F479036

General Info

Members Datasets Scaffolds Average Seq Length
750 298 1500 135

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100926617|Ga0068862_1009266171
Length 156
Sequence MAKPTLPRPTDGELAILRVLWARGPSTVRQVHEVLSRERSAAYTTSLKLLQIMTEKGLVRRDDTDRSHIYQARMSEAQTQRQLVRDLLDRAFGGSASKLVMQALASRRSTPEELGQIRRLLDARPTRPTADAQSDDPDQSAARDRRAVPEDDNEHD

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
187 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
198 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
199 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
200 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
205 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
235 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
261 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
262 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
263 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
264 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
265 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
266 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
272 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
291 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
295 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
296 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 2.67
Rhizosphere 95.07
Stem 0
Stem Tuber 0
Unclassified 18.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100926617 3300005844 Unclassified 858
2 JGI24749J21850_1057165 3300002076 Bacteria 588
3 JGI24035J26624_1004246 3300002126 Bacteria 1359
4 JGI24751J29686_10042113 3300002459 Bacteria 944
5 Ga0065704_10188068 3300005289 Bacteria 1203
6 Ga0065712_10010373 3300005290 Bacteria 2831
7 Ga0065712_10074188 3300005290 Bacteria 4160
8 Ga0065712_10107532 3300005290 Unclassified 1893
9 Ga0065712_10109816 3300005290 Bacteria 1849
10 Ga0065712_10226494 3300005290 Bacteria 1025
11 Ga0065715_10092420 3300005293 Bacteria 5136
12 Ga0065715_10108963 3300005293 Bacteria 2692
13 Ga0065715_10132106 3300005293 Bacteria 1996
14 Ga0065715_10143495 3300005293 Bacteria 1819
15 Ga0065715_10166556 3300005293 Bacteria 1582
16 Ga0065715_10242347 3300005293 Bacteria 1195
17 Ga0065715_10245548 3300005293 Bacteria 1184
18 Ga0065715_10329345 3300005293 Bacteria 987
19 Ga0065715_10525244 3300005293 Bacteria 760
20 Ga0065707_10054504 3300005295 Bacteria 795
21 Ga0065707_10188151 3300005295 Bacteria 1374
22 Ga0065707_10840234 3300005295 Unclassified 586
23 Ga0065707_10993878 3300005295 Bacteria 541
24 Ga0070676_10935768 3300005328 Bacteria 647
25 Ga0070676_11045043 3300005328 Unclassified 615
26 Ga0070683_100000939 3300005329 Bacteria 21677
27 Ga0070683_100492805 3300005329 Bacteria 1170
28 Ga0070683_102217438 3300005329 Bacteria 527
29 Ga0070690_100539228 3300005330 Bacteria 878
30 Ga0070670_100005461 3300005331 Bacteria 10723
31 Ga0070670_100012354 3300005331 Bacteria 7307
32 Ga0070670_100019937 3300005331 Bacteria 5756
33 Ga0070670_100058304 3300005331 Bacteria 3315
34 Ga0070670_100524721 3300005331 Bacteria 1055
35 Ga0070670_101093648 3300005331 Unclassified 727
36 Ga0070677_10393166 3300005333 Unclassified 729
37 Ga0068869_100027185 3300005334 Bacteria 3987
38 Ga0068869_100766457 3300005334 Bacteria 827
39 Ga0068869_101543207 3300005334 Bacteria 590
40 Ga0070666_10496765 3300005335 Bacteria 884
41 Ga0070660_100646130 3300005339 Bacteria 886
42 Ga0070660_101536515 3300005339 Bacteria 566
43 Ga0070689_100586419 3300005340 Bacteria 964
44 Ga0070689_101440495 3300005340 Unclassified 623
45 Ga0070687_100058738 3300005343 Bacteria 2022
46 Ga0070687_101016370 3300005343 Bacteria 602
47 Ga0070661_100017984 3300005344 Bacteria 5021
48 Ga0070661_100960934 3300005344 Bacteria 707
49 Ga0070668_100708768 3300005347 Bacteria 888
50 Ga0070668_101743218 3300005347 Bacteria 572
51 Ga0070669_100000640 3300005353 Bacteria 25921
52 Ga0070669_100038093 3300005353 Bacteria 3489
53 Ga0070669_100306412 3300005353 Unclassified 1279
54 Ga0070669_100516599 3300005353 Bacteria 992
55 Ga0070669_100774964 3300005353 Bacteria 814
56 Ga0070675_100012442 3300005354 Bacteria 6666
57 Ga0070675_100123911 3300005354 Bacteria 2198
58 Ga0070675_100156959 3300005354 Bacteria 1954
59 Ga0070675_100443255 3300005354 Unclassified 1164
60 Ga0070671_100020992 3300005355 Bacteria 5329
61 Ga0070671_100224982 3300005355 Bacteria 1592
62 Ga0070674_100007364 3300005356 Bacteria 6489
63 Ga0070674_100012596 3300005356 Bacteria 5196
64 Ga0070674_100017961 3300005356 Bacteria 4461
65 Ga0070674_100056579 3300005356 Bacteria 2720
66 Ga0070674_100294147 3300005356 Bacteria 1292
67 Ga0070674_101146264 3300005356 Bacteria 688
68 Ga0070673_100055450 3300005364 Bacteria 3123
69 Ga0070673_100074251 3300005364 Bacteria 2740
70 Ga0070673_100480071 3300005364 Bacteria 1122
71 Ga0070673_101182195 3300005364 Bacteria 716
72 Ga0070688_100000001 3300005365 Bacteria 106331
73 Ga0070688_100252970 3300005365 Unclassified 1255
74 Ga0070688_100258342 3300005365 Unclassified 1243
75 Ga0070688_100463391 3300005365 Bacteria 950
76 Ga0070659_100187638 3300005366 Bacteria 1698
77 Ga0070659_100257300 3300005366 Bacteria 1448
78 Ga0070667_100038168 3300005367 Bacteria 4027
79 Ga0070710_10445075 3300005437 Bacteria 877
80 Ga0070711_100149144 3300005439 Bacteria 1761
81 Ga0070700_100072094 3300005441 Bacteria 2207
82 Ga0070708_100315125 3300005445 Bacteria 1473
83 Ga0070663_100033044 3300005455 Bacteria 3571
84 Ga0070663_101225214 3300005455 Bacteria 660
85 Ga0070678_100341186 3300005456 Bacteria 1285
86 Ga0070678_100345925 3300005456 Bacteria 1277
87 Ga0070662_100075017 3300005457 Bacteria 2504
88 Ga0070662_100112842 3300005457 Bacteria 2073
89 Ga0070662_100610189 3300005457 Bacteria 918
90 Ga0070662_100740605 3300005457 Unclassified 833
91 Ga0070662_100819355 3300005457 Bacteria 792
92 Ga0070681_10624603 3300005458 Unclassified 992
93 Ga0070681_11117351 3300005458 Unclassified 709
94 Ga0068867_100293150 3300005459 Bacteria 1338
95 Ga0068867_100342994 3300005459 Bacteria 1244
96 Ga0068867_100351987 3300005459 Unclassified 1229
97 Ga0068867_100422808 3300005459 Unclassified 1129
98 Ga0070685_10232584 3300005466 Bacteria 1213
99 Ga0070685_11339600 3300005466 Bacteria 548
100 Ga0070706_100818738 3300005467 Bacteria 862
101 Ga0070706_101791910 3300005467 Bacteria 558
102 Ga0070707_100630723 3300005468 Bacteria 1034
103 Ga0070699_100654934 3300005518 Bacteria 959
104 Ga0070679_100288139 3300005530 Bacteria 1594
105 Ga0070679_101215420 3300005530 Bacteria 699
106 Ga0070684_100000048 3300005535 Bacteria 80061
107 Ga0070684_100864405 3300005535 Bacteria 847
108 Ga0070684_101290296 3300005535 Bacteria 687
109 Ga0070697_100808491 3300005536 Bacteria 830
110 Ga0070697_100846286 3300005536 Bacteria 810
111 Ga0068853_100494343 3300005539 Unclassified 1154
112 Ga0070672_100113277 3300005543 Bacteria 2214
113 Ga0070672_100155076 3300005543 Bacteria 1896
114 Ga0070686_100320946 3300005544 Bacteria 1155
115 Ga0070686_101378299 3300005544 Bacteria 591
116 Ga0070696_100060433 3300005546 Unclassified 2650
117 Ga0070696_100893433 3300005546 Bacteria 737
118 Ga0070693_101066833 3300005547 Unclassified 614
