacteria | 6937 |
| 160 | Ga0157369_10008841 | 3300013105 | Bacteria | 11536 |
| 161 | Ga0157369_10014336 | 3300013105 | Bacteria | 8951 |
| 162 | Ga0157369_10250363 | 3300013105 | Bacteria | 1849 |
| 163 | Ga0157374_10322933 | 3300013296 | Bacteria | 1530 |
| 164 | Ga0157378_10168830 | 3300013297 | Bacteria | 2050 |
| 165 | Ga0163162_10012665 | 3300013306 | Bacteria | 8236 |
| 166 | Ga0163162_10046721 | 3300013306 | Bacteria | 4340 |
| 167 | Ga0163162_10061533 | 3300013306 | Bacteria | 3792 |
| 168 | Ga0163162_10132160 | 3300013306 | Bacteria | 2605 |
| 169 | Ga0163162_10442528 | 3300013306 | Bacteria | 1432 |
| 170 | Ga0157372_10002748 | 3300013307 | Bacteria | 19019 |
| 171 | Ga0157375_10065595 | 3300013308 | Bacteria | 3620 |
| 172 | Ga0157375_10191793 | 3300013308 | Bacteria | 2198 |
| 173 | Ga0157375_10580559 | 3300013308 | Bacteria | 1281 |
| 174 | Ga0163163_10422730 | 3300014325 | Bacteria | 1392 |
| 175 | Ga0182008_10000083 | 3300014497 | Bacteria | 73635 |
| 176 | Ga0182006_1011481 | 3300015261 | Bacteria | 3894 |
| 177 | Ga0182006_1012808 | 3300015261 | Bacteria | 3659 |
| 178 | Ga0182007_10000117 | 3300015262 | Bacteria | 54576 |
| 179 | Ga0182005_1000220 | 3300015265 | Bacteria | 37719 |
| 180 | Ga0182005_1003904 | 3300015265 | Bacteria | 4934 |
| 181 | Ga0163161_10007088 | 3300017792 | Bacteria | 7751 |
| 182 | Ga0163161_10049876 | 3300017792 | Bacteria | 3027 |
| 183 | Ga0163161_10122805 | 3300017792 | Bacteria | 1953 |
| 184 | Ga0206349_1540627 | 3300020075 | Bacteria | 1379 |
| 185 | Ga0154015_1546600 | 3300020610 | Bacteria | 6538 |
| 186 | Ga0213872_10046939 | 3300021361 | Bacteria | 1965 |
| 187 | Ga0213872_10070055 | 3300021361 | Bacteria | 1581 |
| 188 | Ga0209784_100006 | 3300025224 | Bacteria | 930704 |
| 189 | Ga0209784_100108 | 3300025224 | Bacteria | 94409 |
| 190 | Ga0209784_100846 | 3300025224 | Bacteria | 6784 |
| 191 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 192 | Ga0209566_100602 | 3300025225 | Bacteria | 22518 |
| 193 | Ga0209566_103317 | 3300025225 | Bacteria | 2521 |
| 194 | Ga0209674_100097 | 3300025226 | Bacteria | 167285 |
| 195 | Ga0209674_100168 | 3300025226 | Bacteria | 84107 |
| 196 | Ga0209674_100981 | 3300025226 | Bacteria | 8854 |
| 197 | Ga0209674_101230 | 3300025226 | Bacteria | 7288 |
| 198 | Ga0209147_100018 | 3300025229 | Bacteria | 515719 |
| 199 | Ga0209563_100041 | 3300025230 | Bacteria | 407467 |
| 200 | Ga0209563_104405 | 3300025230 | Bacteria | 2698 |
| 201 | Ga0209437_101206 | 3300025233 | Bacteria | 7471 |
| 202 | Ga0209258_100028 | 3300025242 | Bacteria | 515719 |
| 203 | Ga0207425_1000015 | 3300025245 | Bacteria | 466368 |
| 204 | Ga0209646_1000153 | 3300025246 | Bacteria | 96707 |
| 205 | Ga0209677_100007 | 3300025253 | Bacteria | 1021332 |
| 206 | Ga0209677_107409 | 3300025253 | Bacteria | 2341 |
| 207 | Ga0209148_1000297 | 3300025254 | Bacteria | 72735 |
| 208 | Ga0209148_1002278 | 3300025254 | Bacteria | 6926 |
| 209 | Ga0209759_1002551 | 3300025256 | Bacteria | 7905 |
| 210 | Ga0209759_1002829 | 3300025256 | Bacteria | 7322 |
| 211 | Ga0209759_1009032 | 3300025256 | Bacteria | 3053 |
| 212 | Ga0209759_1014014 | 3300025256 | Bacteria | 2141 |
| 213 | Ga0209129_1000131 | 3300025258 | Bacteria | 127801 |
| 214 | Ga0209455_1000107 | 3300025272 | Bacteria | 195136 |
| 215 | Ga0207673_1004250 | 3300025290 | Bacteria | 1704 |
| 216 | Ga0209675_1003920 | 3300025291 | Bacteria | 6829 |
| 217 | Ga0209676_1000104 | 3300025292 | Bacteria | 226581 |
| 218 | Ga0209676_1000128 | 3300025292 | Bacteria | 188099 |
| 219 | Ga0209676_1000151 | 3300025292 | Bacteria | 167307 |
| 220 | Ga0209676_1005600 | 3300025292 | Bacteria | 6489 |
| 221 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 222 | Ga0209025_1037849 | 3300025294 | Bacteria | 2132 |
| 223 | Ga0209025_1040985 | 3300025294 | Bacteria | 1992 |
| 224 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 225 | Ga0209758_1020232 | 3300025297 | Bacteria | 3161 |
| 226 | Ga0209050_1000796 | 3300025298 | Bacteria | 44614 |
| 227 | Ga0209050_1000985 | 3300025298 | Bacteria | 36261 |
| 228 | Ga0209050_1003203 | 3300025298 | Bacteria | 12387 |
| 229 | Ga0209050_1007470 | 3300025298 | Bacteria | 6119 |
| 230 | Ga0209051_1003539 | 3300025303 | Bacteria | 10180 |
| 231 | Ga0209051_1007550 | 3300025303 | Bacteria | 5924 |
| 232 | Ga0209257_1000413 | 3300025304 | Bacteria | 82516 |
| 233 | Ga0209257_1000434 | 3300025304 | Bacteria | 80353 |
| 234 | Ga0209257_1000796 | 3300025304 | Bacteria | 46060 |
| 235 | Ga0209257_1002077 | 3300025304 | Bacteria | 21100 |
| 236 | Ga0209257_1014808 | 3300025304 | Bacteria | 3310 |
| 237 | Ga0207697_10004112 | 3300025315 | Bacteria | 7024 |
| 238 | Ga0207697_10018043 | 3300025315 | Bacteria | 2897 |
| 239 | Ga0207656_10007972 | 3300025321 | Bacteria | 3883 |
| 240 | Ga0207696_1016340 | 3300025711 | Bacteria | 2485 |
| 241 | Ga0207655_1002897 | 3300025728 | Bacteria | 13240 |
| 242 | Ga0207655_1006892 | 3300025728 | Bacteria | 7456 |
| 243 | Ga0207655_1008231 | 3300025728 | Bacteria | 6645 |
| 244 | Ga0207655_1016757 | 3300025728 | Bacteria | 3992 |
| 245 | Ga0207655_1044630 | 3300025728 | Bacteria | 1860 |
| 246 | Ga0207655_1046046 | 3300025728 | Bacteria | 1815 |
| 247 | Ga0207655_1062978 | 3300025728 | Bacteria | 1423 |
| 248 | Ga0207713_1000535 | 3300025735 | Bacteria | 38232 |
| 249 | Ga0207713_1011252 | 3300025735 | Bacteria | 4879 |
| 250 | Ga0207682_10000870 | 3300025893 | Bacteria | 14001 |
| 251 | Ga0207647_10004266 | 3300025904 | Bacteria | 10602 |
| 252 | Ga0207647_10045620 | 3300025904 | Bacteria | 2734 |
| 253 | Ga0207647_10087403 | 3300025904 | Bacteria | 1862 |
| 254 | Ga0207645_10005766 | 3300025907 | Bacteria | 8932 |
| 255 | Ga0207643_10027172 | 3300025908 | Bacteria | 3171 |
| 256 | Ga0207654_10006004 | 3300025911 | Bacteria | 6111 |
| 257 | Ga0207695_10009088 | 3300025913 | Bacteria | 12340 |
| 258 | Ga0207695_10012681 | 3300025913 | Bacteria | 10095 |
| 259 | Ga0207695_10012956 | 3300025913 | Bacteria | 9967 |
| 260 | Ga0207671_10000013 | 3300025914 | Bacteria | 478458 |
| 261 | Ga0207671_10004397 | 3300025914 | Bacteria | 13516 |
| 262 | Ga0207671_10026987 | 3300025914 | Bacteria | 4297 |
| 263 | Ga0207693_10243509 | 3300025915 | Bacteria | 1412 |
| 264 | Ga0207649_10000111 | 3300025920 | Bacteria | 68568 |
| 265 | Ga0207681_10072066 | 3300025923 | Bacteria | 2411 |
| 266 | Ga0207694_10004579 | 3300025924 | Bacteria | 10775 |
| 267 | Ga0207694_10020419 | 3300025924 | Bacteria | 5013 |
| 268 | Ga0207650_10017851 | 3300025925 | Bacteria | 4971 |
| 269 | Ga0207650_10109287 | 3300025925 | Bacteria | 2138 |
| 270 | Ga0207659_10026798 | 3300025926 | Bacteria | 3894 |
| 271 | Ga0207644_10041097 | 3300025931 | Bacteria | 3269 |
| 272 | Ga0207690_10001080 | 3300025932 | Bacteria | 17433 |
| 273 | Ga0207686_10021887 | 3300025934 | Bacteria | 3675 |
| 274 | Ga0207709_10000019 | 3300025935 | Bacteria | 402225 |
| 275 | Ga0207709_10000954 | 3300025935 | Bacteria | 21622 |
| 276 | Ga0207709_10001101 | 3300025935 | Bacteria | 19831 |
| 277 | Ga0207709_10025527 | 3300025935 | Bacteria | 3384 |
| 278 | Ga0207669_10053122 | 3300025937 | Bacteria | 2438 |
| 279 | Ga0207691_10014615 | 3300025940 | Bacteria | 7483 |
| 280 | Ga0207711_10108645 | 3300025941 | Bacteria | 2464 |
| 281 | Ga0207689_10097761 | 3300025942 | Bacteria | 2412 |
| 282 | Ga0207679_10000105 | 3300025945 | Bacteria | 68561 |
| 283 | Ga0207667_10000047 | 3300025949 | Bacteria | 240471 |
| 284 | Ga0207667_10262627 | 3300025949 | Bacteria | 1765 |
| 285 | Ga0207712_10062854 | 3300025961 | Bacteria | 2641 |
| 286 | Ga0207668_10098422 | 3300025972 | Bacteria | 2167 |
| 287 | Ga0207640_10000154 | 3300025981 | Bacteria | 49637 |
| 288 | Ga0207640_10001091 | 3300025981 | Bacteria | 15000 |
| 289 | Ga0207640_10062050 | 3300025981 | Bacteria | 2478 |
| 290 | Ga0207640_10073870 | 3300025981 | Bacteria | 2306 |
| 291 | Ga0207658_10038290 | 3300025986 | Bacteria | 3453 |
| 292 | Ga0207658_10198646 | 3300025986 | Bacteria | 1673 |
| 293 | Ga0207639_10040742 | 3300026041 | Bacteria | 3469 |
| 294 | Ga0207639_10041821 | 3300026041 | Bacteria | 3432 |
| 295 | Ga0207678_10000106 | 3300026067 | Bacteria | 68474 |
| 296 | Ga0207678_10018900 | 3300026067 | Bacteria | 6054 |
| 297 | Ga0207702_10000135 | 3300026078 | Bacteria | 88092 |
| 298 | Ga0207702_10048334 | 3300026078 | Bacteria | 3588 |
| 299 | Ga0207674_10069548 | 3300026116 | Bacteria | 3540 |
| 300 | Ga0207675_100005953 | 3300026118 | Bacteria | 11620 |
| 301 | Ga0207683_10017060 | 3300026121 | Bacteria | 6179 |
| 302 | Ga0207698_10113019 | 3300026142 | Bacteria | 2281 |
| 303 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 304 | Ga0209371_1000031 | 3300027312 | Bacteria | 399263 |
| 305 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 306 | Ga0209371_1000256 | 3300027312 | Bacteria | 64355 |
| 307 | Ga0268266_10011682 | 3300028379 | Bacteria | 7622 |
| 308 | Ga0307515_10033048 | 3300028794 | Bacteria | 8537 |
| 309 | Ga0307515_10195808 | 3300028794 | Bacteria | 1914 |
| 310 | Ga0265338_10000518 | 3300028800 | Bacteria | 68023 |
| 311 | Ga0265338_10000713 | 3300028800 | Bacteria | 56791 |
| 312 | Ga0265338_10003827 | 3300028800 | Bacteria | 20906 |
| 313 | Ga0265324_10032631 | 3300029957 | Bacteria | 1818 |
| 314 | Ga0268256_1000034 | 3300030500 | Bacteria | 398909 |
| 315 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 316 | Ga0268256_1000216 | 3300030500 | Bacteria | 64353 |
| 317 | Ga0268256_1008755 | 3300030500 | Bacteria | 3439 |
| 318 | Ga0316176_1150308 | 3300030732 | Bacteria | 1679 |
| 319 | Ga0307513_10247978 | 3300031456 | Bacteria | 1580 |
| 320 | Ga0307513_10359283 | 3300031456 | Bacteria | 1202 |
| 321 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 322 | Ga0307408_100007242 | 3300031548 | Bacteria | 7338 |
| 323 | Ga0307408_100034513 | 3300031548 | Bacteria | 3543 |
| 324 | Ga0307408_100100331 | 3300031548 | Bacteria | 2204 |
| 325 | Ga0307514_10000225 | 3300031649 | Bacteria | 151002 |
| 326 | Ga0316576_10003440 | 3300031727 | Bacteria | 9272 |
| 327 | Ga0316578_10129655 | 3300031728 | Bacteria | 1517 |
| 328 | Ga0307405_10002186 | 3300031731 | Bacteria | 8544 |
| 329 | Ga0307405_10011165 | 3300031731 | Bacteria | 4690 |
| 330 | Ga0307405_10012857 | 3300031731 | Bacteria | 4447 |
| 331 | Ga0307413_10016028 | 3300031824 | Bacteria | 3857 |
| 332 | Ga0307413_10106611 | 3300031824 | Bacteria | 1865 |