119 Ga0070704_100198648 3300005549 Unclassified 1617
120 Ga0070704_100654447 3300005549 Bacteria 928
121 Ga0070704_100689484 3300005549 Bacteria 905
122 Ga0068855_100223100 3300005563 Bacteria 2112
123 Ga0068855_100424330 3300005563 Bacteria 1454
124 Ga0068855_100435729 3300005563 Bacteria 1432
125 Ga0070664_100001386 3300005564 Bacteria 19315
126 Ga0070664_100005301 3300005564 Bacteria 10344
127 Ga0070664_100157472 3300005564 Bacteria 2007
128 Ga0070664_100925275 3300005564 Unclassified 818
129 Ga0068857_100080311 3300005577 Bacteria 2912
130 Ga0068857_100218069 3300005577 Bacteria 1742
131 Ga0068857_100865535 3300005577 Unclassified 865
132 Ga0068857_101103994 3300005577 Bacteria 766
133 Ga0068857_101698798 3300005577 Unclassified 617
134 Ga0068854_100656381 3300005578 Bacteria 901
135 Ga0068856_100129611 3300005614 Bacteria 2527
136 Ga0068856_100395952 3300005614 Bacteria 1401
137 Ga0070702_101393152 3300005615 Bacteria 573
138 Ga0068852_100156401 3300005616 Bacteria 2124
139 Ga0068852_101121175 3300005616 Bacteria 807
140 Ga0068859_100144038 3300005617 Bacteria 2457
141 Ga0068859_100567338 3300005617 Bacteria 1229
142 Ga0068859_100650269 3300005617 Bacteria 1146
143 Ga0068859_100985832 3300005617 Bacteria 925
144 Ga0068864_100031679 3300005618 Bacteria 4488
145 Ga0068864_100122814 3300005618 Bacteria 2324
146 Ga0068864_100312704 3300005618 Bacteria 1473
147 Ga0068864_100398633 3300005618 Bacteria 1307
148 Ga0068864_100621130 3300005618 Bacteria 1050
149 Ga0068864_100877227 3300005618 Unclassified 885
150 Ga0068864_102074786 3300005618 Unclassified 575
151 Ga0068866_10716139 3300005718 Unclassified 688
152 Ga0068861_100941369 3300005719 Unclassified 821
153 Ga0068861_100942746 3300005719 Unclassified 820
154 Ga0068861_101061165 3300005719 Bacteria 777
155 Ga0068861_101104368 3300005719 Bacteria 762
156 Ga0068870_10159261 3300005840 Bacteria 1337
157 Ga0068863_100323622 3300005841 Unclassified 1498
158 Ga0068863_100656979 3300005841 Unclassified 1040
159 Ga0068863_100701776 3300005841 Bacteria 1006
160 Ga0068860_101658242 3300005843 Unclassified 661
161 Ga0068862_100081244 3300005844 Bacteria 2812
162 Ga0068862_100674526 3300005844 Bacteria 999
163 Ga0068862_100767430 3300005844 Unclassified 939
164 Ga0068862_100982016 3300005844 Unclassified 834
165 Ga0068862_101785160 3300005844 Bacteria 624
166 Ga0081455_10255746 3300005937 Bacteria 1278
167 Ga0081539_10176618 3300005985 Bacteria 1005
168 Ga0070717_10163599 3300006028 Bacteria 1932
169 Ga0075365_10084812 3300006038 Bacteria 2151
170 Ga0075365_11027455 3300006038 Bacteria 581
171 Ga0075364_10268687 3300006051 Bacteria 1160
172 Ga0075367_10080234 3300006178 Unclassified 1973
173 Ga0075366_10056562 3300006195 Bacteria 2330
174 Ga0097621_100389214 3300006237 Unclassified 1246
175 Ga0097621_100654251 3300006237 Unclassified 964
176 Ga0068871_100487732 3300006358 Unclassified 1109
177 Ga0075428_100000520 3300006844 Bacteria 39099
178 Ga0075428_100002296 3300006844 Bacteria 20691
179 Ga0075428_100801400 3300006844 Unclassified 1001
180 Ga0075430_100004527 3300006846 Bacteria 11709
181 Ga0075430_100014823 3300006846 Bacteria 6637
182 Ga0075430_100065100 3300006846 Bacteria 3062
183 Ga0075430_100089916 3300006846 Bacteria 2569
184 Ga0075430_100405513 3300006846 Bacteria 1125
185 Ga0075430_101371716 3300006846 Bacteria 581
186 Ga0075431_100011125 3300006847 Bacteria 9058
187 Ga0075431_100015718 3300006847 Bacteria 7674
188 Ga0075431_100016362 3300006847 Bacteria 7526
189 Ga0075431_100022830 3300006847 Bacteria 6396
190 Ga0075431_100390681 3300006847 Bacteria 1394
191 Ga0075431_100449009 3300006847 Bacteria 1285
192 Ga0075431_100853143 3300006847 Bacteria 882
193 Ga0075431_101096054 3300006847 Unclassified 761
194 Ga0075431_101101076 3300006847 Unclassified 759
195 Ga0075431_101553683 3300006847 Bacteria 620
196 Ga0075433_10132705 3300006852 Bacteria 2213
197 Ga0075433_10208613 3300006852 Bacteria 1736
198 Ga0075433_10267833 3300006852 Bacteria 1514
199 Ga0075433_10349397 3300006852 Bacteria 1307
200 Ga0075433_10705027 3300006852 Bacteria 884
201 Ga0075433_10841096 3300006852 Bacteria 801
202 Ga0075433_10928360 3300006852 Bacteria 759
203 Ga0075434_100004925 3300006871 Bacteria 12101
204 Ga0075434_100016444 3300006871 Bacteria 7112
205 Ga0075434_100097663 3300006871 Bacteria 2942
206 Ga0075434_100201108 3300006871 Bacteria 2012
207 Ga0075434_100429619 3300006871 Bacteria 1342
208 Ga0075434_100717381 3300006871 Bacteria 1017
209 Ga0075434_100796613 3300006871 Unclassified 961
210 Ga0075429_100010905 3300006880 Bacteria 7862
211 Ga0075429_100448428 3300006880 Bacteria 1131
212 Ga0075429_100533179 3300006880 Unclassified 1029
213 Ga0075429_100699234 3300006880 Bacteria 888
214 Ga0075429_101183260 3300006880 Bacteria 667
215 Ga0075429_101256108 3300006880 Unclassified 646
216 Ga0075436_100206186 3300006914 Bacteria 1393
217 Ga0075436_100472663 3300006914 Bacteria 915
218 Ga0075436_100880216 3300006914 Bacteria 669
219 Ga0097620_100144041 3300006931 Bacteria 2457
220 Ga0097620_100567254 3300006931 Bacteria 1229
221 Ga0097620_100650308 3300006931 Bacteria 1146
222 Ga0097620_100985664 3300006931 Bacteria 925
223 Ga0075435_100124766 3300007076 Bacteria 2151
224 Ga0075435_100810288 3300007076 Bacteria 815
225 Ga0075435_102000765 3300007076 Bacteria 509
226 Ga0105240_10026707 3300009093 Bacteria 7572
227 Ga0105240_10527088 3300009093 Bacteria 1310
228 Ga0105240_11830749 3300009093 Unclassified 632
229 Ga0111539_10012965 3300009094 Bacteria 10431
230 Ga0111539_10013620 3300009094 Bacteria 10159
231 Ga0111539_10028907 3300009094 Bacteria 6759
232 Ga0111539_10033462 3300009094 Bacteria 6239
233 Ga0111539_10040925 3300009094 Bacteria 5576
234 Ga0111539_10080555 3300009094 Bacteria 3830
235 Ga0111539_10198109 3300009094 Unclassified 2343
236 Ga0111539_10272335 3300009094 Bacteria 1971
237 Ga0111539_10381405 3300009094 Bacteria 1641
238 Ga0111539_10640022 3300009094 Bacteria 1238
239 Ga0111539_11019758 3300009094 Unclassified 962
240 Ga0111539_11361790 3300009094 Unclassified 823
241 Ga0111539_13388587 3300009094 Bacteria 513
242 Ga0105245_10584951 3300009098 Bacteria 1141
243 Ga0105245_11302776 3300009098 Bacteria 775
244 Ga0114129_10000054 3300009147 Bacteria 99951
245 Ga0114129_10001555 3300009147 Bacteria 31143
246 Ga0114129_10008035 3300009147 Bacteria 15031
247 Ga0114129_10009389 3300009147 Bacteria 13944
248 Ga0114129_10022451 3300009147 Bacteria 8959
249 Ga0114129_10036053 3300009147 Bacteria 6986
250 Ga0114129_10135438 3300009147 Bacteria 3380
251 Ga0114129_10316388 3300009147 Bacteria 2076
252 Ga0114129_11245257 3300009147 Unclassified 925
253 Ga0105243_10279414 3300009148 Bacteria 1503
254 Ga0105242_11553830 3300009176 Bacteria 694
255 Ga0105242_12421609 3300009176 Unclassified 572
256 Ga0105248_10053649 3300009177 Bacteria 4523
257 Ga0105237_10000005 3300009545 Bacteria 390765
258 Ga0105249_10001107 3300009553 Bacteria 23944
259 Ga0105249_10126340 3300009553 Bacteria 2436
260 Ga0105249_10193899 3300009553 Bacteria 1984
261 Ga0105249_10280522 3300009553 Bacteria 1664
262 Ga0105249_10696053 3300009553 Bacteria 1076
263 Ga0105239_10933858 3300010375 Bacteria 996
264 Ga0105246_10300503 3300011119 Bacteria 1296
265 Ga0105246_10636841 3300011119 Bacteria 926
266 Ga0105246_11429401 3300011119 Unclassified 646
267 Ga0157370_10517950 3300013104 Bacteria 1095
268 Ga0157370_11335971 3300013104 Bacteria 646
269 Ga0157378_10393735 3300013297 Bacteria 1363
270 Ga0163162_10575253 3300013306 Bacteria 1254
271 Ga0163162_11213589 3300013306 Unclassified 856
272 Ga0157372_10160878 3300013307 Bacteria 2595
273 Ga0157372_12767016 3300013307 Bacteria 563
274 Ga0157375_10364025 3300013308 Bacteria 1612
275 Ga0157375_10638988 3300013308 Bacteria 1221
276 Ga0163163_10025043 3300014325 Bacteria 5684
277 Ga0163163_10146312 3300014325 Bacteria 2407
278 Ga0163163_10418853 3300014325 Bacteria 1398
279 Ga0163163_10814960 3300014325 Bacteria 997
280 Ga0163163_10835070 3300014325 Bacteria 985
281 Ga0157380_10016499 3300014326 Bacteria 5448
282 Ga0157380_10040108 3300014326 Bacteria 3645
283 Ga0157380_10206831 3300014326 Unclassified 1746
284 Ga0157380_10296523 3300014326 Bacteria 1487
285 Ga0157380_10343484 3300014326 Bacteria 1393
286 Ga0157380_10478297 3300014326 Bacteria 1204
287 Ga0157380_10488518 3300014326 Bacteria 1193
288 Ga0157380_11224269 3300014326 Bacteria 795
289 Ga0157380_11992542 3300014326 Bacteria 642
290 Ga0157377_10480920 3300014745 Bacteria 864
291 Ga0157379_10243376 3300014968 Bacteria 1632
292 Ga0157376_10645153 3300014969 Bacteria 1058
293 Ga0157376_10836745 3300014969 Bacteria 935
294 Ga0163161_11139491 3300017792 Bacteria 672
295 Ga0206356_10739370 3300020070 Bacteria 1350
296 Ga0213875_10583335 3300021388 Unclassified 540
297 Ga0207666_1033937 3300025271 Bacteria 788
298 Ga0207673_1002362 3300025290 Bacteria 2148
299 Ga0207697_10000562 3300025315 Bacteria 21053
300 Ga0207697_10039988 3300025315 Bacteria 1925
301 Ga0207697_10118845 3300025315 Bacteria 1136
302 Ga0207697_10404188 3300025315 Bacteria 606
303 Ga0207688_10008149 3300025901 Bacteria 5695
304 Ga0207699_10870892 3300025906 Bacteria 664
305 Ga0207643_10149407 3300025908 Bacteria 1400
306 Ga0207643_10690430 3300025908 Bacteria 659
307 Ga0207707_10212861 3300025912 Bacteria 1683
308 Ga0207707_10538667 3300025912 Bacteria 993
309 Ga0207695_10113377 3300025913 Bacteria 2687
310 Ga0207695_11176770 3300025913 Bacteria 647
311 Ga0207671_10000005 3300025914 Bacteria 844816
312 Ga0207663_10133171 3300025916 Bacteria 1721
313 Ga0207663_10385582 3300025916 Bacteria 1068
314 Ga0207660_10217846 3300025917 Bacteria 1497
315 Ga0207660_10548231 3300025917 Bacteria 940
316 Ga0207662_10289112 3300025918 Bacteria 1087
317 Ga0207662_10675011 3300025918 Bacteria 723
318 Ga0207662_11259803 3300025918 Bacteria 525
319 Ga0207657_10459001 3300025919 Bacteria 999
320 Ga0207649_10045935 3300025920 Bacteria 2680
321 Ga0207649_10396374 3300025920 Bacteria 1032
322 Ga0207652_10199650 3300025921 Bacteria 1800
323 Ga0207652_10573576 3300025921 Bacteria 1013
324 Ga0207652_10908373 3300025921 Bacteria 778
325 Ga0207646_10571457 3300025922 Unclassified 1016
326 Ga0207646_10734002 3300025922 Unclassified 882
327 Ga0207681_10061288 3300025923 Bacteria 2585
328 Ga0207681_10103533 3300025923 Bacteria 2057
329 Ga0207681_10105402 3300025923 Bacteria 2041
330 Ga0207681_10347207 3300025923 Bacteria 1187
331 Ga0207681_10695137 3300025923 Bacteria 845
332 Ga0207681_11136497 3300025923 Unclassified 656
333 Ga0207650_10009288 3300025925 Bacteria 6720
334 Ga0207650_10018077 3300025925 Bacteria 4942
335 Ga0207650_10033926 3300025925 Bacteria 3700
336 Ga0207650_10078668 3300025925 Bacteria 2495
337 Ga0207650_10104821 3300025925 Bacteria 2182
338 Ga0207650_10143523 3300025925 Bacteria 1879
339 Ga0207659_10019135 3300025926 Bacteria 4500
340 Ga0207659_10046805 3300025926 Bacteria 3057
341 Ga0207659_10179000 3300025926 Bacteria 1678
342 Ga0207659_10289053 3300025926 Unclassified 1343
343 Ga0207687_10287450 3300025927 Bacteria 1320
344 Ga0207700_11922781 3300025928 Bacteria 518
345 Ga0207644_10010224 3300025931 Bacteria 6185
346 Ga0207644_10210763 3300025931 Bacteria 1536
347 Ga0207690_10036943 3300025932 Bacteria 3167
348 Ga0207690_10221704 3300025932 Bacteria 1447
349 Ga0207706_10104082 3300025933 Bacteria 2497
350 Ga0207706_10138030 3300025933 Bacteria 2145
351 Ga0207706_10428785 3300025933 Bacteria 1145
352 Ga0207706_10685106 3300025933 Unclassified 876
353 Ga0207670_10000012 3300025936 Bacteria 246808
354 Ga0207670_10501601 3300025936 Bacteria 985
355 Ga0207670_11265952 3300025936 Bacteria 625
356 Ga0207669_10009914 3300025937 Bacteria 4562
357 Ga0207669_10035499 3300025937 Bacteria 2838
358 Ga0207669_10190093 3300025937 Bacteria 1480
359 Ga0207669_10446103 3300025937 Bacteria 1024
360 Ga0207669_10482526 3300025937 Bacteria 988
361 Ga0207691_10111639 3300025940 Bacteria 2430
362 Ga0207711_10128096 3300025941 Bacteria 2273
363 Ga0207689_10278239 3300025942 Bacteria 1386
364 Ga0207661_10006992 3300025944 Bacteria 8002
365 Ga0207661_10437818 3300025944 Bacteria 1189
366 Ga0207679_10000474 3300025945 Bacteria 28242
367 Ga0207679_10094445 3300025945 Bacteria 2322
368 Ga0207679_10126330 3300025945 Bacteria 2044
369 Ga0207679_10829122 3300025945 Unclassified 844
370 Ga0207679_11111315 3300025945 Bacteria 725
371 Ga0207679_11212502 3300025945 Bacteria 693
372 Ga0207667_10215279 3300025949 Bacteria 1969
373 Ga0207651_10127867 3300025960 Bacteria 1939
374 Ga0207651_10324101 3300025960 Bacteria 1289
375 Ga0207651_10412993 3300025960 Bacteria 1150
376 Ga0207651_10912761 3300025960 Bacteria 782
377 Ga0207712_10008658 3300025961 Bacteria 6436
378 Ga0207712_10424269 3300025961 Bacteria 1123
379 Ga0207712_10655869 3300025961 Bacteria 912
380 Ga0207712_10816772 3300025961 Bacteria 820
381 Ga0207668_10363023 3300025972 Bacteria 1214
382 Ga0207668_10519924 3300025972 Bacteria 1027
383 Ga0207640_11693854 3300025981 Bacteria 571
384 Ga0207658_10034043 3300025986 Bacteria 3638
385 Ga0207677_10058401 3300026023 Bacteria 2656
386 Ga0207678_10127405 3300026067 Bacteria 2171
387 Ga0207678_10504503 3300026067 Bacteria 1055
388 Ga0207678_10786584 3300026067 Bacteria 840
389 Ga0207678_11246057 3300026067 Unclassified 658
390 Ga0207708_10197779 3300026075 Bacteria 1603
391 Ga0207702_10379381 3300026078 Bacteria 1359
392 Ga0207641_10196907 3300026088 Unclassified 1855
393 Ga0207641_10536658 3300026088 Unclassified 1139
394 Ga0207641_10758642 3300026088 Unclassified 958
395 Ga0207648_10175151 3300026089 Bacteria 1897
396 Ga0207648_10333435 3300026089 Bacteria 1365
397 Ga0207676_10030382 3300026095 Bacteria 4056
398 Ga0207676_10050363 3300026095 Bacteria 3247
399 Ga0207676_10614841 3300026095 Bacteria 1045
400 Ga0207676_10756636 3300026095 Bacteria 945
401 Ga0207674_10018733 3300026116 Bacteria 7514
402 Ga0207674_10040838 3300026116 Bacteria 4802
403 Ga0207674_10837129 3300026116 Bacteria 887
404 Ga0207675_100063450 3300026118 Bacteria 3451
405 Ga0207675_100389765 3300026118 Bacteria 1371
406 Ga0207675_100589364 3300026118 Bacteria 1114
407 Ga0207675_100628323 3300026118 Bacteria 1079
408 Ga0207683_10081895 3300026121 Bacteria 2866
409 Ga0207683_11125970 3300026121 Bacteria 728
410 Ga0207698_11287927 3300026142 Bacteria 745
411 Ga0207698_11676702 3300026142 Bacteria 651
412 Ga0209983_1053485 3300027665 Bacteria 886