| 333 | Ga0307413_10141129 | 3300031824 | Bacteria | 1665 |
| 334 | Ga0307413_10165447 | 3300031824 | Bacteria | 1559 |
| 335 | Ga0307410_10000399 | 3300031852 | Bacteria | 17113 |
| 336 | Ga0307410_10010980 | 3300031852 | Bacteria | 5158 |
| 337 | Ga0307410_10025915 | 3300031852 | Bacteria | 3684 |
| 338 | Ga0307406_10154302 | 3300031901 | Bacteria | 1642 |
| 339 | Ga0307407_10009412 | 3300031903 | Bacteria | 4551 |
| 340 | Ga0307412_10000460 | 3300031911 | Bacteria | 24510 |
| 341 | Ga0307412_10003930 | 3300031911 | Bacteria | 8278 |
| 342 | Ga0307412_10029554 | 3300031911 | Bacteria | 3441 |
| 343 | Ga0307412_10050649 | 3300031911 | Bacteria | 2741 |
| 344 | Ga0307412_10072313 | 3300031911 | Bacteria | 2356 |
| 345 | Ga0307412_10105702 | 3300031911 | Bacteria | 2000 |
| 346 | Ga0307409_100000390 | 3300031995 | Bacteria | 18601 |
| 347 | Ga0307416_100012366 | 3300032002 | Bacteria | 5748 |
| 348 | Ga0307416_100352796 | 3300032002 | Bacteria | 1489 |
| 349 | Ga0307414_10016946 | 3300032004 | Bacteria | 4447 |
| 350 | Ga0307414_10046005 | 3300032004 | Bacteria | 2992 |
| 351 | Ga0307414_10196506 | 3300032004 | Bacteria | 1637 |
| 352 | Ga0307414_10387071 | 3300032004 | Bacteria | 1211 |
| 353 | Ga0307411_10035131 | 3300032005 | Bacteria | 3126 |
| 354 | Ga0307415_100123357 | 3300032126 | Bacteria | 1947 |
| 355 | Ga0373956_0207708 | 3300035119 | Bacteria | 929 |
| 356 | Ga0373957_0064647 | 3300035120 | Bacteria | 1423 |
| 357 | Ga0316574_0060982 | 3300035398 | Bacteria | 2368 |
| 358 | Ga0373937_0072954 | 3300036401 | Unclassified | 3166 |
| 359 | Ga0316584_0019598 | 3300036712 | Bacteria | 4891 |
| 360 | Ga0395899_0026111 | 3300037312 | Bacteria | 4408 |
| 361 | Ga0395900_0014044 | 3300037418 | Bacteria | 8178 |
| 362 | Ga0395900_0059647 | 3300037418 | Bacteria | 3928 |
| 363 | Ga0395900_0075227 | 3300037418 | Bacteria | 3471 |
| 364 | Ga0395898_0192565 | 3300037466 | Bacteria | 1948 |
| 365 | Ga0395898_0344843 | 3300037466 | Bacteria | 1420 |
| 366 | Ga0395901_0000212 | 3300038443 | Bacteria | 73375 |
| 367 | Ga0395901_0062253 | 3300038443 | Bacteria | 3883 |
| 368 | Ga0395901_0070670 | 3300038443 | Bacteria | 3637 |
| 369 | Ga0237819_00007 | 3300038705 | Bacteria | 74520 |
| 370 | Ga0436361_0648767 | 3300039447 | Bacteria | 1580 |
| 371 | Ga0436361_1075392 | 3300039447 | Bacteria | 1991 |
| 372 | Ga0439436_0004053 | 3300041404 | Bacteria | 4490 |
| 373 | Ga0439436_0014131 | 3300041404 | Bacteria | 2413 |
| 374 | Ga0439438_005806 | 3300041405 | Bacteria | 4480 |
| 375 | Ga0439439_0003616 | 3300041406 | Bacteria | 3424 |
| 376 | Ga0439461_0007371 | 3300041410 | Bacteria | 1947 |
| 377 | Ga0439466_0006254 | 3300041411 | Bacteria | 4531 |
| 378 | Ga0451793_0257911 | 3300041452 | Bacteria | 1927 |
| 379 | Ga0451800_1301053 | 3300041459 | Bacteria | 3690 |
| 380 | Ga0451806_414687 | 3300041462 | Bacteria | 2583 |
| 381 | Ga0451804_0787358 | 3300041463 | Bacteria | 2453 |
| 382 | Ga0451807_1029248 | 3300041486 | Bacteria | 4389 |
| 383 | Ga0439433_0000805 | 3300041999 | Bacteria | 6196 |
| 384 | Ga0439433_0003329 | 3300041999 | Bacteria | 3443 |
| 385 | Ga0439442_000590 | 3300042002 | Bacteria | 7857 |
| 386 | Ga0439442_017738 | 3300042002 | Bacteria | 1469 |
| 387 | Ga0439432_041056 | 3300042006 | Bacteria | 1466 |
| 388 | Ga0439449_0000998 | 3300042007 | Bacteria | 11132 |
| 389 | Ga0439452_016998 | 3300042010 | Bacteria | 1966 |
| 390 | Ga0439457_004793 | 3300042014 | Bacteria | 3482 |
| 391 | Ga0439457_016928 | 3300042014 | Bacteria | 1622 |
| 392 | Ga0439462_0006897 | 3300042015 | Bacteria | 2833 |
| 393 | Ga0450920_003213 | 3300042122 | Bacteria | 2821 |
| 394 | Ga0450920_003277 | 3300042122 | Bacteria | 2796 |
| 395 | Ga0450920_006491 | 3300042122 | Bacteria | 2105 |
| 396 | Ga0450908_019332 | 3300042184 | Bacteria | 1200 |
| 397 | Ga0439434_0016828 | 3300042435 | Bacteria | 2185 |
| 398 | Ga0439434_0036096 | 3300042435 | Bacteria | 1511 |
| 399 | Ga0439444_0015613 | 3300042437 | Bacteria | 1284 |
| 400 | Ga0495627_012263 | 3300046453 | Bacteria | 3048 |
| 401 | Ga0495592_0012285 | 3300046454 | Bacteria | 6501 |
| 402 | Ga0495603_0181321 | 3300046455 | Bacteria | 1218 |
| 403 | Ga0495590_0000005 | 3300046457 | Bacteria | 384276 |
| 404 | Ga0495591_042630 | 3300046458 | Bacteria | 1282 |
| 405 | Ga0495629_0001627 | 3300046459 | Bacteria | 17647 |
| 406 | Ga0495638_0000349 | 3300046460 | Bacteria | 57958 |
| 407 | Ga0495638_0002006 | 3300046460 | Bacteria | 17383 |
| 408 | Ga0495651_0001597 | 3300046462 | Bacteria | 17529 |
| 409 | Ga0495651_0002705 | 3300046462 | Bacteria | 13761 |
| 410 | Ga0495653_0009962 | 3300046463 | Bacteria | 7776 |
| 411 | Ga0495653_0041454 | 3300046463 | Bacteria | 3593 |
| 412 | Ga0495650_0001852 | 3300046471 | Bacteria | 18928 |
| 413 | Ga0495650_0004198 | 3300046471 | Bacteria | 9983 |
| 414 | Ga0495650_0017063 | 3300046471 | Bacteria | 3652 |
| 415 | Ga0495580_0174226 | 3300046472 | Bacteria | 1486 |
| 416 | Ga0495582_0029359 | 3300046473 | Bacteria | 3019 |
| 417 | Ga0495605_0062900 | 3300046474 | Bacteria | 1772 |
| 418 | Ga0495639_0026961 | 3300046475 | Bacteria | 2542 |
| 419 | Ga0495639_0035054 | 3300046475 | Bacteria | 2245 |
| 420 | Ga0495664_0151612 | 3300046477 | Bacteria | 1406 |
| 421 | Ga0495607_0007029 | 3300046501 | Bacteria | 7827 |
| 422 | Ga0495607_0009895 | 3300046501 | Bacteria | 6429 |
| 423 | Ga0495583_0000209 | 3300046506 | Bacteria | 98671 |
| 424 | Ga0495583_0000995 | 3300046506 | Bacteria | 32418 |
| 425 | Ga0495608_0003597 | 3300046511 | Bacteria | 11120 |
| 426 | Ga0495616_0031233 | 3300046513 | Bacteria | 2791 |
| 427 | Ga0495628_0025729 | 3300046516 | Bacteria | 4806 |
| 428 | Ga0495631_0059012 | 3300046518 | Bacteria | 1668 |
| 429 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 430 | Ga0495648_0000375 | 3300046524 | Bacteria | 48984 |
| 431 | Ga0495642_0003109 | 3300046528 | Bacteria | 6589 |
| 432 | Ga0495642_0003167 | 3300046528 | Bacteria | 6523 |
| 433 | Ga0495652_0003836 | 3300046529 | Bacteria | 14669 |
| 434 | Ga0495652_0006773 | 3300046529 | Bacteria | 10623 |
| 435 | Ga0495652_0336003 | 3300046529 | Bacteria | 1087 |
| 436 | Ga0495665_0021062 | 3300046531 | Bacteria | 3503 |
| 437 | Ga0495586_0021160 | 3300046535 | Bacteria | 3465 |
| 438 | Ga0495587_0007588 | 3300046536 | Bacteria | 7018 |
| 439 | Ga0495587_0154958 | 3300046536 | Bacteria | 1305 |
| 440 | Ga0495598_0024486 | 3300046537 | Bacteria | 1637 |
| 441 | Ga0495609_0044388 | 3300046538 | Bacteria | 1993 |
| 442 | Ga0495645_0060911 | 3300046543 | Bacteria | 2735 |
| 443 | Ga0495645_0086426 | 3300046543 | Bacteria | 2244 |
| 444 | Ga0495622_0000402 | 3300046557 | Bacteria | 29185 |
| 445 | Ga0495633_0000888 | 3300046558 | Bacteria | 25638 |
| 446 | Ga0495633_0031307 | 3300046558 | Bacteria | 2580 |
| 447 | Ga0495667_0001544 | 3300046559 | Bacteria | 15256 |
| 448 | Ga0495667_0014924 | 3300046559 | Bacteria | 5249 |
| 449 | Ga0495656_0016425 | 3300046615 | Bacteria | 2808 |
| 450 | Ga0495668_0000719 | 3300046616 | Bacteria | 39799 |
| 451 | Ga0495625_0000124 | 3300046660 | Bacteria | 120849 |
| 452 | Ga0495635_0019665 | 3300046663 | Bacteria | 4702 |
| 453 | Ga0495661_0064693 | 3300046665 | Bacteria | 2157 |
| 454 | Ga0495588_0004262 | 3300046674 | Bacteria | 6307 |
| 455 | Ga0495588_0033239 | 3300046674 | Bacteria | 2604 |
| 456 | Ga0495657_0002665 | 3300046675 | Bacteria | 14916 |
| 457 | Ga0495599_0064677 | 3300046678 | Bacteria | 2285 |
| 458 | Ga0495599_0156691 | 3300046678 | Bacteria | 1409 |
| 459 | Ga0495646_0059292 | 3300046680 | Bacteria | 2286 |
| 460 | Ga0495646_0074194 | 3300046680 | Bacteria | 1997 |
| 461 | Ga0495669_0058797 | 3300046684 | Bacteria | 1735 |
| 462 | Ga0495669_0070470 | 3300046684 | Bacteria | 1592 |
| 463 | Ga0495613_0026618 | 3300046689 | Bacteria | 4308 |
| 464 | Ga0495589_0143784 | 3300046794 | Bacteria | 1141 |
| 465 | Ga0495600_0012206 | 3300046809 | Bacteria | 5367 |
| 466 | Ga0495600_0129405 | 3300046809 | Bacteria | 1641 |
| 467 | Ga0495660_0000684 | 3300046810 | Bacteria | 25952 |
| 468 | Ga0495660_0159541 | 3300046810 | Bacteria | 1107 |
| 469 | Ga0495581_0003631 | 3300047315 | Bacteria | 8882 |
| 470 | Ga0495581_0008930 | 3300047315 | Bacteria | 5802 |
| 471 | Ga0495581_0031319 | 3300047315 | Bacteria | 3082 |
| 472 | Ga0495581_0136656 | 3300047315 | Bacteria | 1429 |
| 473 | Ga0495604_0025317 | 3300047317 | Bacteria | 4729 |
| 474 | Ga0495604_0035559 | 3300047317 | Bacteria | 3934 |
| 475 | Ga0495636_0030713 | 3300047318 | Bacteria | 2198 |
| 476 | Ga0495674_0006069 | 3300047319 | Bacteria | 11595 |
| 477 | Ga0495674_0036696 | 3300047319 | Bacteria | 4410 |
| 478 | Ga0495674_0075318 | 3300047319 | Bacteria | 2904 |
| 479 | Ga0495676_0009750 | 3300047321 | Bacteria | 8728 |
| 480 | Ga0495680_0005496 | 3300047322 | Bacteria | 11906 |
| 481 | Ga0495680_0134581 | 3300047322 | Bacteria | 1813 |
| 482 | Ga0495675_0217698 | 3300047444 | Bacteria | 1157 |
| 483 | Ga0495673_0000427 | 3300047469 | Bacteria | 47775 |
| 484 | Ga0495681_0098629 | 3300047470 | Bacteria | 1280 |
| 485 | Ga0495684_0019689 | 3300047471 | Bacteria | 5199 |
| 486 | Ga0495686_0040674 | 3300047472 | Bacteria | 2963 |
| 487 | Ga0495593_0056985 | 3300047673 | Bacteria | 2053 |
| 488 | Ga0495602_0007375 | 3300048088 | Bacteria | 11513 |
| 489 | Ga0495602_0040834 | 3300048088 | Bacteria | 4246 |
| 490 | Ga0495614_0038641 | 3300048089 | Bacteria | 2048 |
| 491 | Ga0495626_0039820 | 3300048091 | Bacteria | 2222 |
| 492 | Ga0496100_0016500 | 3300048903 | Bacteria | 4338 |
| 493 | Ga0496101_0016296 | 3300048904 | Bacteria | 5016 |
| 494 | Ga0496102_0033322 | 3300048905 | Bacteria | 4628 |
| 495 | Ga0496102_0040630 | 3300048905 | Bacteria | 4208 |
| 496 | Ga0496102_0138920 | 3300048905 | Bacteria | 2277 |
| 497 | Ga0496102_0297353 | 3300048905 | Bacteria | 1521 |
| 498 | Ga0496102_0450985 | 3300048905 | Bacteria | 1207 |
| 499 | Ga0496103_0026578 | 3300048906 | Bacteria | 3503 |
| 500 | Ga0496103_0045262 | 3300048906 | Bacteria | 2715 |
| 501 | Ga0496103_0061550 | 3300048906 | Bacteria | 2334 |
| 502 | Ga0496104_0074077 | 3300048907 | Bacteria | 3241 |
| 503 | Ga0496104_0196961 | 3300048907 | Bacteria | 1926 |
| 504 | Ga0496104_0384812 | 3300048907 | Bacteria | 1315 |
| 505 | Ga0496105_0022937 | 3300048908 | Bacteria | 5061 |
| 506 | Ga0496105_0031284 | 3300048908 | Bacteria | 4363 |
| 507 | Ga0496105_0063890 | 3300048908 | Bacteria | 3037 |