413 Ga0209813_10109701 3300027866 Unclassified 949
414 Ga0207428_10012989 3300027907 Bacteria 7294
415 Ga0207428_10080421 3300027907 Bacteria 2546
416 Ga0207428_10127844 3300027907 Unclassified 1945
417 Ga0207428_10173342 3300027907 Bacteria 1633
418 Ga0207428_10278374 3300027907 Unclassified 1242
419 Ga0207428_10310054 3300027907 Bacteria 1167
420 Ga0207428_10364586 3300027907 Bacteria 1062
421 Ga0207428_10369136 3300027907 Bacteria 1054
422 Ga0207428_10472735 3300027907 Bacteria 912
423 Ga0268265_10034800 3300028380 Unclassified 3675
424 Ga0268265_10355794 3300028380 Unclassified 1339
425 Ga0268265_12429260 3300028380 Bacteria 530
426 Ga0268264_11478600 3300028381 Bacteria 690
427 Ga0307408_100073266 3300031548 Bacteria 2538
428 Ga0307408_100075398 3300031548 Bacteria 2506
429 Ga0307408_100539399 3300031548 Unclassified 1028
430 Ga0307405_10154614 3300031731 Bacteria 1617
431 Ga0307413_10152548 3300031824 Bacteria 1612
432 Ga0307413_10337099 3300031824 Bacteria 1158
433 Ga0307413_10386463 3300031824 Bacteria 1092
434 Ga0307413_11019936 3300031824 Unclassified 710
435 Ga0307410_10057906 3300031852 Bacteria 2640
436 Ga0307410_10645396 3300031852 Bacteria 887
437 Ga0307410_10665655 3300031852 Bacteria 875
438 Ga0307406_10168412 3300031901 Bacteria 1583
439 Ga0307406_10607144 3300031901 Bacteria 903
440 Ga0307407_10027108 3300031903 Bacteria 3044
441 Ga0307407_10102945 3300031903 Bacteria 1776
442 Ga0307407_10874673 3300031903 Unclassified 688
443 Ga0307412_10318765 3300031911 Bacteria 1236
444 Ga0307412_10350797 3300031911 Unclassified 1185
445 Ga0307412_11096562 3300031911 Unclassified 708
446 Ga0307412_11214941 3300031911 Bacteria 675
447 Ga0307409_100008282 3300031995 Bacteria 6299
448 Ga0307409_100357855 3300031995 Bacteria 1380
449 Ga0307409_100638018 3300031995 Bacteria 1057
450 Ga0307409_101168944 3300031995 Bacteria 792
451 Ga0307409_101296049 3300031995 Bacteria 753
452 Ga0307416_100015376 3300032002 Bacteria 5285
453 Ga0307416_100224977 3300032002 Bacteria 1803
454 Ga0307416_101065059 3300032002 Bacteria 913
455 Ga0307414_10047065 3300032004 Bacteria 2966
456 Ga0307414_10055745 3300032004 Bacteria 2769
457 Ga0307414_10525680 3300032004 Bacteria 1050
458 Ga0307414_11241109 3300032004 Bacteria 691
459 Ga0307411_10349270 3300032005 Bacteria 1205
460 Ga0307411_10595408 3300032005 Bacteria 950
461 Ga0307411_11291641 3300032005 Unclassified 665
462 Ga0307415_100044333 3300032126 Bacteria 2973
463 Ga0307415_100769124 3300032126 Bacteria 876
464 Ga0307415_101301935 3300032126 Unclassified 688
465 Ga0373928_0183201 3300035084 Unclassified 596
466 Ga0373936_0390566 3300035113 Unclassified 638
467 Ga0373943_0169411 3300035170 Bacteria 1194
468 Ga0373943_0196787 3300035170 Bacteria 1114
469 Ga0373955_0096480 3300035172 Bacteria 1692
470 Ga0373962_0397588 3300035242 Archaea 506
471 Ga0373931_0329862 3300035691 Unclassified 950
472 Ga0373931_1240630 3300035691 Unclassified 511
473 Ga0373935_0147021 3300035692 Unclassified 1596
474 Ga0373933_0488538 3300035724 Bacteria 806
475 Ga0373947_0142698 3300035725 Bacteria 1537
476 Ga0373937_0001020 3300036401 Bacteria 23682
477 Ga0316584_0467165 3300036712 Bacteria 890
478 Ga0436364_0369803 3300037853 Bacteria 7505
479 Ga0436365_0726286 3300039437 Unclassified 3143
480 Ga0439436_0218197 3300041404 Unclassified 548
481 Ga0439439_0013354 3300041406 Bacteria 1992
482 Ga0439453_0002341 3300041408 Bacteria 2599
483 Ga0439453_0123143 3300041408 Bacteria 596
484 Ga0439461_0002648 3300041410 Bacteria 2886
485 Ga0439461_0010734 3300041410 Bacteria 1687
486 Ga0451807_0924662 3300041486 Bacteria 679
487 Ga0451849_0746249 3300041505 Bacteria 759
488 Ga0451853_0977456 3300041512 Bacteria 2076
489 Ga0439431_0156535 3300041997 Unclassified 649
490 Ga0439433_0054143 3300041999 Bacteria 949
491 Ga0439433_0116569 3300041999 Unclassified 671
492 Ga0439449_0100869 3300042007 Bacteria 1067
493 Ga0439457_039367 3300042014 Bacteria 1053
494 Ga0439462_0106451 3300042015 Bacteria 775
495 Ga0450914_004006 3300042118 Unclassified 1169
496 Ga0450921_023663 3300042123 Unclassified 597
497 Ga0450923_071341 3300042125 Bacteria 770
498 Ga0450896_036517 3300042133 Bacteria 757
499 Ga0439446_0012859 3300042156 Bacteria 2291
500 Ga0439434_0072737 3300042435 Bacteria 1084
501 Ga0439434_0200129 3300042435 Unclassified 673
502 Ga0439434_0360651 3300042435 Unclassified 508
503 Ga0439435_0091131 3300042436 Bacteria 926
504 Ga0439435_0263211 3300042436 Bacteria 583
505 Ga0439460_0369018 3300042461 Bacteria 507
506 Ga0450893_0026154 3300042532 Bacteria 1025
507 Ga0451577_0910585 3300042876 Bacteria 792
508 Ga0453684_0071255 3300044712 Bacteria 4395
509 Ga0451576_0142525 3300045051 Bacteria 2499
510 Ga0451576_0170664 3300045051 Bacteria 2270
511 Ga0451576_0239136 3300045051 Bacteria 1897
512 Ga0451576_1371966 3300045051 Bacteria 736
513 Ga0451576_1817108 3300045051 Bacteria 630
514 Ga0451576_2506692 3300045051 Bacteria 527
515 Ga0495603_0116131 3300046455 Bacteria 1560
516 Ga0495629_0168406 3300046459 Bacteria 1521
517 Ga0495639_0114425 3300046475 Bacteria 1283
518 Ga0495608_0107907 3300046511 Bacteria 1791
519 Ga0495628_0135690 3300046516 Bacteria 1881
520 Ga0495628_0141273 3300046516 Bacteria 1838
521 Ga0495628_0270879 3300046516 Unclassified 1263
522 Ga0495630_0077597 3300046517 Unclassified 2504
523 Ga0495652_0242135 3300046529 Unclassified 1341
524 Ga0495598_0150364 3300046537 Unclassified 812
525 Ga0495645_0327930 3300046543 Unclassified 992
526 Ga0495634_0844895 3300046642 Bacteria 520
527 Ga0495659_0190458 3300046664 Unclassified 838
528 Ga0495669_0565666 3300046684 Bacteria 553
529 Ga0495600_0226055 3300046809 Bacteria 1196
530 Ga0495674_0104306 3300047319 Bacteria 2410
531 Ga0495674_0189652 3300047319 Bacteria 1709
532 Ga0496101_0529025 3300048904 Bacteria 932
533 Ga0496102_0049479 3300048905 Bacteria 3824
534 Ga0496102_0219097 3300048905 Bacteria 1794
535 Ga0496103_0328379 3300048906 Unclassified 984
536 Ga0496104_0002137 3300048907 Bacteria 17158
537 Ga0496105_0025385 3300048908 Bacteria 4824
538 Ga0496106_1180493 3300048909 Bacteria 597
539 Ga0496108_0000729 3300048911 Bacteria 25561
540 Ga0496108_0318315 3300048911 Bacteria 1356
541 Ga0496109_0001330 3300048912 Bacteria 20389
542 Ga0496109_0221533 3300048912 Bacteria 1779
543 Ga0496109_1910889 3300048912 Bacteria 526
544 Ga0496110_0000542 3300048913 Bacteria 25762
545 Ga0496111_0088673 3300048914 Bacteria 2266
546 Ga0496111_0152228 3300048914 Bacteria 1716
547 Ga0496111_0289170 3300048914 Bacteria 1215
548 Ga0496112_0001737 3300048915 Bacteria 17063
549 Ga0496112_0020140 3300048915 Bacteria 6316
550 Ga0496112_0623382 3300048915 Bacteria 1009
551 Ga0501292_143805 3300049515 Unclassified 501
552 Ga0501298_015859 3300049521 Bacteria 1361
553 Ga0501033_0046311 3300049570 Bacteria 3234
554 Ga0501033_1172541 3300049570 Bacteria 509
555 Ga0501034_1361102 3300049571 Bacteria 585
556 Ga0501036_0047872 3300049572 Unclassified 3620
557 Ga0501036_0198842 3300049572 Unclassified 1686
558 Ga0501036_0365207 3300049572 Bacteria 1205
559 Ga0501038_0334910 3300049574 Unclassified 1181
560 Ga0501038_0427571 3300049574 Unclassified 1021
561 Ga0501038_0627774 3300049574 Bacteria 811
562 Ga0501039_0154563 3300049575 Bacteria 1802
563 Ga0501039_0466019 3300049575 Bacteria 992
564 Ga0501040_0045993 3300049576 Bacteria 2979
565 Ga0501040_0081099 3300049576 Bacteria 2248
566 Ga0501040_0442229 3300049576 Bacteria 935
567 Ga0501040_0550047 3300049576 Bacteria 833
568 Ga0501041_0026054 3300049577 Bacteria 3515
569 Ga0501041_0072843 3300049577 Bacteria 2111
570 Ga0501041_0106480 3300049577 Bacteria 1738
571 Ga0501041_0411948 3300049577 Unclassified 857
572 Ga0501041_0764838 3300049577 Unclassified 619
573 Ga0501042_0169111 3300049578 Bacteria 1578
574 Ga0501042_0527540 3300049578 Bacteria 858
575 Ga0501042_0773785 3300049578 Bacteria 698
576 Ga0501042_0919846 3300049578 Unclassified 637
577 Ga0501043_0365596 3300049579 Bacteria 1094
578 Ga0501046_0056776 3300049580 Bacteria 3072
579 Ga0501046_0921896 3300049580 Bacteria 609
580 Ga0501047_0394529 3300049581 Bacteria 1217
581 Ga0501048_0044406 3300049582 Bacteria 3178
582 Ga0501048_0128768 3300049582 Unclassified 1790
583 Ga0501048_0420570 3300049582 Bacteria 956
584 Ga0501048_1034002 3300049582 Bacteria 591
585 Ga0501048_1163469 3300049582 Bacteria 555
586 Ga0501067_0031736 3300049583 Bacteria 2931
587 Ga0501068_0092340 3300049584 Bacteria 1869
588 Ga0501068_0351048 3300049584 Bacteria 948
589 Ga0501068_0854047 3300049584 Bacteria 598
590 Ga0501069_0138863 3300049585 Unclassified 1393
591 Ga0501070_1411389 3300049586 Unclassified 529
592 Ga0501071_0029541 3300049587 Bacteria 3870
593 Ga0501071_0086465 3300049587 Bacteria 2300
594 Ga0501071_0224969 3300049587 Bacteria 1413
595 Ga0501072_0010419 3300049588 Bacteria 7084
596 Ga0501072_0018772 3300049588 Bacteria 5333
597 Ga0501072_0032162 3300049588 Bacteria 4109
598 Ga0501072_0104693 3300049588 Bacteria 2250
599 Ga0501072_0341497 3300049588 Bacteria 1189
600 Ga0501072_1228764 3300049588 Bacteria 582
601 Ga0501073_0855961 3300049589 Unclassified 626
602 Ga0501074_0378135 3300049590 Bacteria 1005
603 Ga0501074_0450235 3300049590 Bacteria 913
604 Ga0501074_0578857 3300049590 Bacteria 794
605 Ga0501074_0843317 3300049590 Unclassified 645
606 Ga0501074_0947894 3300049590 Bacteria 605
607 Ga0501075_0072466 3300049591 Bacteria 2604
608 Ga0501075_0234298 3300049591 Unclassified 1400
609 Ga0501075_0575277 3300049591 Unclassified 859
610 Ga0501075_0615402 3300049591 Bacteria 828
611 Ga0501075_0752175 3300049591 Bacteria 742
612 Ga0501075_0768956 3300049591 Bacteria 733
613 Ga0501076_0003748 3300049592 Bacteria 10687
614 Ga0501076_0042223 3300049592 Bacteria 3590
615 Ga0501076_0052310 3300049592 Unclassified 3235
616 Ga0501076_0055448 3300049592 Bacteria 3143
617 Ga0501076_0071712 3300049592 Bacteria 2772
618 Ga0501076_0531189 3300049592 Bacteria 970
619 Ga0501076_0991342 3300049592 Bacteria 692
620 Ga0501076_1121766 3300049592 Unclassified 648
621 Ga0501076_1275302 3300049592 Bacteria 604
622 Ga0501077_0320092 3300049593 Unclassified 989
623 Ga0501077_0373824 3300049593 Unclassified 910
624 Ga0501077_1042157 3300049593 Bacteria 526
625 Ga0501202_134890 3300049652 Unclassified 633
626 Ga0501202_145358 3300049652 Bacteria 616
627 Ga0501217_113653 3300049661 Bacteria 780
628 Ga0501223_071021 3300049663 Bacteria 688
629 Ga0501230_076329 3300049667 Bacteria 696
630 Ga0501243_114767 3300049675 Bacteria 554
631 Ga0501249_030590 3300049679 Bacteria 1199
632 Ga0501257_211046 3300049686 Unclassified 562
633 Ga0501234_068288 3300049707 Unclassified 611
634 Ga0501234_086941 3300049707 Unclassified 557
635 Ga0501079_0040572 3300049741 Bacteria 3591
636 Ga0501079_0097096 3300049741 Bacteria 2284
637 Ga0501079_0198313 3300049741 Bacteria 1567
638 Ga0501079_0468229 3300049741 Bacteria 990
639 Ga0501079_0982075 3300049741 Bacteria 665
640 Ga0501079_1447178 3300049741 Bacteria 541
641 Ga0501080_0129936 3300049742 Bacteria 2332
642 Ga0501080_0136598 3300049742 Bacteria 2269
643 Ga0501080_1209443 3300049742 Unclassified 649
644 Ga0501081_0059096 3300049743 Bacteria 2654
645 Ga0501081_0395702 3300049743 Bacteria 1022
646 Ga0501083_0314360 3300049744 Bacteria 1019
647 Ga0501083_0530700 3300049744 Bacteria 766
648 Ga0501083_0811439 3300049744 Bacteria 609
649 Ga0501268_048174 3300049765 Bacteria 819
650 Ga0501273_092744 3300049770 Unclassified 515
651 Ga0501035_0528967 3300049822 Unclassified 968
652 Ga0501035_0730924 3300049822 Bacteria 796
653 Ga0501035_1159196 3300049822 Unclassified 601
654 Ga0501045_0008035 3300049824 Bacteria 7349
655 Ga0501045_0102973 3300049824 Bacteria 2114
656 Ga0501045_0158157 3300049824 Bacteria 1686
657 Ga0501045_0764512 3300049824 Unclassified 712
658 Ga0501045_1133245 3300049824 Unclassified 572
659 nmdc:mga0yw44_80023_c1 3300050492 Bacteria 2046
660 nmdc:mga06z11_13055_c1 3300050494 Bacteria 3634
661 nmdc:mga04h51_129281_c1 3300050495 Unclassified 948
662 nmdc:mga05p37_11_c1 3300050507 Bacteria 149577
663 nmdc:mga05p37_23948_c1 3300050507 Bacteria 7413
664 nmdc:mga05p37_32474_c1 3300050507 Bacteria 6383
665 nmdc:mga05p37_394731_c1 3300050507 Bacteria 1617
666 nmdc:mga05p37_41383_c1 3300050507 Bacteria 5657
667 nmdc:mga05p37_426950_c1 3300050507 Bacteria 1541
668 nmdc:mga05p37_6299_c1 3300050507 Bacteria 13965
669 nmdc:mga05p37_7519_c1 3300050507 Bacteria 12846
670 nmdc:mga09592_1263236_c1 3300050508 Bacteria 608
671 nmdc:mga09592_425254_c1 3300050508 Bacteria 1147
672 nmdc:mga09592_532098_c1 3300050508 Unclassified 1010
673 nmdc:mga09592_709062_c1 3300050508 Unclassified 856
674 nmdc:mga09592_85284_c1 3300050508 Bacteria 2694
675 nmdc:mga09592_9620_c1 3300050508 Bacteria 7853
676 nmdc:mga0qj67_301921_c1 3300050509 Bacteria 1297
677 nmdc:mga0qj67_386813_c1 3300050509 Bacteria 1129
678 nmdc:mga0qj67_92296_c1 3300050509 Bacteria 2434
679 nmdc:mga0qj67_93248_c1 3300050509 Bacteria 2421
680 nmdc:mga06r32_1038365_c1 3300050510 Bacteria 771
681 nmdc:mga06r32_1199572_c1 3300050510 Bacteria 705
682 nmdc:mga06r32_137888_c1 3300050510 Bacteria 2414
683 nmdc:mga06r32_375212_c1 3300050510 Bacteria 1405
684 nmdc:mga06r32_591198_c1 3300050510 Bacteria 1081
685 nmdc:mga06r32_613692_c1 3300050510 Bacteria 1058
686 nmdc:mga06r32_648796_c1 3300050510 Bacteria 1024
687 nmdc:mga06r32_8742_c1 3300050510 Bacteria 9126
688 nmdc:mga06r32_890928_c1 3300050510 Unclassified 847
689 nmdc:mga06r32_903173_c1 3300050510 Bacteria 840
690 nmdc:mga08y16_1301380_c1 3300050511 Bacteria 694
691 nmdc:mga08y16_135689_c1 3300050511 Bacteria 2558
692 nmdc:mga08y16_1702938_c1 3300050511 Unclassified 586
693 nmdc:mga08y16_173501_c1 3300050511 Unclassified 2239
694 nmdc:mga08y16_175101_c1 3300050511 Bacteria 2228
695 nmdc:mga08y16_1761136_c1 3300050511 Unclassified 573
696 nmdc:mga08y16_187215_c1 3300050511 Bacteria 2148
697 nmdc:mga08y16_1944_c1 3300050511 Bacteria 21097
698 nmdc:mga08y16_228394_c1 3300050511 Bacteria 1925
699 nmdc:mga08y16_253384_c1 3300050511 Bacteria 1819
700 nmdc:mga08y16_265190_c1 3300050511 Bacteria 1773
701 nmdc:mga08y16_358157_c1 3300050511 Bacteria 1498
702 nmdc:mga08y16_497972_c1 3300050511 Bacteria 1238
703 nmdc:mga08y16_54010_c1 3300050511 Bacteria 4199
704 nmdc:mga08y16_57669_c1 3300050511 Bacteria 4057
705 nmdc:mga08y16_74543_c1 3300050511 Bacteria 3536
706 nmdc:mga08y16_95334_c1 3300050511 Bacteria 3099