| 508 | Ga0496107_0001472 | 3300048910 | Bacteria | 14564 |
| 509 | Ga0496107_0016974 | 3300048910 | Bacteria | 5119 |
| 510 | Ga0496107_0179394 | 3300048910 | Bacteria | 1572 |
| 511 | Ga0496108_0213192 | 3300048911 | Bacteria | 1676 |
| 512 | Ga0496109_0333773 | 3300048912 | Bacteria | 1431 |
| 513 | Ga0496110_0040917 | 3300048913 | Bacteria | 4041 |
| 514 | Ga0496110_0069866 | 3300048913 | Bacteria | 3110 |
| 515 | Ga0496111_0029654 | 3300048914 | Bacteria | 3886 |
| 516 | Ga0496112_0082633 | 3300048915 | Bacteria | 3176 |
| 517 | Ga0496112_0234863 | 3300048915 | Bacteria | 1787 |
| 518 | Ga0496113_0043686 | 3300048916 | Bacteria | 3317 |
| 519 | Ga0496113_0082665 | 3300048916 | Bacteria | 2463 |
| 520 | Ga0496113_0295913 | 3300048916 | Bacteria | 1295 |
| 521 | Ga0496114_0058080 | 3300048917 | Bacteria | 3230 |
| 522 | Ga0496114_0105752 | 3300048917 | Bacteria | 2407 |
| 523 | Ga0496115_0037698 | 3300048918 | Bacteria | 3832 |
| 524 | Ga0496115_0227974 | 3300048918 | Bacteria | 1537 |
| 525 | Ga0496115_0262489 | 3300048918 | Bacteria | 1420 |
| 526 | Ga0496116_0005857 | 3300048919 | Bacteria | 11292 |
| 527 | Ga0496116_0007649 | 3300048919 | Bacteria | 9532 |
| 528 | Ga0496116_0049894 | 3300048919 | Bacteria | 2793 |
| 529 | Ga0496116_0171041 | 3300048919 | Bacteria | 1177 |
| 530 | Ga0496117_0000369 | 3300048920 | Bacteria | 78448 |
| 531 | Ga0496117_0000829 | 3300048920 | Bacteria | 47900 |
| 532 | Ga0496117_0001338 | 3300048920 | Bacteria | 36231 |
| 533 | Ga0496117_0005490 | 3300048920 | Bacteria | 13289 |
| 534 | Ga0496117_0009239 | 3300048920 | Bacteria | 9218 |
| 535 | Ga0496117_0021751 | 3300048920 | Bacteria | 5175 |
| 536 | Ga0496117_0053757 | 3300048920 | Bacteria | 2827 |
| 537 | Ga0496118_0000406 | 3300048921 | Bacteria | 71874 |
| 538 | Ga0496118_0002325 | 3300048921 | Bacteria | 25790 |
| 539 | Ga0496118_0002786 | 3300048921 | Bacteria | 22881 |
| 540 | Ga0496118_0016572 | 3300048921 | Bacteria | 6756 |
| 541 | Ga0496118_0054731 | 3300048921 | Bacteria | 3019 |
| 542 | Ga0496118_0086813 | 3300048921 | Bacteria | 2172 |
| 543 | Ga0496118_0147901 | 3300048921 | Bacteria | 1475 |
| 544 | Ga0496119_0000301 | 3300048922 | Bacteria | 69339 |
| 545 | Ga0496119_0006605 | 3300048922 | Bacteria | 10683 |
| 546 | Ga0496119_0008842 | 3300048922 | Bacteria | 8758 |
| 547 | Ga0496119_0035555 | 3300048922 | Bacteria | 3262 |
| 548 | Ga0496120_0000402 | 3300048923 | Bacteria | 69322 |
| 549 | Ga0496120_0002718 | 3300048923 | Bacteria | 17292 |
| 550 | Ga0496120_0018130 | 3300048923 | Bacteria | 4544 |
| 551 | Ga0496120_0024279 | 3300048923 | Bacteria | 3783 |
| 552 | Ga0496121_0000164 | 3300048924 | Bacteria | 145421 |
| 553 | Ga0496121_0002806 | 3300048924 | Bacteria | 25767 |
| 554 | Ga0496121_0006928 | 3300048924 | Bacteria | 13816 |
| 555 | Ga0496121_0008829 | 3300048924 | Bacteria | 11737 |
| 556 | Ga0496121_0057224 | 3300048924 | Bacteria | 3233 |
| 557 | Ga0496121_0098168 | 3300048924 | Bacteria | 2267 |
| 558 | Ga0496122_0000227 | 3300048925 | Bacteria | 125743 |
| 559 | Ga0496122_0001751 | 3300048925 | Bacteria | 33413 |
| 560 | Ga0496122_0011096 | 3300048925 | Bacteria | 9184 |
| 561 | Ga0496122_0014211 | 3300048925 | Bacteria | 7714 |
| 562 | Ga0496122_0014373 | 3300048925 | Bacteria | 7659 |
| 563 | Ga0496122_0060247 | 3300048925 | Bacteria | 2796 |
| 564 | Ga0496122_0063183 | 3300048925 | Bacteria | 2704 |
| 565 | Ga0496122_0077851 | 3300048925 | Bacteria | 2326 |
| 566 | Ga0496122_0085595 | 3300048925 | Bacteria | 2174 |
| 567 | Ga0496123_0000265 | 3300048926 | Bacteria | 104723 |
| 568 | Ga0496123_0000795 | 3300048926 | Bacteria | 50979 |
| 569 | Ga0496123_0004482 | 3300048926 | Bacteria | 14646 |
| 570 | Ga0496123_0007554 | 3300048926 | Bacteria | 10189 |
| 571 | Ga0496123_0009133 | 3300048926 | Bacteria | 8968 |
| 572 | Ga0496123_0014808 | 3300048926 | Bacteria | 6438 |
| 573 | Ga0496124_0000034 | 3300048927 | Bacteria | 325332 |
| 574 | Ga0496124_0000991 | 3300048927 | Bacteria | 44959 |
| 575 | Ga0496124_0002054 | 3300048927 | Bacteria | 27351 |
| 576 | Ga0496124_0006990 | 3300048927 | Bacteria | 12099 |
| 577 | Ga0496124_0008723 | 3300048927 | Bacteria | 10532 |
| 578 | Ga0496124_0016659 | 3300048927 | Bacteria | 6973 |
| 579 | Ga0496124_0026942 | 3300048927 | Bacteria | 5172 |
| 580 | Ga0496124_0034367 | 3300048927 | Bacteria | 4451 |
| 581 | Ga0496124_0077937 | 3300048927 | Bacteria | 2732 |
| 582 | Ga0496124_0078881 | 3300048927 | Bacteria | 2712 |
| 583 | Ga0496124_0156785 | 3300048927 | Bacteria | 1779 |
| 584 | Ga0496124_0202515 | 3300048927 | Bacteria | 1508 |
| 585 | Ga0496125_0000044 | 3300048928 | Bacteria | 296762 |
| 586 | Ga0496125_0000190 | 3300048928 | Bacteria | 132540 |
| 587 | Ga0496125_0002163 | 3300048928 | Bacteria | 26296 |
| 588 | Ga0496125_0003842 | 3300048928 | Bacteria | 17821 |
| 589 | Ga0496125_0007703 | 3300048928 | Bacteria | 11409 |
| 590 | Ga0496125_0028908 | 3300048928 | Bacteria | 4992 |
| 591 | Ga0496125_0034756 | 3300048928 | Bacteria | 4436 |
| 592 | Ga0496126_0001069 | 3300048929 | Bacteria | 46093 |
| 593 | Ga0496126_0004648 | 3300048929 | Bacteria | 16233 |
| 594 | Ga0496126_0006225 | 3300048929 | Bacteria | 13340 |
| 595 | Ga0496126_0025860 | 3300048929 | Bacteria | 5639 |
| 596 | Ga0496126_0066238 | 3300048929 | Bacteria | 3230 |
| 597 | Ga0496126_0079199 | 3300048929 | Bacteria | 2909 |
| 598 | Ga0496126_0167205 | 3300048929 | Bacteria | 1876 |
| 599 | Ga0501315_003829 | 3300049531 | Bacteria | 1533 |
| 600 | Ga0501031_0040572 | 3300049568 | Bacteria | 3039 |
| 601 | Ga0501032_0016464 | 3300049569 | Bacteria | 5200 |
| 602 | Ga0501032_0062372 | 3300049569 | Bacteria | 2498 |
| 603 | Ga0501033_0000839 | 3300049570 | Bacteria | 28060 |
| 604 | Ga0501033_0042833 | 3300049570 | Bacteria | 3374 |
| 605 | Ga0501034_0000798 | 3300049571 | Bacteria | 46906 |
| 606 | Ga0501037_0000228 | 3300049573 | Bacteria | 49067 |
| 607 | Ga0501037_0159036 | 3300049573 | Bacteria | 1611 |
| 608 | Ga0501038_0001410 | 3300049574 | Bacteria | 22000 |
| 609 | Ga0501039_0221615 | 3300049575 | Bacteria | 1487 |
| 610 | Ga0501047_0051969 | 3300049581 | Bacteria | 3961 |
| 611 | Ga0501047_0402763 | 3300049581 | Bacteria | 1201 |
| 612 | Ga0501070_0288512 | 3300049586 | Bacteria | 1338 |
| 613 | Ga0501079_0421293 | 3300049741 | Bacteria | 1048 |
| 614 | Ga0501080_0095970 | 3300049742 | Bacteria | 2753 |
| 615 | Ga0501035_0001120 | 3300049822 | Bacteria | 28018 |
| 616 | Ga0501035_0301184 | 3300049822 | Bacteria | 1351 |
| 617 | Ga0501044_0075508 | 3300049823 | Bacteria | 3422 |
| 618 | nmdc:mga00v17_308_c1 | 3300050491 | Bacteria | 28036 |
| 619 | nmdc:mga00v17_47857_c1 | 3300050491 | Bacteria | 2590 |
| 620 | nmdc:mga0yw44_123233_c1 | 3300050492 | Bacteria | 1671 |
| 621 | nmdc:mga0yw44_17954_c1 | 3300050492 | Bacteria | 3863 |
| 622 | nmdc:mga05p37_55686_c1 | 3300050507 | Bacteria | 4868 |
| 623 | nmdc:mga06r32_29282_c1 | 3300050510 | Bacteria | 5159 |
| 624 | nmdc:mga08y16_47829_c1 | 3300050511 | Bacteria | 4477 |
| 625 | nmdc:mga0n895_221882_c1 | 3300050512 | Bacteria | 1919 |
| 626 | nmdc:mga0sz30_15652_c1 | 3300050516 | Bacteria | 2999 |
| 627 | Ga0495601_0107032 | 3300053077 | Bacteria | 1809 |
| 628 | Ga0500644_0000306 | 3300053088 | Bacteria | 25948 |
| 629 | Ga0500618_001158 | 3300053125 | Bacteria | 12766 |
| 630 | Ga0500618_002275 | 3300053125 | Bacteria | 7423 |
| 631 | Ga0500616_0000667 | 3300053153 | Bacteria | 40674 |
| 632 | Ga0587072_001000 | 3300059643 | Bacteria | 3293 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035119 | Ga0373956_0207708 | Ga0373956_0207708_77_889 | 269 |
| 2 | 3300005455 | Ga0070663_100028245 | Ga0070663_1000282455 | 318 |
| 3 | 3300005548 | Ga0070665_100011695 | Ga0070665_1000116958 | 318 |
| 4 | 3300005563 | Ga0068855_100252115 | Ga0068855_1002521152 | 318 |
| 5 | 3300005578 | Ga0068854_100014660 | Ga0068854_1000146601 | 318 |
| 6 | 3300005616 | Ga0068852_100145249 | Ga0068852_1001452492 | 318 |
| 7 | 3300009093 | Ga0105240_10036630 | Ga0105240_100366308 | 318 |
| 8 | 3300009174 | Ga0105241_10007804 | Ga0105241_100078048 | 318 |
| 9 | 3300009545 | Ga0105237_10315012 | Ga0105237_103150122 | 318 |
| 10 | 3300009551 | Ga0105238_10170518 | Ga0105238_101705182 | 318 |
| 11 | 3300010375 | Ga0105239_10024465 | Ga0105239_100244659 | 318 |
| 12 | 3300013105 | Ga0157369_10250363 | Ga0157369_102503631 | 318 |
| 13 | 3300013296 | Ga0157374_10322933 | Ga0157374_103229332 | 318 |
| 14 | 3300025911 | Ga0207654_10006004 | Ga0207654_100060046 | 318 |
| 15 | 3300025913 | Ga0207695_10012681 | Ga0207695_1001268110 | 318 |
| 16 | 3300025914 | Ga0207671_10004397 | Ga0207671_1000439715 | 318 |
| 17 | 3300025924 | Ga0207694_10004579 | Ga0207694_100045793 | 318 |
| 18 | 3300025949 | Ga0207667_10262627 | Ga0207667_102626271 | 318 |
| 19 | 3300026041 | Ga0207639_10041821 | Ga0207639_100418214 | 318 |
| 20 | 3300026067 | Ga0207678_10018900 | Ga0207678_100189008 | 318 |
| 21 | 3300026078 | Ga0207702_10048334 | Ga0207702_100483341 | 318 |
| 22 | 3300026142 | Ga0207698_10113019 | Ga0207698_101130192 | 318 |
| 23 | 3300025904 | Ga0207647_10087403 | Ga0207647_100874031 | 319 |
| 24 | 3300025981 | Ga0207640_10062050 | Ga0207640_100620502 | 319 |
| 25 | 3300009551 | Ga0105238_10096300 | Ga0105238_100963002 | 323 |
| 26 | 3300005545 | Ga0070695_100117092 | Ga0070695_1001170922 | 328 |
| 27 | 3300003781 | Ga0055536_1004496 | Ga0055536_10044966 | 329 |
| 28 | 3300003791 | Ga0055530_10003547 | Ga0055530_100035474 | 329 |
| 29 | 3300025292 | Ga0209676_1000128 | Ga0209676_100012830 | 329 |
| 30 | 3300025298 | Ga0209050_1000796 | Ga0209050_100079611 | 329 |
| 31 | 3300025303 | Ga0209051_1007550 | Ga0209051_10075501 | 329 |
| 32 | 3300025304 | Ga0209257_1014808 | Ga0209257_10148081 | 329 |
| 33 | 3300046462 | Ga0495651_0001597 | Ga0495651_0001597_8333_9346 | 330 |
| 34 | 3300046516 | Ga0495628_0025729 | Ga0495628_0025729_3397_4410 | 330 |
| 35 | 3300046529 | Ga0495652_0006773 | Ga0495652_0006773_3208_4221 | 330 |
| 36 | 3300046543 | Ga0495645_0086426 | Ga0495645_0086426_308_1321 | 330 |
| 37 | 3300046678 | Ga0495599_0156691 | Ga0495599_0156691_367_1380 | 330 |
| 38 | 3300046809 | Ga0495600_0012206 | Ga0495600_0012206_2390_3403 | 330 |
| 39 | 3300047317 | Ga0495604_0025317 | Ga0495604_0025317_2506_3519 | 330 |
| 40 | 3300025728 | Ga0207655_1016757 | Ga0207655_10167572 | 331 |
| 41 | 3300025728 | Ga0207655_1062978 | Ga0207655_10629782 | 331 |