707 nmdc:mga0n895_1089131_c1 3300050512 Bacteria 777
708 nmdc:mga0n895_13858_c1 3300050512 Bacteria 7297
709 nmdc:mga0n895_26861_c1 3300050512 Bacteria 5460
710 nmdc:mga0n895_46922_c1 3300050512 Bacteria 4222
711 nmdc:mga0n895_55620_c1 3300050512 Unclassified 3894
712 nmdc:mga0n895_658184_c1 3300050512 Bacteria 1046
713 nmdc:mga0n895_72597_c1 3300050512 Bacteria 3414
714 nmdc:mga0n895_751197_c1 3300050512 Bacteria 968
715 nmdc:mga0rr50_105757_c1 3300050513 Bacteria 2219
716 nmdc:mga0rr50_293123_c1 3300050513 Unclassified 1360
717 nmdc:mga0rr50_767651_c1 3300050513 Bacteria 823
718 nmdc:mga08x19_135556_c1 3300050514 Bacteria 1659
719 nmdc:mga08x19_165946_c1 3300050514 Bacteria 1501
720 nmdc:mga08x19_992733_c1 3300050514 Bacteria 596
721 nmdc:mga0a205_1009281_c1 3300050515 Unclassified 679
722 nmdc:mga0a205_1601277_c1 3300050515 Unclassified 500
723 nmdc:mga0a205_28201_c1 3300050515 Bacteria 5367
724 nmdc:mga0a205_439193_c1 3300050515 Bacteria 1166
725 nmdc:mga0sz30_142115_c1 3300050516 Bacteria 1060
726 Ga0495601_0026437 3300053077 Bacteria 3584
727 Ga0495601_0261779 3300053077 Unclassified 1129
728 Ga0495619_0715566 3300053085 Unclassified 680
729 Ga0500628_034679 3300053129 Bacteria 1117
730 Ga0500645_002231 3300053730 Bacteria 8834
731 Ga0501084_0024653 3300054114 Bacteria 5020
732 Ga0501084_0042897 3300054114 Bacteria 3784
733 Ga0501084_0045193 3300054114 Bacteria 3688
734 Ga0501084_0174846 3300054114 Bacteria 1812
735 Ga0501084_0209233 3300054114 Bacteria 1646
736 Ga0501084_0459196 3300054114 Bacteria 1077
737 Ga0501084_0916786 3300054114 Bacteria 737
738 Ga0590071_058738 3300059421 Bacteria 938
739 Ga0590074_001350 3300059423 Bacteria 3926
740 Ga0590074_065972 3300059423 Unclassified 678
741 Ga0590077_000140 3300059426 Bacteria 19839
742 Ga0590077_007955 3300059426 Bacteria 2169
743 Ga0587128_060439 3300059630 Bacteria 714
744 Ga0501082_0023154 3300060353 Bacteria 5357
745 Ga0501082_0048313 3300060353 Bacteria 3668
746 Ga0501082_0089625 3300060353 Bacteria 2656
747 Ga0501082_0182362 3300060353 Unclassified 1826
748 Ga0501082_0274720 3300060353 Bacteria 1467
749 Ga0530510_1301025 3300061734 Bacteria 558
750 Ga0530510_1322203 3300061734 Bacteria 553
751 Ga0068862_100926617
752 JGI24749J21850_1057165
753 JGI24035J26624_1004246
754 JGI24751J29686_10042113
755 Ga0065704_10188068
756 Ga0065712_10010373
757 Ga0065712_10074188
758 Ga0065712_10107532
759 Ga0065712_10109816
760 Ga0065712_10226494
761 Ga0065715_10092420
762 Ga0065715_10108963
763 Ga0065715_10132106
764 Ga0065715_10143495
765 Ga0065715_10166556
766 Ga0065715_10242347
767 Ga0065715_10245548
768 Ga0065715_10329345
769 Ga0065715_10525244
770 Ga0065707_10054504
771 Ga0065707_10188151
772 Ga0065707_10840234
773 Ga0065707_10993878
774 Ga0070676_10935768
775 Ga0070676_11045043
776 Ga0070683_100000939
777 Ga0070683_100492805
778 Ga0070683_102217438
779 Ga0070690_100539228
780 Ga0070670_100005461
781 Ga0070670_100012354
782 Ga0070670_100019937
783 Ga0070670_100058304
784 Ga0070670_100524721
785 Ga0070670_101093648
786 Ga0070677_10393166
787 Ga0068869_100027185
788 Ga0068869_100766457
789 Ga0068869_101543207
790 Ga0070666_10496765
791 Ga0070660_100646130
792 Ga0070660_101536515
793 Ga0070689_100586419
794 Ga0070689_101440495
795 Ga0070687_100058738
796 Ga0070687_101016370
797 Ga0070661_100017984
798 Ga0070661_100960934
799 Ga0070668_100708768
800 Ga0070668_101743218
801 Ga0070669_100000640
802 Ga0070669_100038093
803 Ga0070669_100306412
804 Ga0070669_100516599
805 Ga0070669_100774964
806 Ga0070675_100012442
807 Ga0070675_100123911
808 Ga0070675_100156959
809 Ga0070675_100443255
810 Ga0070671_100020992
811 Ga0070671_100224982
812 Ga0070674_100007364
813 Ga0070674_100012596
814 Ga0070674_100017961
815 Ga0070674_100056579
816 Ga0070674_100294147
817 Ga0070674_101146264
818 Ga0070673_100055450
819 Ga0070673_100074251
820 Ga0070673_100480071
821 Ga0070673_101182195
822 Ga0070688_100000001
823 Ga0070688_100252970
824 Ga0070688_100258342
825 Ga0070688_100463391
826 Ga0070659_100187638
827 Ga0070659_100257300
828 Ga0070667_100038168
829 Ga0070710_10445075
830 Ga0070711_100149144
831 Ga0070700_100072094
832 Ga0070708_100315125
833 Ga0070663_100033044
834 Ga0070663_101225214
835 Ga0070678_100341186
836 Ga0070678_100345925
837 Ga0070662_100075017
838 Ga0070662_100112842
839 Ga0070662_100610189
840 Ga0070662_100740605
841 Ga0070662_100819355
842 Ga0070681_10624603
843 Ga0070681_11117351
844 Ga0068867_100293150
845 Ga0068867_100342994
846 Ga0068867_100351987
847 Ga0068867_100422808
848 Ga0070685_10232584
849 Ga0070685_11339600
850 Ga0070706_100818738
851 Ga0070706_101791910
852 Ga0070707_100630723
853 Ga0070699_100654934
854 Ga0070679_100288139
855 Ga0070679_101215420
856 Ga0070684_100000048
857 Ga0070684_100864405
858 Ga0070684_101290296
859 Ga0070697_100808491
860 Ga0070697_100846286
861 Ga0068853_100494343
862 Ga0070672_100113277
863 Ga0070672_100155076
864 Ga0070686_100320946
865 Ga0070686_101378299
866 Ga0070696_100060433
867 Ga0070696_100893433
868 Ga0070693_101066833
869 Ga0070704_100198648
870 Ga0070704_100654447
871 Ga0070704_100689484
872 Ga0068855_100223100
873 Ga0068855_100424330
874 Ga0068855_100435729
875 Ga0070664_100001386
876 Ga0070664_100005301
877 Ga0070664_100157472
878 Ga0070664_100925275
879 Ga0068857_100080311
880 Ga0068857_100218069
881 Ga0068857_100865535
882 Ga0068857_101103994
883 Ga0068857_101698798
884 Ga0068854_100656381
885 Ga0068856_100129611
886 Ga0068856_100395952
887 Ga0070702_101393152
888 Ga0068852_100156401
889 Ga0068852_101121175
890 Ga0068859_100144038
891 Ga0068859_100567338
892 Ga0068859_100650269
893 Ga0068859_100985832
894 Ga0068864_100031679
895 Ga0068864_100122814
896 Ga0068864_100312704
897 Ga0068864_100398633
898 Ga0068864_100621130
899 Ga0068864_100877227
900 Ga0068864_102074786
901 Ga0068866_10716139
902 Ga0068861_100941369
903 Ga0068861_100942746
904 Ga0068861_101061165
905 Ga0068861_101104368
906 Ga0068870_10159261
907 Ga0068863_100323622
908 Ga0068863_100656979
909 Ga0068863_100701776
910 Ga0068860_101658242
911 Ga0068862_100081244
912 Ga0068862_100674526
913 Ga0068862_100767430
914 Ga0068862_100982016
915 Ga0068862_101785160
916 Ga0081455_10255746
917 Ga0081539_10176618
918 Ga0070717_10163599
919 Ga0075365_10084812
920 Ga0075365_11027455
921 Ga0075364_10268687
922 Ga0075367_10080234
923 Ga0075366_10056562
924 Ga0097621_100389214
925 Ga0097621_100654251
926 Ga0068871_100487732
927 Ga0075428_100000520
928 Ga0075428_100002296
929 Ga0075428_100801400
930 Ga0075430_100004527
931 Ga0075430_100014823
932 Ga0075430_100065100
933 Ga0075430_100089916
934 Ga0075430_100405513
935 Ga0075430_101371716
936 Ga0075431_100011125
937 Ga0075431_100015718
938 Ga0075431_100016362
939 Ga0075431_100022830
940 Ga0075431_100390681
941 Ga0075431_100449009
942 Ga0075431_100853143
943 Ga0075431_101096054
944 Ga0075431_101101076
945 Ga0075431_101553683
946 Ga0075433_10132705
947 Ga0075433_10208613
948 Ga0075433_10267833
949 Ga0075433_10349397
950 Ga0075433_10705027
951 Ga0075433_10841096
952 Ga0075433_10928360
953 Ga0075434_100004925
954 Ga0075434_100016444
955 Ga0075434_100097663
956 Ga0075434_100201108
957 Ga0075434_100429619