| 42 | 3300048922 | Ga0496119_0008842 | Ga0496119_0008842_495_1559 | 331 |
| 43 | 3300048923 | Ga0496120_0024279 | Ga0496120_0024279_16_1080 | 331 |
| 44 | 3300048925 | Ga0496122_0060247 | Ga0496122_0060247_178_1242 | 331 |
| 45 | 3300005331 | Ga0070670_100273742 | Ga0070670_1002737422 | 332 |
| 46 | 3300005543 | Ga0070672_100141408 | Ga0070672_1001414082 | 332 |
| 47 | 3300025728 | Ga0207655_1002897 | Ga0207655_10028973 | 332 |
| 48 | 3300046529 | Ga0495652_0336003 | Ga0495652_0336003_11_1009 | 332 |
| 49 | iso_pu_bacteria | 8002745576 | 8002749022 | 332 |
| 50 | 3300005334 | Ga0068869_100236838 | Ga0068869_1002368382 | 333 |
| 51 | 3300009176 | Ga0105242_10312352 | Ga0105242_103123521 | 333 |
| 52 | 3300009553 | Ga0105249_10407113 | Ga0105249_104071131 | 333 |
| 53 | 3300013306 | Ga0163162_10442528 | Ga0163162_104425282 | 333 |
| 54 | 3300014325 | Ga0163163_10422730 | Ga0163163_104227301 | 333 |
| 55 | 3300031548 | Ga0307408_100034513 | Ga0307408_1000345132 | 333 |
| 56 | 3300031731 | Ga0307405_10012857 | Ga0307405_100128574 | 333 |
| 57 | 3300031824 | Ga0307413_10016028 | Ga0307413_100160283 | 333 |
| 58 | 3300031852 | Ga0307410_10025915 | Ga0307410_100259152 | 333 |
| 59 | 3300031901 | Ga0307406_10154302 | Ga0307406_101543022 | 333 |
| 60 | 3300032002 | Ga0307416_100012366 | Ga0307416_1000123662 | 333 |
| 61 | 3300032005 | Ga0307411_10035131 | Ga0307411_100351312 | 333 |
| 62 | 3300050492 | nmdc:mga0yw44_123233_c1 | nmdc:mga0yw44_123233_c1_390_1406 | 333 |
| 63 | iso_pu_bacteria | 2858950400 | 2858956662 | 333 |
| 64 | iso_pu_bacteria | 2842391507 | 2842393436 | 334 |
| 65 | iso_pu_bacteria | 2884960567 | 2884961129 | 334 |
| 66 | iso_pu_bacteria | 2917832318 | 2917833192 | 334 |
| 67 | 3300035120 | Ga0373957_0064647 | Ga0373957_0064647_350_1360 | 335 |
| 68 | 3300036401 | Ga0373937_0072954 | Ga0373937_0072954_516_1532 | 335 |
| 69 | 3300046454 | Ga0495592_0012285 | Ga0495592_0012285_4458_5468 | 335 |
| 70 | 3300046462 | Ga0495651_0002705 | Ga0495651_0002705_1624_2634 | 335 |
| 71 | 3300046463 | Ga0495653_0009962 | Ga0495653_0009962_581_1591 | 335 |
| 72 | 3300046511 | Ga0495608_0003597 | Ga0495608_0003597_1461_2471 | 335 |
| 73 | 3300046529 | Ga0495652_0003836 | Ga0495652_0003836_8058_9068 | 335 |
| 74 | 3300046536 | Ga0495587_0007588 | Ga0495587_0007588_1735_2745 | 335 |
| 75 | 3300046543 | Ga0495645_0060911 | Ga0495645_0060911_377_1387 | 335 |
| 76 | 3300046559 | Ga0495667_0001544 | Ga0495667_0001544_8635_9645 | 335 |
| 77 | 3300046663 | Ga0495635_0019665 | Ga0495635_0019665_1994_3004 | 335 |
| 78 | 3300046675 | Ga0495657_0002665 | Ga0495657_0002665_8457_9467 | 335 |
| 79 | 3300046678 | Ga0495599_0064677 | Ga0495599_0064677_629_1639 | 335 |
| 80 | 3300046680 | Ga0495646_0059292 | Ga0495646_0059292_664_1674 | 335 |
| 81 | 3300047317 | Ga0495604_0035559 | Ga0495604_0035559_688_1698 | 335 |
| 82 | 3300047319 | Ga0495674_0036696 | Ga0495674_0036696_1302_2312 | 335 |
| 83 | 3300047322 | Ga0495680_0005496 | Ga0495680_0005496_2382_3392 | 335 |
| 84 | 3300047471 | Ga0495684_0019689 | Ga0495684_0019689_66_1076 | 335 |
| 85 | 3300048088 | Ga0495602_0040834 | Ga0495602_0040834_2489_3499 | 335 |
| 86 | 3300049586 | Ga0501070_0288512 | Ga0501070_0288512_175_1239 | 335 |
| 87 | 3300053077 | Ga0495601_0107032 | Ga0495601_0107032_683_1693 | 335 |
| 88 | 3300053153 | Ga0500616_0000667 | Ga0500616_0000667_28591_29607 | 335 |
| 89 | iso_pu_bacteria | 2904497146 | 2904500202 | 335 |
| 90 | iso_pu_bacteria | 2910809715 | 2910812527 | 335 |
| 91 | iso_pu_bacteria | 2919034639 | 2919036534 | 335 |
| 92 | iso_pu_bacteria | 2919538618 | 2919540995 | 335 |
| 93 | iso_pu_bacteria | 2932426870 | 2932427138 | 335 |
| 94 | iso_pu_bacteria | 2939674588 | 2939677282 | 335 |
| 95 | iso_pu_bacteria | 2945941187 | 2945941454 | 335 |
| 96 | iso_pu_bacteria | 2945941187 | 2945942723 | 335 |
| 97 | iso_pu_bacteria | 8054107350 | 8054109448 | 335 |
| 98 | 3300003322 | rootL2_10057367 | rootL2_100573673 | 336 |
| 99 | 3300005434 | Ga0070709_10272069 | Ga0070709_102720691 | 336 |
| 100 | 3300006175 | Ga0070712_100138658 | Ga0070712_1001386582 | 336 |
| 101 | 3300009036 | Ga0105244_10006402 | Ga0105244_100064023 | 336 |
| 102 | 3300009036 | Ga0105244_10017652 | Ga0105244_100176522 | 336 |
| 103 | 3300009148 | Ga0105243_10125346 | Ga0105243_101253462 | 336 |
| 104 | 3300009176 | Ga0105242_10048898 | Ga0105242_100488982 | 336 |
| 105 | 3300009553 | Ga0105249_10093359 | Ga0105249_100933592 | 336 |
| 106 | 3300013297 | Ga0157378_10168830 | Ga0157378_101688302 | 336 |
| 107 | 3300013306 | Ga0163162_10132160 | Ga0163162_101321602 | 336 |
| 108 | 3300025915 | Ga0207693_10243509 | Ga0207693_102435091 | 336 |
| 109 | 3300031727 | Ga0316576_10003440 | Ga0316576_100034403 | 336 |
| 110 | 3300031728 | Ga0316578_10129655 | Ga0316578_101296551 | 336 |
| 111 | 3300035398 | Ga0316574_0060982 | Ga0316574_0060982_31_1113 | 336 |
| 112 | 3300036712 | Ga0316584_0019598 | Ga0316584_0019598_3724_4806 | 336 |
| 113 | 3300037312 | Ga0395899_0026111 | Ga0395899_0026111_2716_3726 | 336 |
| 114 | 3300037418 | Ga0395900_0059647 | Ga0395900_0059647_1674_2684 | 336 |
| 115 | 3300037466 | Ga0395898_0344843 | Ga0395898_0344843_203_1213 | 336 |
| 116 | 3300041404 | Ga0439436_0004053 | Ga0439436_0004053_3186_4196 | 336 |
| 117 | 3300041404 | Ga0439436_0014131 | Ga0439436_0014131_1247_2257 | 336 |
| 118 | 3300041405 | Ga0439438_005806 | Ga0439438_005806_2111_3121 | 336 |
| 119 | 3300041406 | Ga0439439_0003616 | Ga0439439_0003616_503_1513 | 336 |
| 120 | 3300041410 | Ga0439461_0007371 | Ga0439461_0007371_606_1616 | 336 |
| 121 | 3300041999 | Ga0439433_0000805 | Ga0439433_0000805_3040_4050 | 336 |
| 122 | 3300041999 | Ga0439433_0003329 | Ga0439433_0003329_2224_3234 | 336 |
| 123 | 3300042002 | Ga0439442_000590 | Ga0439442_000590_4337_5347 | 336 |
| 124 | 3300042002 | Ga0439442_017738 | Ga0439442_017738_49_1059 | 336 |
| 125 | 3300042006 | Ga0439432_041056 | Ga0439432_041056_282_1292 | 336 |
| 126 | 3300042007 | Ga0439449_0000998 | Ga0439449_0000998_4891_5901 | 336 |
| 127 | 3300042010 | Ga0439452_016998 | Ga0439452_016998_864_1874 | 336 |
| 128 | 3300042014 | Ga0439457_004793 | Ga0439457_004793_261_1271 | 336 |
| 129 | 3300042014 | Ga0439457_016928 | Ga0439457_016928_492_1502 | 336 |
| 130 | 3300042015 | Ga0439462_0006897 | Ga0439462_0006897_215_1225 | 336 |
| 131 | 3300042122 | Ga0450920_003213 | Ga0450920_003213_164_1174 | 336 |
| 132 | 3300042122 | Ga0450920_003277 | Ga0450920_003277_1079_2089 | 336 |
| 133 | 3300042435 | Ga0439434_0016828 | Ga0439434_0016828_269_1279 | 336 |
| 134 | 3300042435 | Ga0439434_0036096 | Ga0439434_0036096_373_1383 | 336 |
| 135 | 3300046473 | Ga0495582_0029359 | Ga0495582_0029359_293_1303 | 336 |
| 136 | 3300046475 | Ga0495639_0026961 | Ga0495639_0026961_849_1859 | 336 |
| 137 | 3300046531 | Ga0495665_0021062 | Ga0495665_0021062_1857_2867 | 336 |
| 138 | 3300046535 | Ga0495586_0021160 | Ga0495586_0021160_204_1214 | 336 |
| 139 | 3300046674 | Ga0495588_0004262 | Ga0495588_0004262_308_1318 | 336 |
| 140 | 3300046809 | Ga0495600_0129405 | Ga0495600_0129405_488_1498 | 336 |
| 141 | 3300047315 | Ga0495581_0003631 | Ga0495581_0003631_6103_7113 | 336 |
| 142 | 3300047322 | Ga0495680_0134581 | Ga0495680_0134581_513_1523 | 336 |
| 143 | 3300047444 | Ga0495675_0217698 | Ga0495675_0217698_85_1095 | 336 |
| 144 | 3300047673 | Ga0495593_0056985 | Ga0495593_0056985_667_1677 | 336 |
| 145 | 3300048905 | Ga0496102_0033322 | Ga0496102_0033322_170_1180 | 336 |
| 146 | 3300048906 | Ga0496103_0026578 | Ga0496103_0026578_1276_2286 | 336 |
| 147 | 3300048906 | Ga0496103_0045262 | Ga0496103_0045262_1586_2596 | 336 |
| 148 | 3300048907 | Ga0496104_0074077 | Ga0496104_0074077_1999_3009 | 336 |
| 149 | 3300048908 | Ga0496105_0063890 | Ga0496105_0063890_332_1342 | 336 |
| 150 | 3300048911 | Ga0496108_0213192 | Ga0496108_0213192_235_1245 | 336 |
| 151 | 3300048912 | Ga0496109_0333773 | Ga0496109_0333773_62_1072 | 336 |
| 152 | 3300048913 | Ga0496110_0069866 | Ga0496110_0069866_1485_2495 | 336 |
| 153 | 3300048915 | Ga0496112_0234863 | Ga0496112_0234863_159_1169 | 336 |
| 154 | 3300048916 | Ga0496113_0043686 | Ga0496113_0043686_357_1367 | 336 |
| 155 | 3300048917 | Ga0496114_0058080 | Ga0496114_0058080_2080_3090 | 336 |
| 156 | 3300048918 | Ga0496115_0262489 | Ga0496115_0262489_12_1022 | 336 |
| 157 | 3300049531 | Ga0501315_003829 | Ga0501315_003829_334_1344 | 336 |
| 158 | 3300049569 | Ga0501032_0062372 | Ga0501032_0062372_370_1380 | 336 |
| 159 | 3300049573 | Ga0501037_0159036 | Ga0501037_0159036_442_1452 | 336 |
| 160 | iso_pu_bacteria | 2597490356 | 2599100420 | 336 |
| 161 | iso_pu_bacteria | 2599185178 | 2599448390 | 336 |
| 162 | iso_pu_bacteria | 2600254954 | 2600444353 | 336 |
| 163 | iso_pu_bacteria | 2600255389 | 2602008168 | 336 |
| 164 | iso_pu_bacteria | 2690315906 | 2691514942 | 336 |
| 165 | iso_pu_bacteria | 2728369097 | 2729145606 | 336 |
| 166 | iso_pu_bacteria | 2808606357 | 2808828049 | 336 |
| 167 | iso_pu_bacteria | 2808606360 | 2808853407 | 336 |
| 168 | iso_pu_bacteria | 2808606371 | 2808897399 | 336 |
| 169 | iso_pu_bacteria | 2811994881 | 2812369876 | 336 |
| 170 | iso_pu_bacteria | 2823421272 | 2823426007 | 336 |
| 171 | iso_pu_bacteria | 2857740372 | 2857744213 | 336 |
| 172 | iso_pu_bacteria | 2900577576 | 2900578504 | 336 |
| 173 | iso_pu_bacteria | 2904776348 | 2904777002 | 336 |
| 174 | iso_pu_bacteria | 2919059106 | 2919059453 | 336 |
| 175 | iso_pu_bacteria | 2919391150 | 2919392971 | 336 |
| 176 | iso_pu_bacteria | 2919501602 | 2919502752 | 336 |
| 177 | iso_pu_bacteria | 2923519811 | 2923523962 | 336 |
| 178 | iso_pu_bacteria | 2926063275 | 2926064425 | 336 |
| 179 | iso_pu_bacteria | 2928058823 | 2928060461 | 336 |
| 180 | iso_pu_bacteria | 2933418574 | 2933419762 | 336 |
| 181 | iso_pu_bacteria | 2939598168 | 2939599015 | 336 |
| 182 | iso_pu_bacteria | 2939647034 | 2939649842 | 336 |
| 183 | iso_pu_bacteria | 2953998280 | 2953999263 | 336 |
| 184 | iso_pu_bacteria | 3007315729 | 3007316363 | 336 |
| 185 | iso_pu_bacteria | 651053060 | 651174694 | 336 |
| 186 | iso_pu_bacteria | 8034962539 | 8034965326 | 336 |
| 187 | 3300006881 | Ga0068865_100259213 | Ga0068865_1002592131 | 337 |
| 188 | 3300028800 | Ga0265338_10000518 | Ga0265338_1000051847 | 337 |
| 189 | 3300029957 | Ga0265324_10032631 | Ga0265324_100326312 | 337 |
| 190 | 3300042437 | Ga0439444_0015613 | Ga0439444_0015613_132_1241 | 337 |
| 191 | 3300047319 | Ga0495674_0006069 | Ga0495674_0006069_6055_7068 | 337 |
| 192 | 3300049575 | Ga0501039_0221615 | Ga0501039_0221615_107_1120 | 337 |
| 193 | 3300049741 | Ga0501079_0421293 | Ga0501079_0421293_22_1035 | 337 |
| 194 | iso_pu_bacteria | 2524023250 | 2524612501 | 337 |
| 195 | iso_pu_bacteria | 2599185292 | 2599903911 | 337 |
| 196 | iso_pu_bacteria | 2643221569 | 2643863487 | 337 |
| 197 | iso_pu_bacteria | 2643221594 | 2643982674 | 337 |
| 198 | iso_pu_bacteria | 2643221621 | 2644120724 | 337 |
| 199 | iso_pu_bacteria | 2738543005 | 2739202762 | 337 |
| 200 | iso_pu_bacteria | 2808606395 | 2809034783 | 337 |
| 201 | iso_pu_bacteria | 2842333319 | 2842340965 | 337 |
| 202 | iso_pu_bacteria | 2858688981 | 2858695394 | 337 |
| 203 | iso_pu_bacteria | 2882456835 | 2882459401 | 337 |
| 204 | iso_pu_bacteria | 2928142448 | 2928143022 | 337 |
| 205 | iso_pu_bacteria | 2941479691 | 2941480543 | 337 |
| 206 | 3300005435 | Ga0070714_100308894 | Ga0070714_1003088942 | 338 |
| 207 | 3300005467 | Ga0070706_100199661 | Ga0070706_1001996611 | 338 |
| 208 | 3300009011 | Ga0105251_10008083 | Ga0105251_100080832 | 338 |
| 209 | 3300009036 | Ga0105244_10020719 | Ga0105244_100207192 | 338 |
| 210 | 3300013102 | Ga0157371_10016092 | Ga0157371_100160925 | 338 |
| 211 | 3300013102 | Ga0157371_10088033 | Ga0157371_100880333 | 338 |
| 212 | 3300013105 | Ga0157369_10014336 | Ga0157369_100143363 | 338 |
| 213 | 3300028800 | Ga0265338_10003827 | Ga0265338_1000382715 | 338 |
| 214 | 3300049570 | Ga0501033_0042833 | Ga0501033_0042833_2149_3216 | 338 |
| 215 | 3300049581 | Ga0501047_0051969 | Ga0501047_0051969_2327_3394 | 338 |
| 216 | 3300049823 | Ga0501044_0075508 | Ga0501044_0075508_2148_3215 | 338 |
| 217 | iso_pu_bacteria | 2501025501 | 2501072070 | 338 |
| 218 | iso_pu_bacteria | 2501025502 | 2501084401 | 338 |
| 219 | iso_pu_bacteria | 2510065053 | 2510284457 | 338 |
| 220 | iso_pu_bacteria | 2510065055 | 2510295576 | 338 |
| 221 | iso_pu_bacteria | 2510065058 | 2510312359 | 338 |
| 222 | iso_pu_bacteria | 2510917013 | 2511088519 | 338 |
| 223 | iso_pu_bacteria | 2510917014 | 2511100880 | 338 |
| 224 | iso_pu_bacteria | 2510917015 | 2511107361 | 338 |
| 225 | iso_pu_bacteria | 2513237082 | 2513553354 | 338 |
| 226 | iso_pu_bacteria | 2513237083 | 2513564974 | 338 |
| 227 | iso_pu_bacteria | 2515154189 | 2516020402 | 338 |
| 228 | iso_pu_bacteria | 2547132130 | 2547503097 | 338 |
| 229 | iso_pu_bacteria | 2554235132 | 2554818547 | 338 |
| 230 | iso_pu_bacteria | 2576861471 | 2578460326 | 338 |
| 231 | iso_pu_bacteria | 2593339238 | 2595446112 | 338 |
| 232 | iso_pu_bacteria | 2606217733 | 2608384213 | 338 |
| 233 | iso_pu_bacteria | 2643221579 | 2643906500 | 338 |
| 234 | iso_pu_bacteria | 2643221581 | 2643913990 | 338 |
| 235 | iso_pu_bacteria | 2643221645 | 2644253316 | 338 |
| 236 | iso_pu_bacteria | 2643221664 | 2644355640 | 338 |
| 237 | iso_pu_bacteria | 2687453129 | 2687580047 | 338 |
| 238 | iso_pu_bacteria | 2721755523 | 2722884494 | 338 |
| 239 | iso_pu_bacteria | 2747842428 | 2747951361 | 338 |
| 240 | iso_pu_bacteria | 2751185800 | 2753358544 | 338 |
| 241 | iso_pu_bacteria | 2751185897 | 2753767823 | 338 |
| 242 | iso_pu_bacteria | 2773857672 | 2774131640 | 338 |
| 243 | iso_pu_bacteria | 2816332141 | 2816519622 | 338 |
| 244 | iso_pu_bacteria | 2818991457 | 2819661991 | 338 |
| 245 | iso_pu_bacteria | 2839138175 | 2839143091 | 338 |
| 246 | iso_pu_bacteria | 2852649853 | 2852652826 | 338 |
| 247 | iso_pu_bacteria | 2852684882 | 2852688664 | 338 |
| 248 | iso_pu_bacteria | 2855730933 | 2855736993 | 338 |
| 249 | iso_pu_bacteria | 2855767633 | 2855767703 | 338 |
| 250 | iso_pu_bacteria | 2857442823 | 2857444113 | 338 |
| 251 | iso_pu_bacteria | 2874220319 | 2874224112 | 338 |
| 252 | iso_pu_bacteria | 2904479285 | 2904481132 | 338 |
| 253 | iso_pu_bacteria | 2919089067 | 2919089953 | 338 |
| 254 | iso_pu_bacteria | 2919125081 | 2919127326 | 338 |
| 255 | iso_pu_bacteria | 2919130084 | 2919133326 | 338 |
| 256 | iso_pu_bacteria | 2919134579 | 2919138246 | 338 |
| 257 | iso_pu_bacteria | 2919513703 | 2919514046 | 338 |
| 258 | iso_pu_bacteria | 2923516293 | 2923516455 | 338 |
| 259 | iso_pu_bacteria | 2928496128 | 2928499964 | 338 |
| 260 | iso_pu_bacteria | 2928531327 | 2928535599 | 338 |
| 261 | iso_pu_bacteria | 2929195423 | 2929195456 | 338 |
| 262 | iso_pu_bacteria | 2931380184 | 2931382728 | 338 |
| 263 | iso_pu_bacteria | 2937610967 | 2937613395 | 338 |
| 264 | iso_pu_bacteria | 2939622612 | 2939623238 | 338 |
| 265 | iso_pu_bacteria | 2939626828 | 2939628145 | 338 |
| 266 | iso_pu_bacteria | 2941475908 | 2941479180 | 338 |
| 267 | iso_pu_bacteria | 2952252522 | 2952253898 | 338 |
| 268 | iso_pu_bacteria | 2961047084 | 2961050876 | 338 |
| 269 | iso_pu_bacteria | 2961064222 | 2961067923 | 338 |
| 270 | iso_pu_bacteria | 2974298342 | 2974301886 | 338 |
| 271 | iso_pu_bacteria | 2984499530 | 2984500546 | 338 |
| 272 | iso_pu_bacteria | 2984504281 | 2984507063 | 338 |
| 273 | iso_pu_bacteria | 2987605356 | 2987607021 | 338 |
| 274 | iso_pu_bacteria | 8003955200 | 8003960345 | 338 |
| 275 | iso_pu_bacteria | 8016728285 | 8016730868 | 338 |
| 276 | iso_pu_bacteria | 8021622325 | 8021622453 | 338 |
| 277 | iso_pu_bacteria | 8021626552 | 8021628834 | 338 |
| 278 | iso_pu_bacteria | 8021648035 | 8021650990 | 338 |
| 279 | 3300003320 | rootH2_10049822 | rootH2_100498222 | 339 |
| 280 | 3300005288 | Ga0065714_10007259 | Ga0065714_100072593 | 339 |
| 281 | 3300005328 | Ga0070676_10015876 | Ga0070676_100158763 | 339 |
| 282 | 3300005331 | Ga0070670_100337027 | Ga0070670_1003370271 | 339 |
| 283 | 3300005333 | Ga0070677_10004983 | Ga0070677_100049831 | 339 |
| 284 | 3300005335 | Ga0070666_10019893 | Ga0070666_100198932 | 339 |
| 285 | 3300005347 | Ga0070668_100034112 | Ga0070668_1000341122 | 339 |
| 286 | 3300005353 | Ga0070669_100201742 | Ga0070669_1002017421 | 339 |
| 287 | 3300005354 | Ga0070675_100014679 | Ga0070675_1000146792 | 339 |
| 288 | 3300005355 | Ga0070671_100032521 | Ga0070671_1000325213 | 339 |
| 289 | 3300005356 | Ga0070674_100016361 | Ga0070674_1000163613 | 339 |
| 290 | 3300005364 | Ga0070673_100020953 | Ga0070673_1000209532 | 339 |
| 291 | 3300005367 | Ga0070667_100086224 | Ga0070667_1000862242 | 339 |
| 292 | 3300005456 | Ga0070678_100042276 | Ga0070678_1000422762 | 339 |
| 293 | 3300005615 | Ga0070702_100125785 | Ga0070702_1001257852 | 339 |
| 294 | 3300005840 | Ga0068870_10043231 | Ga0068870_100432312 | 339 |
| 295 | 3300009036 | Ga0105244_10139238 | Ga0105244_101392381 | 339 |
| 296 | 3300009148 | Ga0105243_10026584 | Ga0105243_100265842 | 339 |
| 297 | 3300009177 | Ga0105248_10052388 | Ga0105248_100523882 | 339 |
| 298 | 3300009553 | Ga0105249_10092216 | Ga0105249_100922162 | 339 |
| 299 | 3300011119 | Ga0105246_10008423 | Ga0105246_100084232 | 339 |
| 300 | 3300013102 | Ga0157371_10040986 | Ga0157371_100409863 | 339 |
| 301 | 3300013306 | Ga0163162_10061533 | Ga0163162_100615332 | 339 |
| 302 | 3300013308 | Ga0157375_10065595 | Ga0157375_100655953 | 339 |
| 303 | 3300013308 | Ga0157375_10191793 | Ga0157375_101917932 | 339 |
| 304 | 3300025290 | Ga0207673_1004250 | Ga0207673_10042502 | 339 |
| 305 | 3300025315 | Ga0207697_10004112 | Ga0207697_100041123 | 339 |
| 306 | 3300025728 | Ga0207655_1008231 | Ga0207655_10082312 | 339 |
| 307 | 3300025893 | Ga0207682_10000870 | Ga0207682_100008702 | 339 |
| 308 | 3300025907 | Ga0207645_10005766 | Ga0207645_100057666 | 339 |
| 309 | 3300025908 | Ga0207643_10027172 | Ga0207643_100271722 | 339 |
| 310 | 3300025923 | Ga0207681_10072066 | Ga0207681_100720662 | 339 |
| 311 | 3300025925 | Ga0207650_10017851 | Ga0207650_100178512 | 339 |
| 312 | 3300025926 | Ga0207659_10026798 | Ga0207659_100267982 | 339 |
| 313 | 3300025931 | Ga0207644_10041097 | Ga0207644_100410974 | 339 |
| 314 | 3300025934 | Ga0207686_10021887 | Ga0207686_100218872 | 339 |
| 315 | 3300025935 | Ga0207709_10025527 | Ga0207709_100255273 | 339 |
| 316 | 3300025937 | Ga0207669_10053122 | Ga0207669_100531222 | 339 |
| 317 | 3300025940 | Ga0207691_10014615 | Ga0207691_100146152 | 339 |
| 318 | 3300025941 | Ga0207711_10108645 | Ga0207711_101086451 | 339 |
| 319 | 3300025986 | Ga0207658_10038290 | Ga0207658_100382904 | 339 |
| 320 | 3300026121 | Ga0207683_10017060 | Ga0207683_100170605 | 339 |
| 321 | 3300031824 | Ga0307413_10141129 | Ga0307413_101411292 | 339 |
| 322 | 3300032004 | Ga0307414_10387071 | Ga0307414_103870712 | 339 |
| 323 | 3300041411 | Ga0439466_0006254 | Ga0439466_0006254_772_1791 | 339 |
| 324 | 3300046518 | Ga0495631_0059012 | Ga0495631_0059012_15_1034 | 339 |
| 325 | 3300047315 | Ga0495581_0031319 | Ga0495581_0031319_721_1740 | 339 |
| 326 | 3300047315 | Ga0495581_0136656 | Ga0495581_0136656_87_1142 | 339 |
| 327 | 3300048905 | Ga0496102_0138920 | Ga0496102_0138920_488_1507 | 339 |
| 328 | 3300048907 | Ga0496104_0196961 | Ga0496104_0196961_612_1631 | 339 |
| 329 | 3300048908 | Ga0496105_0031284 | Ga0496105_0031284_1033_2052 | 339 |
| 330 | 3300048910 | Ga0496107_0179394 | Ga0496107_0179394_379_1398 | 339 |
| 331 | 3300048913 | Ga0496110_0040917 | Ga0496110_0040917_1157_2176 | 339 |
| 332 | 3300048915 | Ga0496112_0082633 | Ga0496112_0082633_204_1223 | 339 |
| 333 | 3300048916 | Ga0496113_0295913 | Ga0496113_0295913_27_1046 | 339 |
| 334 | 3300048917 | Ga0496114_0105752 | Ga0496114_0105752_292_1311 | 339 |
| 335 | 3300048918 | Ga0496115_0037698 | Ga0496115_0037698_2706_3725 | 339 |
| 336 | 3300048927 | Ga0496124_0034367 | Ga0496124_0034367_3125_4144 | 339 |
| 337 | iso_pu_bacteria | 2928115317 | 2928119619 | 339 |
| 338 | 3300001915 | JGI24741J21665_1000701 | JGI24741J21665_10007014 | 340 |
| 339 | 3300001979 | JGI24740J21852_10001102 | JGI24740J21852_100011023 | 340 |
| 340 | 3300001979 | JGI24740J21852_10003569 | JGI24740J21852_100035693 | 340 |
| 341 | 3300002705 | JGI25156J39149_1002620 | JGI25156J39149_10026203 | 340 |
| 342 | 3300003323 | rootH1_10002003 | rootH1_100020031 | 340 |
| 343 | 3300003567 | Ga0006554J51385_1020996 | Ga0006554J51385_10209962 | 340 |
| 344 | 3300003578 | Ga0006562J51391_1003719 | Ga0006562J51391_10037193 | 340 |
| 345 | 3300003578 | Ga0006562J51391_1042671 | Ga0006562J51391_10426712 | 340 |
| 346 | 3300003578 | Ga0006562J51391_1060129 | Ga0006562J51391_10601291 | 340 |
| 347 | 3300003751 | Ga0055538_1001920 | Ga0055538_10019204 | 340 |
| 348 | 3300003751 | Ga0055538_1002774 | Ga0055538_10027743 | 340 |