958 Ga0075434_100717381
959 Ga0075434_100796613
960 Ga0075429_100010905
961 Ga0075429_100448428
962 Ga0075429_100533179
963 Ga0075429_100699234
964 Ga0075429_101183260
965 Ga0075429_101256108
966 Ga0075436_100206186
967 Ga0075436_100472663
968 Ga0075436_100880216
969 Ga0097620_100144041
970 Ga0097620_100567254
971 Ga0097620_100650308
972 Ga0097620_100985664
973 Ga0075435_100124766
974 Ga0075435_100810288
975 Ga0075435_102000765
976 Ga0105240_10026707
977 Ga0105240_10527088
978 Ga0105240_11830749
979 Ga0111539_10012965
980 Ga0111539_10013620
981 Ga0111539_10028907
982 Ga0111539_10033462
983 Ga0111539_10040925
984 Ga0111539_10080555
985 Ga0111539_10198109
986 Ga0111539_10272335
987 Ga0111539_10381405
988 Ga0111539_10640022
989 Ga0111539_11019758
990 Ga0111539_11361790
991 Ga0111539_13388587
992 Ga0105245_10584951
993 Ga0105245_11302776
994 Ga0114129_10000054
995 Ga0114129_10001555
996 Ga0114129_10008035
997 Ga0114129_10009389
998 Ga0114129_10022451
999 Ga0114129_10036053
1000 Ga0114129_10135438
1001 Ga0114129_10316388
1002 Ga0114129_11245257
1003 Ga0105243_10279414
1004 Ga0105242_11553830
1005 Ga0105242_12421609
1006 Ga0105248_10053649
1007 Ga0105237_10000005
1008 Ga0105249_10001107
1009 Ga0105249_10126340
1010 Ga0105249_10193899
1011 Ga0105249_10280522
1012 Ga0105249_10696053
1013 Ga0105239_10933858
1014 Ga0105246_10300503
1015 Ga0105246_10636841
1016 Ga0105246_11429401
1017 Ga0157370_10517950
1018 Ga0157370_11335971
1019 Ga0157378_10393735
1020 Ga0163162_10575253
1021 Ga0163162_11213589
1022 Ga0157372_10160878
1023 Ga0157372_12767016
1024 Ga0157375_10364025
1025 Ga0157375_10638988
1026 Ga0163163_10025043
1027 Ga0163163_10146312
1028 Ga0163163_10418853
1029 Ga0163163_10814960
1030 Ga0163163_10835070
1031 Ga0157380_10016499
1032 Ga0157380_10040108
1033 Ga0157380_10206831
1034 Ga0157380_10296523
1035 Ga0157380_10343484
1036 Ga0157380_10478297
1037 Ga0157380_10488518
1038 Ga0157380_11224269
1039 Ga0157380_11992542
1040 Ga0157377_10480920
1041 Ga0157379_10243376
1042 Ga0157376_10645153
1043 Ga0157376_10836745
1044 Ga0163161_11139491
1045 Ga0206356_10739370
1046 Ga0213875_10583335
1047 Ga0207666_1033937
1048 Ga0207673_1002362
1049 Ga0207697_10000562
1050 Ga0207697_10039988
1051 Ga0207697_10118845
1052 Ga0207697_10404188
1053 Ga0207688_10008149
1054 Ga0207699_10870892
1055 Ga0207643_10149407
1056 Ga0207643_10690430
1057 Ga0207707_10212861
1058 Ga0207707_10538667
1059 Ga0207695_10113377
1060 Ga0207695_11176770
1061 Ga0207671_10000005
1062 Ga0207663_10133171
1063 Ga0207663_10385582
1064 Ga0207660_10217846
1065 Ga0207660_10548231
1066 Ga0207662_10289112
1067 Ga0207662_10675011
1068 Ga0207662_11259803
1069 Ga0207657_10459001
1070 Ga0207649_10045935
1071 Ga0207649_10396374
1072 Ga0207652_10199650
1073 Ga0207652_10573576
1074 Ga0207652_10908373
1075 Ga0207646_10571457
1076 Ga0207646_10734002
1077 Ga0207681_10061288
1078 Ga0207681_10103533
1079 Ga0207681_10105402
1080 Ga0207681_10347207
1081 Ga0207681_10695137
1082 Ga0207681_11136497
1083 Ga0207650_10009288
1084 Ga0207650_10018077
1085 Ga0207650_10033926
1086 Ga0207650_10078668
1087 Ga0207650_10104821
1088 Ga0207650_10143523
1089 Ga0207659_10019135
1090 Ga0207659_10046805
1091 Ga0207659_10179000
1092 Ga0207659_10289053
1093 Ga0207687_10287450
1094 Ga0207700_11922781
1095 Ga0207644_10010224
1096 Ga0207644_10210763
1097 Ga0207690_10036943
1098 Ga0207690_10221704
1099 Ga0207706_10104082
1100 Ga0207706_10138030
1101 Ga0207706_10428785
1102 Ga0207706_10685106
1103 Ga0207670_10000012
1104 Ga0207670_10501601
1105 Ga0207670_11265952
1106 Ga0207669_10009914
1107 Ga0207669_10035499
1108 Ga0207669_10190093
1109 Ga0207669_10446103
1110 Ga0207669_10482526
1111 Ga0207691_10111639
1112 Ga0207711_10128096
1113 Ga0207689_10278239
1114 Ga0207661_10006992
1115 Ga0207661_10437818
1116 Ga0207679_10000474
1117 Ga0207679_10094445
1118 Ga0207679_10126330
1119 Ga0207679_10829122
1120 Ga0207679_11111315
1121 Ga0207679_11212502
1122 Ga0207667_10215279
1123 Ga0207651_10127867
1124 Ga0207651_10324101
1125 Ga0207651_10412993
1126 Ga0207651_10912761
1127 Ga0207712_10008658
1128 Ga0207712_10424269
1129 Ga0207712_10655869
1130 Ga0207712_10816772
1131 Ga0207668_10363023
1132 Ga0207668_10519924
1133 Ga0207640_11693854
1134 Ga0207658_10034043
1135 Ga0207677_10058401
1136 Ga0207678_10127405
1137 Ga0207678_10504503
1138 Ga0207678_10786584
1139 Ga0207678_11246057
1140 Ga0207708_10197779
1141 Ga0207702_10379381
1142 Ga0207641_10196907
1143 Ga0207641_10536658
1144 Ga0207641_10758642
1145 Ga0207648_10175151
1146 Ga0207648_10333435
1147 Ga0207676_10030382
1148 Ga0207676_10050363
1149 Ga0207676_10614841
1150 Ga0207676_10756636
1151 Ga0207674_10018733
1152 Ga0207674_10040838
1153 Ga0207674_10837129
1154 Ga0207675_100063450
1155 Ga0207675_100389765
1156 Ga0207675_100589364
1157 Ga0207675_100628323
1158 Ga0207683_10081895
1159 Ga0207683_11125970
1160 Ga0207698_11287927
1161 Ga0207698_11676702
1162 Ga0209983_1053485
1163 Ga0209813_10109701
1164 Ga0207428_10012989
1165 Ga0207428_10080421
1166 Ga0207428_10127844
1167 Ga0207428_10173342
1168 Ga0207428_10278374
1169 Ga0207428_10310054
1170 Ga0207428_10364586
1171 Ga0207428_10369136
1172 Ga0207428_10472735
1173 Ga0268265_10034800
1174 Ga0268265_10355794
1175 Ga0268265_12429260
1176 Ga0268264_11478600
1177 Ga0307408_100073266
1178 Ga0307408_100075398
1179 Ga0307408_100539399
1180 Ga0307405_10154614
1181 Ga0307413_10152548
1182 Ga0307413_10337099
1183 Ga0307413_10386463
1184 Ga0307413_11019936
1185 Ga0307410_10057906
1186 Ga0307410_10645396
1187 Ga0307410_10665655
1188 Ga0307406_10168412
1189 Ga0307406_10607144
1190 Ga0307407_10027108
1191 Ga0307407_10102945
1192 Ga0307407_10874673
1193 Ga0307412_10318765
1194 Ga0307412_10350797
1195 Ga0307412_11096562
1196 Ga0307412_11214941
1197 Ga0307409_100008282
1198 Ga0307409_100357855
1199 Ga0307409_100638018
1200 Ga0307409_101168944
1201 Ga0307409_101296049
1202 Ga0307416_100015376
1203 Ga0307416_100224977
1204 Ga0307416_101065059
1205 Ga0307414_10047065
1206 Ga0307414_10055745
1207 Ga0307414_10525680
1208 Ga0307414_11241109
1209 Ga0307411_10349270
1210 Ga0307411_10595408
1211 Ga0307411_11291641
1212 Ga0307415_100044333
1213 Ga0307415_100769124
1214 Ga0307415_101301935
1215 Ga0373928_0183201
1216 Ga0373936_0390566
1217 Ga0373943_0169411
1218 Ga0373943_0196787
1219 Ga0373955_0096480
1220 Ga0373962_0397588
1221 Ga0373931_0329862
1222 Ga0373931_1240630
1223 Ga0373935_0147021
1224 Ga0373933_0488538
1225 Ga0373947_0142698
1226 Ga0373937_0001020
1227 Ga0316584_0467165
1228 Ga0436364_0369803
1229 Ga0436365_0726286
1230 Ga0439436_0218197
1231 Ga0439439_0013354
1232 Ga0439453_0002341
1233 Ga0439453_0123143
1234 Ga0439461_0002648
1235 Ga0439461_0010734
1236 Ga0451807_0924662
1237 Ga0451849_0746249
1238 Ga0451853_0977456
1239 Ga0439431_0156535
1240 Ga0439433_0054143
1241 Ga0439433_0116569
1242 Ga0439449_0100869
1243 Ga0439457_039367
1244 Ga0439462_0106451
1245 Ga0450914_004006
1246 Ga0450921_023663
1247 Ga0450923_071341
1248 Ga0450896_036517
1249 Ga0439446_0012859
1250 Ga0439434_0072737
1251 Ga0439434_0200129
1252 Ga0439434_0360651
1253 Ga0439435_0091131
1254 Ga0439435_0263211
1255 Ga0439460_0369018
1256 Ga0450893_0026154
1257 Ga0451577_0910585
1258 Ga0453684_0071255
1259 Ga0451576_0142525
1260 Ga0451576_0170664
1261 Ga0451576_0239136
1262 Ga0451576_1371966
1263 Ga0451576_1817108
1264 Ga0451576_2506692
1265 Ga0495603_0116131
1266 Ga0495629_0168406
1267 Ga0495639_0114425
1268 Ga0495608_0107907
1269 Ga0495628_0135690
1270 Ga0495628_0141273
1271 Ga0495628_0270879
1272 Ga0495630_0077597
1273 Ga0495652_0242135
1274 Ga0495598_0150364
1275 Ga0495645_0327930
1276 Ga0495634_0844895
1277 Ga0495659_0190458
1278 Ga0495669_0565666
1279 Ga0495600_0226055
1280 Ga0495674_0104306
1281 Ga0495674_0189652
1282 Ga0496101_0529025
1283 Ga0496102_0049479
1284 Ga0496102_0219097
1285 Ga0496103_0328379
1286 Ga0496104_0002137
1287 Ga0496105_0025385
1288 Ga0496106_1180493
1289 Ga0496108_0000729
1290 Ga0496108_0318315
1291 Ga0496109_0001330
1292 Ga0496109_0221533
1293 Ga0496109_1910889
1294 Ga0496110_0000542
1295 Ga0496111_0088673
1296 Ga0496111_0152228
1297 Ga0496111_0289170
1298 Ga0496112_0001737
1299 Ga0496112_0020140
1300 Ga0496112_0623382
1301 Ga0501292_143805
1302 Ga0501298_015859
1303 Ga0501033_0046311
1304 Ga0501033_1172541
1305 Ga0501034_1361102
1306 Ga0501036_0047872
1307 Ga0501036_0198842
1308 Ga0501036_0365207
1309 Ga0501038_0334910
1310 Ga0501038_0427571
1311 Ga0501038_0627774
1312 Ga0501039_0154563
1313 Ga0501039_0466019
1314 Ga0501040_0045993
1315 Ga0501040_0081099
1316 Ga0501040_0442229
1317 Ga0501040_0550047
1318 Ga0501041_0026054
1319 Ga0501041_0072843
1320 Ga0501041_0106480
1321 Ga0501041_0411948
1322 Ga0501041_0764838
1323 Ga0501042_0169111
1324 Ga0501042_0527540
1325 Ga0501042_0773785
1326 Ga0501042_0919846
1327 Ga0501043_0365596
1328 Ga0501046_0056776
1329 Ga0501046_0921896
1330 Ga0501047_0394529
1331 Ga0501048_0044406
1332 Ga0501048_0128768
1333 Ga0501048_0420570
1334 Ga0501048_1034002
1335 Ga0501048_1163469
1336 Ga0501067_0031736
1337 Ga0501068_0092340
1338 Ga0501068_0351048
1339 Ga0501068_0854047
1340 Ga0501069_0138863
1341 Ga0501070_1411389
1342 Ga0501071_0029541
1343 Ga0501071_0086465
1344 Ga0501071_0224969
1345 Ga0501072_0010419
1346 Ga0501072_0018772
1347 Ga0501072_0032162
1348 Ga0501072_0104693
1349 Ga0501072_0341497
1350 Ga0501072_1228764
1351 Ga0501073_0855961
1352 Ga0501074_0378135
1353 Ga0501074_0450235
1354 Ga0501074_0578857
1355 Ga0501074_0843317
1356 Ga0501074_0947894
1357 Ga0501075_0072466
1358 Ga0501075_0234298
1359 Ga0501075_0575277
1360 Ga0501075_0615402
1361 Ga0501075_0752175
1362 Ga0501075_0768956
1363 Ga0501076_0003748
1364 Ga0501076_0042223
1365 Ga0501076_0052310
1366 Ga0501076_0055448
1367 Ga0501076_0071712
1368 Ga0501076_0531189
1369 Ga0501076_0991342
1370 Ga0501076_1121766
1371 Ga0501076_1275302
1372 Ga0501077_0320092
1373 Ga0501077_0373824
1374 Ga0501077_1042157
1375 Ga0501202_134890
1376 Ga0501202_145358
1377 Ga0501217_113653
1378 Ga0501223_071021
1379 Ga0501230_076329
1380 Ga0501243_114767
1381 Ga0501249_030590
1382 Ga0501257_211046
1383 Ga0501234_068288
1384 Ga0501234_086941
1385 Ga0501079_0040572
1386 Ga0501079_0097096
1387 Ga0501079_0198313
1388 Ga0501079_0468229
1389 Ga0501079_0982075
1390 Ga0501079_1447178
1391 Ga0501080_0129936
1392 Ga0501080_0136598
1393 Ga0501080_1209443
1394 Ga0501081_0059096
1395 Ga0501081_0395702
1396 Ga0501083_0314360
1397 Ga0501083_0530700
1398 Ga0501083_0811439
1399 Ga0501268_048174
1400 Ga0501273_092744
1401 Ga0501035_0528967
1402 Ga0501035_0730924
1403 Ga0501035_1159196
1404 Ga0501045_0008035
1405 Ga0501045_0102973
1406 Ga0501045_0158157
1407 Ga0501045_0764512
1408 Ga0501045_1133245
1409 nmdc:mga0yw44_80023_c1
1410 nmdc:mga06z11_13055_c1
1411 nmdc:mga04h51_129281_c1
1412 nmdc:mga05p37_11_c1
1413 nmdc:mga05p37_23948_c1
1414 nmdc:mga05p37_32474_c1
1415 nmdc:mga05p37_394731_c1
1416 nmdc:mga05p37_41383_c1
1417 nmdc:mga05p37_426950_c1
1418 nmdc:mga05p37_6299_c1
1419 nmdc:mga05p37_7519_c1
1420 nmdc:mga09592_1263236_c1
1421 nmdc:mga09592_425254_c1
1422 nmdc:mga09592_532098_c1
1423 nmdc:mga09592_709062_c1
1424 nmdc:mga09592_85284_c1
1425 nmdc:mga09592_9620_c1
1426 nmdc:mga0qj67_301921_c1
1427 nmdc:mga0qj67_386813_c1
1428 nmdc:mga0qj67_92296_c1
1429 nmdc:mga0qj67_93248_c1
1430 nmdc:mga06r32_1038365_c1
1431 nmdc:mga06r32_1199572_c1
1432 nmdc:mga06r32_137888_c1
1433 nmdc:mga06r32_375212_c1
1434 nmdc:mga06r32_591198_c1
1435 nmdc:mga06r32_613692_c1
1436 nmdc:mga06r32_648796_c1
1437 nmdc:mga06r32_8742_c1
1438 nmdc:mga06r32_890928_c1
1439 nmdc:mga06r32_903173_c1
1440 nmdc:mga08y16_1301380_c1
1441 nmdc:mga08y16_135689_c1
1442 nmdc:mga08y16_1702938_c1
1443 nmdc:mga08y16_173501_c1
1444 nmdc:mga08y16_175101_c1
1445 nmdc:mga08y16_1761136_c1
1446 nmdc:mga08y16_187215_c1
1447 nmdc:mga08y16_1944_c1
1448 nmdc:mga08y16_228394_c1
1449 nmdc:mga08y16_253384_c1
1450 nmdc:mga08y16_265190_c1
1451 nmdc:mga08y16_358157_c1
1452 nmdc:mga08y16_497972_c1
1453 nmdc:mga08y16_54010_c1
1454 nmdc:mga08y16_57669_c1
1455 nmdc:mga08y16_74543_c1
1456 nmdc:mga08y16_95334_c1
1457 nmdc:mga0n895_1089131_c1
1458 nmdc:mga0n895_13858_c1
1459 nmdc:mga0n895_26861_c1
1460 nmdc:mga0n895_46922_c1
1461 nmdc:mga0n895_55620_c1
1462 nmdc:mga0n895_658184_c1
1463 nmdc:mga0n895_72597_c1
1464 nmdc:mga0n895_751197_c1
1465 nmdc:mga0rr50_105757_c1
1466 nmdc:mga0rr50_293123_c1
1467 nmdc:mga0rr50_767651_c1
1468 nmdc:mga08x19_135556_c1
1469 nmdc:mga08x19_165946_c1
1470 nmdc:mga08x19_992733_c1
1471 nmdc:mga0a205_1009281_c1
1472 nmdc:mga0a205_1601277_c1
1473 nmdc:mga0a205_28201_c1
1474 nmdc:mga0a205_439193_c1
1475 nmdc:mga0sz30_142115_c1
1476 Ga0495601_0026437
1477 Ga0495601_0261779
1478 Ga0495619_0715566
1479 Ga0500628_034679
1480 Ga0500645_002231
1481 Ga0501084_0024653
1482 Ga0501084_0042897
1483 Ga0501084_0045193
1484 Ga0501084_0174846
1485 Ga0501084_0209233
1486 Ga0501084_0459196
1487 Ga0501084_0916786
1488 Ga0590071_058738
1489 Ga0590074_001350
1490 Ga0590074_065972
1491 Ga0590077_000140
1492 Ga0590077_007955
1493 Ga0587128_060439
1494 Ga0501082_0023154
1495 Ga0501082_0048313
1496 Ga0501082_0089625
1497 Ga0501082_0182362
1498 Ga0501082_0274720
1499 Ga0530510_1301025
1500 Ga0530510_1322203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

9

123

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9148 11 72
2fu4-assembly1.cif.gz_A crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) 0.898 14 72
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8977 16 72
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.8867 10 73
1u5t-assembly1.cif.gz_A structure of the escrt-ii endosomal trafficking complex 0.8756 10 72
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9406 10 71 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9397 14 72 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9258 10 72 1.10.10.10
1sd4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9214 16 72 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9148 11 72 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1G3WQU3-F1-model_v4 Transcriptional regulator 0.9584 8 91 GO:0003677
GO:0045892
AF-A0A2N1QJA7-F1-model_v4 Transcriptional regulator 0.9575 9 90 GO:0003677
GO:0045892
AF-A0A5C8A1Q6-F1-model_v4 deleted 0.9524 10 94
AF-A0A352HCE1-F1-model_v4 deleted 0.9483 7 94
AF-A0A3M2BFY9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.948 10 90 GO:0003677
GO:0045892

Map