| 349 | 3300003752 | Ga0055539_1000073 | Ga0055539_100007344 | 340 |
| 350 | 3300003756 | Ga0055533_1000850 | Ga0055533_10008502 | 340 |
| 351 | 3300003756 | Ga0055533_1002700 | Ga0055533_10027005 | 340 |
| 352 | 3300003756 | Ga0055533_1004145 | Ga0055533_10041453 | 340 |
| 353 | 3300003758 | Ga0055532_1000090 | Ga0055532_10000906 | 340 |
| 354 | 3300003759 | Ga0055525_1000387 | Ga0055525_100038725 | 340 |
| 355 | 3300003761 | Ga0055535_1000085 | Ga0055535_10000856 | 340 |
| 356 | 3300003762 | Ga0055542_1000847 | Ga0055542_100084718 | 340 |
| 357 | 3300003763 | Ga0055529_1000134 | Ga0055529_100013499 | 340 |
| 358 | 3300003841 | Ga0055541_1001417 | Ga0055541_10014172 | 340 |
| 359 | 3300003841 | Ga0055541_1004035 | Ga0055541_10040351 | 340 |
| 360 | 3300005331 | Ga0070670_100264853 | Ga0070670_1002648531 | 340 |
| 361 | 3300005331 | Ga0070670_100277919 | Ga0070670_1002779191 | 340 |
| 362 | 3300005344 | Ga0070661_100000141 | Ga0070661_1000001412 | 340 |
| 363 | 3300005366 | Ga0070659_100001430 | Ga0070659_1000014307 | 340 |
| 364 | 3300005455 | Ga0070663_100000034 | Ga0070663_10000003458 | 340 |
| 365 | 3300005518 | Ga0070699_100103088 | Ga0070699_1001030883 | 340 |
| 366 | 3300005548 | Ga0070665_100329479 | Ga0070665_1003294792 | 340 |
| 367 | 3300005564 | Ga0070664_100000057 | Ga0070664_10000005760 | 340 |
| 368 | 3300005577 | Ga0068857_100009494 | Ga0068857_1000094949 | 340 |
| 369 | 3300005578 | Ga0068854_100000299 | Ga0068854_1000002993 | 340 |
| 370 | 3300005614 | Ga0068856_100000811 | Ga0068856_1000008118 | 340 |
| 371 | 3300005983 | Ga0081540_1069939 | Ga0081540_10699391 | 340 |
| 372 | 3300006058 | Ga0075432_10033221 | Ga0075432_100332212 | 340 |
| 373 | 3300006844 | Ga0075428_100049522 | Ga0075428_1000495223 | 340 |
| 374 | 3300006847 | Ga0075431_100094668 | Ga0075431_1000946683 | 340 |
| 375 | 3300009092 | Ga0105250_10025648 | Ga0105250_100256482 | 340 |
| 376 | 3300009093 | Ga0105240_10023229 | Ga0105240_100232295 | 340 |
| 377 | 3300009094 | Ga0111539_10054304 | Ga0111539_100543041 | 340 |
| 378 | 3300009147 | Ga0114129_10087196 | Ga0114129_100871962 | 340 |
| 379 | 3300009147 | Ga0114129_10110850 | Ga0114129_101108502 | 340 |
| 380 | 3300009553 | Ga0105249_10058788 | Ga0105249_100587882 | 340 |
| 381 | 3300010375 | Ga0105239_10009822 | Ga0105239_100098225 | 340 |
| 382 | 3300013100 | Ga0157373_10011643 | Ga0157373_100116435 | 340 |
| 383 | 3300013102 | Ga0157371_10000323 | Ga0157371_1000032351 | 340 |
| 384 | 3300013104 | Ga0157370_10000038 | Ga0157370_1000003851 | 340 |
| 385 | 3300013105 | Ga0157369_10008841 | Ga0157369_100088415 | 340 |
| 386 | 3300013306 | Ga0163162_10046721 | Ga0163162_100467215 | 340 |
| 387 | 3300013307 | Ga0157372_10002748 | Ga0157372_100027489 | 340 |
| 388 | 3300013308 | Ga0157375_10580559 | Ga0157375_105805591 | 340 |
| 389 | 3300015261 | Ga0182006_1011481 | Ga0182006_10114812 | 340 |
| 390 | 3300020610 | Ga0154015_1546600 | Ga0154015_15466003 | 340 |
| 391 | 3300025224 | Ga0209784_100006 | Ga0209784_100006104 | 340 |
| 392 | 3300025224 | Ga0209784_100108 | Ga0209784_10010821 | 340 |
| 393 | 3300025224 | Ga0209784_100846 | Ga0209784_1008463 | 340 |
| 394 | 3300025225 | Ga0209566_100002 | Ga0209566_100002104 | 340 |
| 395 | 3300025225 | Ga0209566_100602 | Ga0209566_1006023 | 340 |
| 396 | 3300025225 | Ga0209566_103317 | Ga0209566_1033171 | 340 |
| 397 | 3300025226 | Ga0209674_100097 | Ga0209674_100097104 | 340 |
| 398 | 3300025226 | Ga0209674_100168 | Ga0209674_10016868 | 340 |
| 399 | 3300025226 | Ga0209674_101230 | Ga0209674_1012304 | 340 |
| 400 | 3300025229 | Ga0209147_100018 | Ga0209147_100018396 | 340 |
| 401 | 3300025230 | Ga0209563_100041 | Ga0209563_100041368 | 340 |
| 402 | 3300025230 | Ga0209563_104405 | Ga0209563_1044052 | 340 |
| 403 | 3300025242 | Ga0209258_100028 | Ga0209258_100028396 | 340 |
| 404 | 3300025246 | Ga0209646_1000153 | Ga0209646_100015351 | 340 |
| 405 | 3300025253 | Ga0209677_100007 | Ga0209677_100007104 | 340 |
| 406 | 3300025253 | Ga0209677_107409 | Ga0209677_1074092 | 340 |
| 407 | 3300025254 | Ga0209148_1000297 | Ga0209148_100029721 | 340 |
| 408 | 3300025256 | Ga0209759_1002551 | Ga0209759_10025513 | 340 |
| 409 | 3300025256 | Ga0209759_1002829 | Ga0209759_10028295 | 340 |
| 410 | 3300025256 | Ga0209759_1009032 | Ga0209759_10090322 | 340 |
| 411 | 3300025256 | Ga0209759_1014014 | Ga0209759_10140142 | 340 |
| 412 | 3300025272 | Ga0209455_1000107 | Ga0209455_100010796 | 340 |
| 413 | 3300025294 | Ga0209025_1040985 | Ga0209025_10409851 | 340 |
| 414 | 3300025303 | Ga0209051_1003539 | Ga0209051_10035397 | 340 |
| 415 | 3300025315 | Ga0207697_10018043 | Ga0207697_100180432 | 340 |
| 416 | 3300025728 | Ga0207655_1006892 | Ga0207655_10068922 | 340 |
| 417 | 3300025904 | Ga0207647_10045620 | Ga0207647_100456202 | 340 |
| 418 | 3300025913 | Ga0207695_10009088 | Ga0207695_100090885 | 340 |
| 419 | 3300025920 | Ga0207649_10000111 | Ga0207649_1000011158 | 340 |
| 420 | 3300025932 | Ga0207690_10001080 | Ga0207690_1000108010 | 340 |
| 421 | 3300025942 | Ga0207689_10097761 | Ga0207689_100977614 | 340 |
| 422 | 3300025945 | Ga0207679_10000105 | Ga0207679_100001058 | 340 |
| 423 | 3300025961 | Ga0207712_10062854 | Ga0207712_100628544 | 340 |
| 424 | 3300025981 | Ga0207640_10000154 | Ga0207640_100001546 | 340 |
| 425 | 3300025986 | Ga0207658_10198646 | Ga0207658_101986462 | 340 |
| 426 | 3300026067 | Ga0207678_10000106 | Ga0207678_1000010658 | 340 |
| 427 | 3300026078 | Ga0207702_10000135 | Ga0207702_1000013580 | 340 |
| 428 | 3300026118 | Ga0207675_100005953 | Ga0207675_1000059535 | 340 |
| 429 | 3300027312 | Ga0209371_1000066 | Ga0209371_100006611 | 340 |
| 430 | 3300030500 | Ga0268256_1000063 | Ga0268256_100006311 | 340 |
| 431 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002667 | 340 |
| 432 | 3300031548 | Ga0307408_100007242 | Ga0307408_1000072422 | 340 |
| 433 | 3300031548 | Ga0307408_100100331 | Ga0307408_1001003312 | 340 |
| 434 | 3300031731 | Ga0307405_10002186 | Ga0307405_100021869 | 340 |
| 435 | 3300031731 | Ga0307405_10011165 | Ga0307405_100111652 | 340 |
| 436 | 3300031824 | Ga0307413_10106611 | Ga0307413_101066112 | 340 |
| 437 | 3300031824 | Ga0307413_10165447 | Ga0307413_101654472 | 340 |
| 438 | 3300031852 | Ga0307410_10000399 | Ga0307410_1000039918 | 340 |
| 439 | 3300031852 | Ga0307410_10010980 | Ga0307410_100109804 | 340 |
| 440 | 3300031903 | Ga0307407_10009412 | Ga0307407_100094124 | 340 |
| 441 | 3300031911 | Ga0307412_10003930 | Ga0307412_100039305 | 340 |
| 442 | 3300031911 | Ga0307412_10029554 | Ga0307412_100295543 | 340 |
| 443 | 3300031911 | Ga0307412_10050649 | Ga0307412_100506492 | 340 |
| 444 | 3300031911 | Ga0307412_10072313 | Ga0307412_100723132 | 340 |
| 445 | 3300031911 | Ga0307412_10105702 | Ga0307412_101057023 | 340 |
| 446 | 3300031995 | Ga0307409_100000390 | Ga0307409_1000003908 | 340 |
| 447 | 3300032002 | Ga0307416_100352796 | Ga0307416_1003527961 | 340 |
| 448 | 3300032004 | Ga0307414_10016946 | Ga0307414_100169463 | 340 |
| 449 | 3300032004 | Ga0307414_10196506 | Ga0307414_101965061 | 340 |
| 450 | 3300032126 | Ga0307415_100123357 | Ga0307415_1001233572 | 340 |
| 451 | 3300037418 | Ga0395900_0014044 | Ga0395900_0014044_3970_4992 | 340 |
| 452 | 3300038443 | Ga0395901_0070670 | Ga0395901_0070670_660_1682 | 340 |
| 453 | 3300042122 | Ga0450920_006491 | Ga0450920_006491_395_1417 | 340 |
| 454 | 3300042184 | Ga0450908_019332 | Ga0450908_019332_117_1139 | 340 |
| 455 | 3300048903 | Ga0496100_0016500 | Ga0496100_0016500_3009_4091 | 340 |
| 456 | 3300048904 | Ga0496101_0016296 | Ga0496101_0016296_3646_4728 | 340 |
| 457 | 3300048905 | Ga0496102_0297353 | Ga0496102_0297353_96_1178 | 340 |
| 458 | 3300048905 | Ga0496102_0450985 | Ga0496102_0450985_10_1032 | 340 |
| 459 | 3300048906 | Ga0496103_0061550 | Ga0496103_0061550_1157_2239 | 340 |
| 460 | 3300048910 | Ga0496107_0001472 | Ga0496107_0001472_1075_2157 | 340 |
| 461 | 3300048914 | Ga0496111_0029654 | Ga0496111_0029654_2458_3540 | 340 |
| 462 | 3300049569 | Ga0501032_0016464 | Ga0501032_0016464_3424_4446 | 340 |
| 463 | 3300049570 | Ga0501033_0000839 | Ga0501033_0000839_5936_6958 | 340 |
| 464 | 3300049573 | Ga0501037_0000228 | Ga0501037_0000228_5724_6746 | 340 |
| 465 | 3300049574 | Ga0501038_0001410 | Ga0501038_0001410_11139_12161 | 340 |
| 466 | 3300049742 | Ga0501080_0095970 | Ga0501080_0095970_364_1386 | 340 |
| 467 | 3300049822 | Ga0501035_0001120 | Ga0501035_0001120_14178_15200 | 340 |
| 468 | 3300049822 | Ga0501035_0301184 | Ga0501035_0301184_81_1115 | 340 |
| 469 | 3300050507 | nmdc:mga05p37_55686_c1 | nmdc:mga05p37_55686_c1_3047_4069 | 340 |
| 470 | 3300050510 | nmdc:mga06r32_29282_c1 | nmdc:mga06r32_29282_c1_553_1575 | 340 |
| 471 | 3300050511 | nmdc:mga08y16_47829_c1 | nmdc:mga08y16_47829_c1_611_1633 | 340 |
| 472 | 3300050512 | nmdc:mga0n895_221882_c1 | nmdc:mga0n895_221882_c1_879_1901 | 340 |
| 473 | 3300059643 | Ga0587072_001000 | Ga0587072_001000_465_1487 | 340 |
| 474 | iso_pu_bacteria | 2846952575 | 2846958392 | 340 |
| 475 | iso_pu_bacteria | 2848858292 | 2848860644 | 340 |
| 476 | iso_pu_bacteria | 8011350971 | 8011354542 | 340 |
| 477 | 3300003322 | rootL2_10004265 | rootL2_100042652 | 341 |
| 478 | 3300005539 | Ga0068853_100051148 | Ga0068853_1000511483 | 341 |
| 479 | 3300011119 | Ga0105246_10303430 | Ga0105246_103034301 | 341 |
| 480 | 3300025298 | Ga0209050_1000985 | Ga0209050_100098517 | 341 |
| 481 | 3300025913 | Ga0207695_10012956 | Ga0207695_1001295610 | 341 |
| 482 | 3300025914 | Ga0207671_10026987 | Ga0207671_100269875 | 341 |
| 483 | 3300025924 | Ga0207694_10020419 | Ga0207694_100204193 | 341 |
| 484 | 3300026041 | Ga0207639_10040742 | Ga0207639_100407424 | 341 |
| 485 | 3300028794 | Ga0307515_10195808 | Ga0307515_101958081 | 341 |
| 486 | 3300031456 | Ga0307513_10359283 | Ga0307513_103592831 | 341 |
| 487 | 3300031911 | Ga0307412_10000460 | Ga0307412_1000046010 | 341 |
| 488 | 3300046455 | Ga0495603_0181321 | Ga0495603_0181321_22_1047 | 341 |
| 489 | 3300046459 | Ga0495629_0001627 | Ga0495629_0001627_3766_4791 | 341 |
| 490 | 3300046471 | Ga0495650_0001852 | Ga0495650_0001852_12898_13923 | 341 |
| 491 | 3300046472 | Ga0495580_0174226 | Ga0495580_0174226_153_1178 | 341 |
| 492 | 3300046475 | Ga0495639_0035054 | Ga0495639_0035054_300_1325 | 341 |
| 493 | 3300046477 | Ga0495664_0151612 | Ga0495664_0151612_98_1123 | 341 |
| 494 | 3300046528 | Ga0495642_0003109 | Ga0495642_0003109_1143_2168 | 341 |
| 495 | 3300046536 | Ga0495587_0154958 | Ga0495587_0154958_113_1138 | 341 |
| 496 | 3300046559 | Ga0495667_0014924 | Ga0495667_0014924_2532_3557 | 341 |
| 497 | 3300046674 | Ga0495588_0033239 | Ga0495588_0033239_788_1813 | 341 |
| 498 | 3300046684 | Ga0495669_0070470 | Ga0495669_0070470_182_1207 | 341 |
| 499 | 3300046689 | Ga0495613_0026618 | Ga0495613_0026618_1834_2859 | 341 |
| 500 | 3300046794 | Ga0495589_0143784 | Ga0495589_0143784_36_1061 | 341 |
| 501 | 3300047315 | Ga0495581_0008930 | Ga0495581_0008930_4368_5393 | 341 |
| 502 | 3300047319 | Ga0495674_0075318 | Ga0495674_0075318_1604_2629 | 341 |
| 503 | 3300047321 | Ga0495676_0009750 | Ga0495676_0009750_1697_2722 | 341 |
| 504 | 3300047470 | Ga0495681_0098629 | Ga0495681_0098629_131_1156 | 341 |
| 505 | 3300048089 | Ga0495614_0038641 | Ga0495614_0038641_361_1386 | 341 |
| 506 | 3300048919 | Ga0496116_0005857 | Ga0496116_0005857_8023_9048 | 341 |
| 507 | 3300048920 | Ga0496117_0021751 | Ga0496117_0021751_2591_3616 | 341 |
| 508 | 3300048921 | Ga0496118_0054731 | Ga0496118_0054731_271_1296 | 341 |
| 509 | 3300048922 | Ga0496119_0035555 | Ga0496119_0035555_751_1776 | 341 |
| 510 | 3300048923 | Ga0496120_0018130 | Ga0496120_0018130_3286_4311 | 341 |
| 511 | 3300048924 | Ga0496121_0000164 | Ga0496121_0000164_10969_11994 | 341 |
| 512 | 3300048924 | Ga0496121_0057224 | Ga0496121_0057224_1759_2784 | 341 |
| 513 | 3300048925 | Ga0496122_0000227 | Ga0496122_0000227_34598_35623 | 341 |
| 514 | 3300048925 | Ga0496122_0085595 | Ga0496122_0085595_659_1684 | 341 |
| 515 | 3300048926 | Ga0496123_0000265 | Ga0496123_0000265_48499_49524 | 341 |
| 516 | 3300048927 | Ga0496124_0078881 | Ga0496124_0078881_1313_2338 | 341 |
| 517 | 3300048927 | Ga0496124_0156785 | Ga0496124_0156785_124_1149 | 341 |
| 518 | 3300048928 | Ga0496125_0000190 | Ga0496125_0000190_6161_7186 | 341 |
| 519 | 3300048929 | Ga0496126_0004648 | Ga0496126_0004648_37_1062 | 341 |
| 520 | 3300048929 | Ga0496126_0167205 | Ga0496126_0167205_202_1227 | 341 |
| 521 | 3300053125 | Ga0500618_002275 | Ga0500618_002275_23_1048 | 341 |
| 522 | 2162886007 | SwRhRL2b_contig_1398166 | SwRhRL2b_0065.00006960 | 342 |
| 523 | 2162886007 | SwRhRL2b_contig_3013297 | SwRhRL2b_0575.00003230 | 342 |
| 524 | 3300001979 | JGI24740J21852_10001979 | JGI24740J21852_100019793 | 342 |
| 525 | 3300002737 | JGI25162J39368_1005203 | JGI25162J39368_10052032 | 342 |
| 526 | 3300002773 | JGI25152J39213_1002500 | JGI25152J39213_10025005 | 342 |
| 527 | 3300003187 | JGI25151J46595_10004949 | JGI25151J46595_100049495 | 342 |
| 528 | 3300003215 | JGI25153J46596_10005084 | JGI25153J46596_100050845 | 342 |
| 529 | 3300003578 | Ga0006562J51391_1002671 | Ga0006562J51391_10026714 | 342 |
| 530 | 3300003781 | Ga0055536_1000208 | Ga0055536_100020847 | 342 |
| 531 | 3300003781 | Ga0055536_1004486 | Ga0055536_10044866 | 342 |
| 532 | 3300003781 | Ga0055536_1008760 | Ga0055536_10087603 | 342 |
| 533 | 3300003781 | Ga0055536_1014629 | Ga0055536_10146293 | 342 |
| 534 | 3300003791 | Ga0055530_10014085 | Ga0055530_100140854 | 342 |
| 535 | 3300003794 | Ga0055531_10002440 | Ga0055531_100024409 | 342 |
| 536 | 3300003794 | Ga0055531_10007366 | Ga0055531_100073665 | 342 |
| 537 | 3300003856 | Ga0058692_1000005 | Ga0058692_1000005240 | 342 |
| 538 | 3300003856 | Ga0058692_1000087 | Ga0058692_100008746 | 342 |
| 539 | 3300005289 | Ga0065704_10074978 | Ga0065704_100749781 | 342 |
| 540 | 3300005289 | Ga0065704_10132396 | Ga0065704_101323962 | 342 |
| 541 | 3300005327 | Ga0070658_10085520 | Ga0070658_100855201 | 342 |
| 542 | 3300005331 | Ga0070670_100016372 | Ga0070670_1000163725 | 342 |
| 543 | 3300005347 | Ga0070668_100000632 | Ga0070668_10000063220 | 342 |
| 544 | 3300005353 | Ga0070669_100059488 | Ga0070669_1000594883 | 342 |
| 545 | 3300005456 | Ga0070678_100159662 | Ga0070678_1001596622 | 342 |
| 546 | 3300005467 | Ga0070706_100068908 | Ga0070706_1000689082 | 342 |
| 547 | 3300005471 | Ga0070698_100000844 | Ga0070698_10000084415 | 342 |
| 548 | 3300005518 | Ga0070699_100022461 | Ga0070699_1000224616 | 342 |
| 549 | 3300005536 | Ga0070697_100000201 | Ga0070697_10000020131 | 342 |
| 550 | 3300005548 | Ga0070665_100036789 | Ga0070665_1000367894 | 342 |
| 551 | 3300005548 | Ga0070665_100257302 | Ga0070665_1002573023 | 342 |
| 552 | 3300005563 | Ga0068855_100001118 | Ga0068855_10000111813 | 342 |
| 553 | 3300005577 | Ga0068857_100169737 | Ga0068857_1001697372 | 342 |
| 554 | 3300005578 | Ga0068854_100036124 | Ga0068854_1000361243 | 342 |
| 555 | 3300005834 | Ga0068851_10003172 | Ga0068851_100031726 | 342 |
| 556 | 3300005842 | Ga0068858_100166850 | Ga0068858_1001668501 | 342 |
| 557 | 3300005985 | Ga0081539_10006532 | Ga0081539_100065325 | 342 |
| 558 | 3300006038 | Ga0075365_10002875 | Ga0075365_100028754 | 342 |
| 559 | 3300006051 | Ga0075364_10000276 | Ga0075364_1000027616 | 342 |
| 560 | 3300006186 | Ga0075369_10026420 | Ga0075369_100264202 | 342 |
| 561 | 3300006946 | Ga0079104_1000004 | Ga0079104_100000465 | 342 |
| 562 | 3300009011 | Ga0105251_10000821 | Ga0105251_100008216 | 342 |
| 563 | 3300009092 | Ga0105250_10021928 | Ga0105250_100219282 | 342 |
| 564 | 3300009093 | Ga0105240_10006539 | Ga0105240_1000653913 | 342 |
| 565 | 3300009148 | Ga0105243_10000196 | Ga0105243_100001962 | 342 |
| 566 | 3300009148 | Ga0105243_10041778 | Ga0105243_100417782 | 342 |
| 567 | 3300009177 | Ga0105248_10044318 | Ga0105248_100443186 | 342 |
| 568 | 3300009545 | Ga0105237_10000010 | Ga0105237_10000010257 | 342 |
| 569 | 3300009545 | Ga0105237_10000850 | Ga0105237_100008506 | 342 |
| 570 | 3300009551 | Ga0105238_10007711 | Ga0105238_1000771112 | 342 |
| 571 | 3300010375 | Ga0105239_10002448 | Ga0105239_100024486 | 342 |
| 572 | 3300013102 | Ga0157371_10000896 | Ga0157371_1000089613 | 342 |
| 573 | 3300013102 | Ga0157371_10044860 | Ga0157371_100448602 | 342 |
| 574 | 3300013104 | Ga0157370_10018866 | Ga0157370_100188662 | 342 |
| 575 | 3300013306 | Ga0163162_10012665 | Ga0163162_100126653 | 342 |
| 576 | 3300014497 | Ga0182008_10000083 | Ga0182008_1000008344 | 342 |
| 577 | 3300015261 | Ga0182006_1012808 | Ga0182006_10128084 | 342 |
| 578 | 3300015262 | Ga0182007_10000117 | Ga0182007_1000011719 | 342 |
| 579 | 3300015265 | Ga0182005_1000220 | Ga0182005_100022026 | 342 |
| 580 | 3300015265 | Ga0182005_1003904 | Ga0182005_10039043 | 342 |
| 581 | 3300017792 | Ga0163161_10007088 | Ga0163161_100070888 | 342 |
| 582 | 3300017792 | Ga0163161_10049876 | Ga0163161_100498762 | 342 |
| 583 | 3300017792 | Ga0163161_10122805 | Ga0163161_101228052 | 342 |
| 584 | 3300020075 | Ga0206349_1540627 | Ga0206349_15406271 | 342 |
| 585 | 3300021361 | Ga0213872_10046939 | Ga0213872_100469392 | 342 |
| 586 | 3300021361 | Ga0213872_10070055 | Ga0213872_100700551 | 342 |
| 587 | 3300025226 | Ga0209674_100981 | Ga0209674_1009814 | 342 |
| 588 | 3300025233 | Ga0209437_101206 | Ga0209437_1012066 | 342 |
| 589 | 3300025245 | Ga0207425_1000015 | Ga0207425_1000015304 | 342 |
| 590 | 3300025254 | Ga0209148_1002278 | Ga0209148_10022786 | 342 |
| 591 | 3300025258 | Ga0209129_1000131 | Ga0209129_10001311 | 342 |
| 592 | 3300025291 | Ga0209675_1003920 | Ga0209675_10039204 | 342 |
| 593 | 3300025292 | Ga0209676_1000104 | Ga0209676_1000104100 | 342 |
| 594 | 3300025292 | Ga0209676_1000151 | Ga0209676_100015146 | 342 |
| 595 | 3300025292 | Ga0209676_1005600 | Ga0209676_10056003 | 342 |
| 596 | 3300025294 | Ga0209025_1000002 | Ga0209025_10000021202 | 342 |
| 597 | 3300025294 | Ga0209025_1037849 | Ga0209025_10378493 | 342 |
| 598 | 3300025297 | Ga0209758_1000003 | Ga0209758_10000031209 | 342 |
| 599 | 3300025297 | Ga0209758_1020232 | Ga0209758_10202324 | 342 |
| 600 | 3300025298 | Ga0209050_1003203 | Ga0209050_10032036 | 342 |
| 601 | 3300025298 | Ga0209050_1007470 | Ga0209050_10074703 | 342 |
| 602 | 3300025304 | Ga0209257_1000413 | Ga0209257_100041328 | 342 |
| 603 | 3300025304 | Ga0209257_1000434 | Ga0209257_100043439 | 342 |
| 604 | 3300025304 | Ga0209257_1000796 | Ga0209257_100079615 | 342 |
| 605 | 3300025304 | Ga0209257_1002077 | Ga0209257_10020778 | 342 |
| 606 | 3300025321 | Ga0207656_10007972 | Ga0207656_100079722 | 342 |
| 607 | 3300025711 | Ga0207696_1016340 | Ga0207696_10163402 | 342 |
| 608 | 3300025728 | Ga0207655_1044630 | Ga0207655_10446302 | 342 |
| 609 | 3300025728 | Ga0207655_1046046 | Ga0207655_10460462 | 342 |
| 610 | 3300025735 | Ga0207713_1000535 | Ga0207713_10005355 | 342 |
| 611 | 3300025735 | Ga0207713_1011252 | Ga0207713_10112523 | 342 |
| 612 | 3300025904 | Ga0207647_10004266 | Ga0207647_100042668 | 342 |
| 613 | 3300025914 | Ga0207671_10000013 | Ga0207671_10000013136 | 342 |
| 614 | 3300025925 | Ga0207650_10109287 | Ga0207650_101092873 | 342 |
| 615 | 3300025935 | Ga0207709_10000019 | Ga0207709_10000019177 | 342 |
| 616 | 3300025935 | Ga0207709_10000954 | Ga0207709_1000095412 | 342 |
| 617 | 3300025935 | Ga0207709_10001101 | Ga0207709_100011018 | 342 |
| 618 | 3300025949 | Ga0207667_10000047 | Ga0207667_1000004730 | 342 |
| 619 | 3300025972 | Ga0207668_10098422 | Ga0207668_100984222 | 342 |
| 620 | 3300025981 | Ga0207640_10001091 | Ga0207640_100010914 | 342 |
| 621 | 3300025981 | Ga0207640_10073870 | Ga0207640_100738702 | 342 |
| 622 | 3300026116 | Ga0207674_10069548 | Ga0207674_100695483 | 342 |
| 623 | 3300027111 | Ga0209281_1000005 | Ga0209281_1000005266 | 342 |
| 624 | 3300027312 | Ga0209371_1000031 | Ga0209371_1000031236 | 342 |
| 625 | 3300027312 | Ga0209371_1000256 | Ga0209371_100025615 | 342 |
| 626 | 3300028379 | Ga0268266_10011682 | Ga0268266_100116828 | 342 |
| 627 | 3300028794 | Ga0307515_10033048 | Ga0307515_100330487 | 342 |
| 628 | 3300028800 | Ga0265338_10000713 | Ga0265338_1000071314 | 342 |
| 629 | 3300030500 | Ga0268256_1000034 | Ga0268256_1000034115 | 342 |
| 630 | 3300030500 | Ga0268256_1000216 | Ga0268256_100021648 | 342 |
| 631 | 3300030500 | Ga0268256_1008755 | Ga0268256_10087554 | 342 |
| 632 | 3300030732 | Ga0316176_1150308 | Ga0316176_11503082 | 342 |
| 633 | 3300031456 | Ga0307513_10247978 | Ga0307513_102479782 | 342 |
| 634 | 3300031649 | Ga0307514_10000225 | Ga0307514_1000022560 | 342 |
| 635 | 3300032004 | Ga0307414_10046005 | Ga0307414_100460054 | 342 |
| 636 | 3300037418 | Ga0395900_0075227 | Ga0395900_0075227_1624_2658 | 342 |
| 637 | 3300037466 | Ga0395898_0192565 | Ga0395898_0192565_515_1549 | 342 |
| 638 | 3300038443 | Ga0395901_0000212 | Ga0395901_0000212_31403_32437 | 342 |
| 639 | 3300038443 | Ga0395901_0062253 | Ga0395901_0062253_317_1351 | 342 |
| 640 | 3300038705 | Ga0237819_00007 | Ga0237819_00007_22079_23107 | 342 |
| 641 | 3300039447 | Ga0436361_0648767 | Ga0436361_0648767_107_1135 | 342 |
| 642 | 3300039447 | Ga0436361_1075392 | Ga0436361_1075392_651_1679 | 342 |
| 643 | 3300041452 | Ga0451793_0257911 | Ga0451793_0257911_445_1473 | 342 |
| 644 | 3300041459 | Ga0451800_1301053 | Ga0451800_1301053_2116_3144 | 342 |
| 645 | 3300041462 | Ga0451806_414687 | Ga0451806_414687_547_1575 | 342 |
| 646 | 3300041463 | Ga0451804_0787358 | Ga0451804_0787358_877_1905 | 342 |
| 647 | 3300041486 | Ga0451807_1029248 | Ga0451807_1029248_2815_3843 | 342 |
| 648 | 3300046453 | Ga0495627_012263 | Ga0495627_012263_1110_2138 | 342 |
| 649 | 3300046457 | Ga0495590_0000005 | Ga0495590_0000005_78601_79638 | 342 |
| 650 | 3300046458 | Ga0495591_042630 | Ga0495591_042630_131_1159 | 342 |
| 651 | 3300046460 | Ga0495638_0000349 | Ga0495638_0000349_42750_43787 | 342 |
| 652 | 3300046460 | Ga0495638_0002006 | Ga0495638_0002006_851_1879 | 342 |
| 653 | 3300046463 | Ga0495653_0041454 | Ga0495653_0041454_494_1522 | 342 |
| 654 | 3300046471 | Ga0495650_0004198 | Ga0495650_0004198_7799_8836 | 342 |
| 655 | 3300046471 | Ga0495650_0017063 | Ga0495650_0017063_1045_2088 | 342 |
| 656 | 3300046474 | Ga0495605_0062900 | Ga0495605_0062900_215_1561 | 342 |
| 657 | 3300046501 | Ga0495607_0007029 | Ga0495607_0007029_5819_6847 | 342 |
| 658 | 3300046501 | Ga0495607_0009895 | Ga0495607_0009895_1910_2938 | 342 |
| 659 | 3300046506 | Ga0495583_0000209 | Ga0495583_0000209_2129_3157 | 342 |
| 660 | 3300046506 | Ga0495583_0000995 | Ga0495583_0000995_15990_17027 | 342 |
| 661 | 3300046513 | Ga0495616_0031233 | Ga0495616_0031233_130_1158 | 342 |
| 662 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_331088_332125 | 342 |
| 663 | 3300046524 | Ga0495648_0000375 | Ga0495648_0000375_26134_27162 | 342 |
| 664 | 3300046528 | Ga0495642_0003167 | Ga0495642_0003167_890_1927 | 342 |
| 665 | 3300046537 | Ga0495598_0024486 | Ga0495598_0024486_147_1175 | 342 |
| 666 | 3300046538 | Ga0495609_0044388 | Ga0495609_0044388_576_1613 | 342 |
| 667 | 3300046557 | Ga0495622_0000402 | Ga0495622_0000402_14069_15106 | 342 |
| 668 | 3300046558 | Ga0495633_0000888 | Ga0495633_0000888_21891_22928 | 342 |
| 669 | 3300046558 | Ga0495633_0031307 | Ga0495633_0031307_393_1421 | 342 |
| 670 | 3300046615 | Ga0495656_0016425 | Ga0495656_0016425_1090_2118 | 342 |
| 671 | 3300046616 | Ga0495668_0000719 | Ga0495668_0000719_9433_10470 | 342 |
| 672 | 3300046660 | Ga0495625_0000124 | Ga0495625_0000124_52742_53779 | 342 |
| 673 | 3300046665 | Ga0495661_0064693 | Ga0495661_0064693_88_1116 | 342 |
| 674 | 3300046680 | Ga0495646_0074194 | Ga0495646_0074194_718_1746 | 342 |
| 675 | 3300046684 | Ga0495669_0058797 | Ga0495669_0058797_334_1362 | 342 |
| 676 | 3300046810 | Ga0495660_0000684 | Ga0495660_0000684_8714_9742 | 342 |
| 677 | 3300046810 | Ga0495660_0159541 | Ga0495660_0159541_51_1088 | 342 |
| 678 | 3300047318 | Ga0495636_0030713 | Ga0495636_0030713_864_1892 | 342 |
| 679 | 3300047469 | Ga0495673_0000427 | Ga0495673_0000427_23054_24082 | 342 |
| 680 | 3300047472 | Ga0495686_0040674 | Ga0495686_0040674_1802_2830 | 342 |
| 681 | 3300048088 | Ga0495602_0007375 | Ga0495602_0007375_6534_7562 | 342 |
| 682 | 3300048091 | Ga0495626_0039820 | Ga0495626_0039820_266_1294 | 342 |
| 683 | 3300048905 | Ga0496102_0040630 | Ga0496102_0040630_2422_3456 | 342 |
| 684 | 3300048907 | Ga0496104_0384812 | Ga0496104_0384812_100_1128 | 342 |
| 685 | 3300048908 | Ga0496105_0022937 | Ga0496105_0022937_595_1623 | 342 |
| 686 | 3300048910 | Ga0496107_0016974 | Ga0496107_0016974_793_1821 | 342 |
| 687 | 3300048916 | Ga0496113_0082665 | Ga0496113_0082665_256_1284 | 342 |
| 688 | 3300048918 | Ga0496115_0227974 | Ga0496115_0227974_475_1509 | 342 |
| 689 | 3300048919 | Ga0496116_0007649 | Ga0496116_0007649_8231_9259 | 342 |
| 690 | 3300048919 | Ga0496116_0049894 | Ga0496116_0049894_595_1623 | 342 |
| 691 | 3300048919 | Ga0496116_0171041 | Ga0496116_0171041_38_1066 | 342 |
| 692 | 3300048920 | Ga0496117_0000369 | Ga0496117_0000369_21329_22360 | 342 |
| 693 | 3300048920 | Ga0496117_0000829 | Ga0496117_0000829_17498_18526 | 342 |
| 694 | 3300048920 | Ga0496117_0001338 | Ga0496117_0001338_11587_12648 | 342 |
| 695 | 3300048920 | Ga0496117_0005490 | Ga0496117_0005490_5703_6731 | 342 |
| 696 | 3300048920 | Ga0496117_0009239 | Ga0496117_0009239_7910_8938 | 342 |
| 697 | 3300048920 | Ga0496117_0053757 | Ga0496117_0053757_420_1448 | 342 |
| 698 | 3300048921 | Ga0496118_0000406 | Ga0496118_0000406_17860_18888 | 342 |
| 699 | 3300048921 | Ga0496118_0002325 | Ga0496118_0002325_21566_22594 | 342 |
| 700 | 3300048921 | Ga0496118_0002786 | Ga0496118_0002786_13926_14954 | 342 |
| 701 | 3300048921 | Ga0496118_0016572 | Ga0496118_0016572_5259_6287 | 342 |
| 702 | 3300048921 | Ga0496118_0086813 | Ga0496118_0086813_433_1494 | 342 |
| 703 | 3300048921 | Ga0496118_0147901 | Ga0496118_0147901_431_1459 | 342 |
| 704 | 3300048922 | Ga0496119_0000301 | Ga0496119_0000301_30815_31843 | 342 |
| 705 | 3300048922 | Ga0496119_0006605 | Ga0496119_0006605_2901_3962 | 342 |
| 706 | 3300048923 | Ga0496120_0000402 | Ga0496120_0000402_30815_31843 | 342 |
| 707 | 3300048923 | Ga0496120_0002718 | Ga0496120_0002718_12800_13861 | 342 |
| 708 | 3300048924 | Ga0496121_0002806 | Ga0496121_0002806_3522_4553 | 342 |
| 709 | 3300048924 | Ga0496121_0006928 | Ga0496121_0006928_11967_12995 | 342 |
| 710 | 3300048924 | Ga0496121_0008829 | Ga0496121_0008829_5587_6615 | 342 |
| 711 | 3300048924 | Ga0496121_0098168 | Ga0496121_0098168_521_1549 | 342 |
| 712 | 3300048925 | Ga0496122_0001751 | Ga0496122_0001751_19404_20465 | 342 |
| 713 | 3300048925 | Ga0496122_0011096 | Ga0496122_0011096_293_1321 | 342 |
| 714 | 3300048925 | Ga0496122_0014211 | Ga0496122_0014211_121_1149 | 342 |
| 715 | 3300048925 | Ga0496122_0014373 | Ga0496122_0014373_4503_5543 | 342 |
| 716 | 3300048925 | Ga0496122_0063183 | Ga0496122_0063183_1624_2652 | 342 |
| 717 | 3300048925 | Ga0496122_0077851 | Ga0496122_0077851_921_1949 | 342 |
| 718 | 3300048926 | Ga0496123_0000795 | Ga0496123_0000795_19567_20628 | 342 |
| 719 | 3300048926 | Ga0496123_0004482 | Ga0496123_0004482_5720_6748 | 342 |
| 720 | 3300048926 | Ga0496123_0007554 | Ga0496123_0007554_4503_5534 | 342 |
| 721 | 3300048926 | Ga0496123_0009133 | Ga0496123_0009133_6852_7880 | 342 |
| 722 | 3300048926 | Ga0496123_0014808 | Ga0496123_0014808_4500_5528 | 342 |
| 723 | 3300048927 | Ga0496124_0000034 | Ga0496124_0000034_271277_272305 | 342 |
| 724 | 3300048927 | Ga0496124_0000991 | Ga0496124_0000991_38357_39385 | 342 |
| 725 | 3300048927 | Ga0496124_0002054 | Ga0496124_0002054_2302_3330 | 342 |
| 726 | 3300048927 | Ga0496124_0006990 | Ga0496124_0006990_1856_2884 | 342 |
| 727 | 3300048927 | Ga0496124_0008723 | Ga0496124_0008723_6742_7803 | 342 |
| 728 | 3300048927 | Ga0496124_0016659 | Ga0496124_0016659_1024_2052 | 342 |
| 729 | 3300048927 | Ga0496124_0026942 | Ga0496124_0026942_1867_2895 | 342 |
| 730 | 3300048927 | Ga0496124_0077937 | Ga0496124_0077937_1545_2579 | 342 |
| 731 | 3300048927 | Ga0496124_0202515 | Ga0496124_0202515_122_1150 | 342 |
| 732 | 3300048928 | Ga0496125_0000044 | Ga0496125_0000044_168764_169795 | 342 |
| 733 | 3300048928 | Ga0496125_0002163 | Ga0496125_0002163_15729_16757 | 342 |
| 734 | 3300048928 | Ga0496125_0003842 | Ga0496125_0003842_8844_9872 | 342 |
| 735 | 3300048928 | Ga0496125_0007703 | Ga0496125_0007703_9164_10192 | 342 |
| 736 | 3300048928 | Ga0496125_0028908 | Ga0496125_0028908_953_2020 | 342 |
| 737 | 3300048928 | Ga0496125_0034756 | Ga0496125_0034756_463_1491 | 342 |
| 738 | 3300048929 | Ga0496126_0001069 | Ga0496126_0001069_9497_10525 | 342 |
| 739 | 3300048929 | Ga0496126_0006225 | Ga0496126_0006225_648_1715 | 342 |
| 740 | 3300048929 | Ga0496126_0025860 | Ga0496126_0025860_573_1601 | 342 |
| 741 | 3300048929 | Ga0496126_0066238 | Ga0496126_0066238_307_1335 | 342 |
| 742 | 3300048929 | Ga0496126_0079199 | Ga0496126_0079199_214_1455 | 342 |
| 743 | 3300049568 | Ga0501031_0040572 | Ga0501031_0040572_384_1412 | 342 |
| 744 | 3300049571 | Ga0501034_0000798 | Ga0501034_0000798_833_1861 | 342 |
| 745 | 3300049581 | Ga0501047_0402763 | Ga0501047_0402763_53_1087 | 342 |
| 746 | 3300050491 | nmdc:mga00v17_308_c1 | nmdc:mga00v17_308_c1_14599_15627 | 342 |
| 747 | 3300050491 | nmdc:mga00v17_47857_c1 | nmdc:mga00v17_47857_c1_1190_2218 | 342 |
| 748 | 3300050492 | nmdc:mga0yw44_17954_c1 | nmdc:mga0yw44_17954_c1_39_1067 | 342 |
| 749 | 3300050516 | nmdc:mga0sz30_15652_c1 | nmdc:mga0sz30_15652_c1_1270_2304 | 342 |
| 750 | 3300053088 | Ga0500644_0000306 | Ga0500644_0000306_3491_4519 | 342 |
| 751 | 3300053125 | Ga0500618_001158 | Ga0500618_001158_11099_12130 | 342 |
| 752 | iso_pu_bacteria | 2883087390 | 2883089541 | 342 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z6k-assembly1.cif.gz_B | alcohol dehydrogenase from the antarctic psychrophile moraxella sp. tae 123 | 0.9923 | 5 | 341 |
| 6iqd-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus | 0.9902 | 5 | 340 |
| 3s2i-assembly2.cif.gz_H | crystal structure of furx nadh+:furfuryl alcohol ii | 0.9898 | 4 | 342 |
| 6iqd-assembly1.cif.gz_A | crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus | 0.9873 | 5 | 340 |
| 1llu-assembly1.cif.gz_A | the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate | 0.987 | 1 | 340 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lluA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9971 | 152 | 289 | 3.40.50.720 |
| 4gkvA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9944 | 154 | 289 | 3.40.50.720 |
| 1lluA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9899 | 152 | 289 | 3.40.50.720 |
| 1rjwC01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9897 | 5 | 341 | 3.90.180.10 |
| af_P00332_5_156_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9838 | 4 | 152 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-M5D5M4-F1-model_v4 | deleted | 0.9974 | 92 | 342 |
|
| AF-M5D5M4-F1-model_v4 | deleted | 0.9935 | 92 | 342 |
|
| AF-A0A0K1Q3C7-F1-model_v4 | alcohol dehydrogenase (EC 1.1.1.1) | 0.9914 | 2 | 340 |
GO:0008270
GO:0016491 |
| AF-A0A812YKR7-F1-model_v4 | deleted | 0.9906 | 1 | 342 |
|
| AF-A0A3D5EPX3-F1-model_v4 | Zinc-dependent alcohol dehydrogenase | 0.9901 | 5 | 135 |
GO:0008270
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar