F478995

General Info

Members Datasets Scaffolds Average Seq Length
749 265 1498 199

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100152683|Ga0070698_1001526832
Length 225
Sequence VSPCLCGKPGLLITKEHRENRNLHMKAEKTINRTGTVHRKTKETDIRVSLNLDGKGSSSITTGLPFLDHMLDLFAKHGLFDLRISCKGDLEIDDHHSVEDIAITLGQTLIEALGNKAGINRYGEAIVPMDEALCRTVIDLSGRFYLVYEVPTKRQKIGNFSVELAEHFWRSFAETAKFNLHIDCLRGRNTHHMLEGTFKATARALRSAVDLNPRVVGVPSTKGSL

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
195 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
196 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
218 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
219 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
220 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
221 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
222 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
223 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
228 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
229 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
230 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
235 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
236 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
239 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
240 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
241 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
242 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
243 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
244 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
245 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
246 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
251 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
252 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
253 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
254 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 22.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100152683 3300005471 Bacteria 2256
2 CNAas_1000953 3300000532 Bacteria 2691
3 JGI24737J22298_10101882 3300001990 Unclassified 851
4 JGI24751J29686_10000074 3300002459 Bacteria 56035
5 JGI25406J46586_10003242 3300003203 Bacteria 7656
6 Ga0065714_10064450 3300005288 Bacteria 77548
7 Ga0065704_10102768 3300005289 Unclassified 2190
8 Ga0065704_10166121 3300005289 Bacteria 1278
9 Ga0065712_10022669 3300005290 Bacteria 1604
10 Ga0065712_10033246 3300005290 Unclassified 1048
11 Ga0065712_10067784 3300005290 Bacteria 36245
12 Ga0065712_10077762 3300005290 Bacteria 3445
13 Ga0065715_10034878 3300005293 Bacteria 1609
14 Ga0065715_10091307 3300005293 Bacteria 5899
15 Ga0065715_10098282 3300005293 Bacteria 3570
16 Ga0065715_10098694 3300005293 Bacteria 3511
17 Ga0065715_10101185 3300005293 Unclassified 3229
18 Ga0065715_10106238 3300005293 Bacteria 2837
19 Ga0065715_10126237 3300005293 Bacteria 2113
20 Ga0065715_10177613 3300005293 Bacteria 1500
21 Ga0065707_10002958 3300005295 Bacteria 6998
22 Ga0065707_10102021 3300005295 Bacteria 2832
23 Ga0065707_10192599 3300005295 Bacteria 1353
24 Ga0065707_10450520 3300005295 Unclassified 801
25 Ga0070676_10067199 3300005328 Bacteria 2143
26 Ga0070676_10214828 3300005328 Bacteria 1267
27 Ga0070676_10463509 3300005328 Unclassified 893
28 Ga0070683_100389289 3300005329 Bacteria 1329
29 Ga0070690_100065921 3300005330 Bacteria 2342
30 Ga0070690_100409487 3300005330 Unclassified 997
31 Ga0070690_100416374 3300005330 Bacteria 990
32 Ga0070690_100647037 3300005330 Bacteria 807
33 Ga0070670_100001763 3300005331 Bacteria 17603
34 Ga0070670_100048022 3300005331 Bacteria 3674
35 Ga0070670_100050584 3300005331 Bacteria 3570
36 Ga0070670_100147136 3300005331 Bacteria 2038
37 Ga0070670_100442455 3300005331 Bacteria 1151
38 Ga0068869_100169486 3300005334 Bacteria 1705
39 Ga0068869_100191680 3300005334 Bacteria 1608
40 Ga0068869_100238816 3300005334 Unclassified 1447
41 Ga0068869_100324855 3300005334 Bacteria 1249
42 Ga0068869_100421109 3300005334 Unclassified 1102
43 Ga0068869_100622703 3300005334 Bacteria 914
44 Ga0070666_10282257 3300005335 Bacteria 1181
45 Ga0070666_10383670 3300005335 Unclassified 1009
46 Ga0070680_100000103 3300005336 Bacteria 48805
47 Ga0070680_100062450 3300005336 Unclassified 3051
48 Ga0070680_100436902 3300005336 Unclassified 1117
49 Ga0070682_100064536 3300005337 Bacteria 2324
50 Ga0068868_100048607 3300005338 Bacteria 3328
51 Ga0068868_100290926 3300005338 Bacteria 1385
52 Ga0070660_100035921 3300005339 Bacteria 3752
53 Ga0070689_100002181 3300005340 Bacteria 12680
54 Ga0070689_100020424 3300005340 Bacteria 4914
55 Ga0070689_100235140 3300005340 Unclassified 1507
56 Ga0070689_101280842 3300005340 Bacteria 660
57 Ga0070687_100042227 3300005343 Bacteria 2309
58 Ga0070687_100065994 3300005343 Bacteria 1927
59 Ga0070661_100011061 3300005344 Bacteria 6285
60 Ga0070692_10039192 3300005345 Bacteria 2418
61 Ga0070692_10129494 3300005345 Bacteria 1417
62 Ga0070692_10388087 3300005345 Unclassified 878
63 Ga0070668_100637272 3300005347 Unclassified 935
64 Ga0070669_100005513 3300005353 Bacteria 9133
65 Ga0070669_100413504 3300005353 Unclassified 1106
66 Ga0070675_100083870 3300005354 Unclassified 2661
67 Ga0070675_100180385 3300005354 Bacteria 1825
68 Ga0070675_100901965 3300005354 Unclassified 810
69 Ga0070671_100012037 3300005355 Bacteria 6961
70 Ga0070671_100048020 3300005355 Bacteria 3549
71 Ga0070674_100066360 3300005356 Bacteria 2535
72 Ga0070674_100468271 3300005356 Unclassified 1043
73 Ga0070673_100201076 3300005364 Unclassified 1716
74 Ga0070673_100245260 3300005364 Bacteria 1559
75 Ga0070673_100837808 3300005364 Unclassified 851
76 Ga0070688_100645091 3300005365 Unclassified 815
77 Ga0070659_100013426 3300005366 Bacteria 6096
78 Ga0070659_100028472 3300005366 Bacteria 4315
79 Ga0070659_100409876 3300005366 Unclassified 1145
80 Ga0070667_100233486 3300005367 Bacteria 1640
81 Ga0070667_101009405 3300005367 Unclassified 776
82 Ga0070703_10029959 3300005406 Bacteria 1637
83 Ga0070701_10022279 3300005438 Bacteria 3035
84 Ga0070701_10046662 3300005438 Bacteria 2228
85 Ga0070701_10168438 3300005438 Unclassified 1274
86 Ga0070701_10212002 3300005438 Bacteria 1150
87 Ga0070711_100362998 3300005439 Bacteria 1167
88 Ga0070705_100001672 3300005440 Bacteria 11606
89 Ga0070705_100130880 3300005440 Bacteria 1636
90 Ga0070705_100326425 3300005440 Bacteria 1110
91 Ga0070705_100998005 3300005440 Bacteria 679
92 Ga0070700_100000392 3300005441 Bacteria 22584
93 Ga0070700_100002664 3300005441 Bacteria 9128
94 Ga0070700_100008886 3300005441 Bacteria 5494
95 Ga0070700_100033829 3300005441 Bacteria 3082
96 Ga0070700_100171209 3300005441 Bacteria 1504
97 Ga0070700_100173291 3300005441 Bacteria 1496
98 Ga0070694_100027334 3300005444 Bacteria 3704
99 Ga0070694_100044718 3300005444 Bacteria 2964
100 Ga0070694_100052346 3300005444 Unclassified 2759
101 Ga0070694_100082332 3300005444 Bacteria 2241
102 Ga0070694_100187216 3300005444 Bacteria 1535
103 Ga0070694_100368868 3300005444 Bacteria 1117
104 Ga0070694_100570494 3300005444 Bacteria 908
105 Ga0070694_100933715 3300005444 Unclassified 718
106 Ga0070708_100000330 3300005445 Bacteria 35639
107 Ga0070708_100161811 3300005445 Bacteria 2086
108 Ga0070708_100411133 3300005445 Unclassified 1276
109 Ga0070708_101087413 3300005445 Bacteria 749
110 Ga0070663_100273465 3300005455 Bacteria 1344
111 Ga0070662_100138587 3300005457 Bacteria 1883
112 Ga0070662_100160493 3300005457 Bacteria 1758
113 Ga0070662_100274486 3300005457 Unclassified 1362
114 Ga0070681_10000095 3300005458 Bacteria 65410
115 Ga0070681_10003800 3300005458 Bacteria 14187
116 Ga0070681_10009934 3300005458 Bacteria 9377
117 Ga0068867_100081208 3300005459 Bacteria 2444
118 Ga0068867_100377660 3300005459 Bacteria 1190
119 Ga0068867_100767326 3300005459 Bacteria 857
120 Ga0070685_10493129 3300005466 Unclassified 865
121 Ga0070706_100000920 3300005467 Bacteria 32204
122 Ga0070706_100005282 3300005467 Bacteria 12316
123 Ga0070706_100010741 3300005467 Bacteria 8497
124 Ga0070706_100026011 3300005467 Bacteria 5385
125 Ga0070706_100458808 3300005467 Unclassified 1186
126 Ga0070706_100873558 3300005467 Unclassified 831
127 Ga0070707_100030588 3300005468 Bacteria 5127
128 Ga0070707_100081463 3300005468 Bacteria 3125
129 Ga0070707_100123066 3300005468 Bacteria 2519
130 Ga0070707_100624322 3300005468 Bacteria 1040
131 Ga0070707_100664255 3300005468 Bacteria 1005
132 Ga0070698_100002075 3300005471 Bacteria 22276
133 Ga0070698_100025445 3300005471 Bacteria 6170
134 Ga0070698_100067712 3300005471 Unclassified 3590
135 Ga0070698_100085663 3300005471 Bacteria 3137
136 Ga0070699_100000914 3300005518 Bacteria 27512
137 Ga0070699_100000990 3300005518 Bacteria 26429
138 Ga0070699_100014937 3300005518 Bacteria 6673
139 Ga0070699_100031605 3300005518 Unclassified 4571
140 Ga0070699_100178179 3300005518 Bacteria 1885
141 Ga0070699_100329888 3300005518 Bacteria 1372
142 Ga0070699_100411318 3300005518 Bacteria 1224
143 Ga0070699_100702647 3300005518 Bacteria 924
144 Ga0070679_100000661 3300005530 Bacteria 29364
145 Ga0070679_100002862 3300005530 Bacteria 15682
146 Ga0070697_100000174 3300005536 Bacteria 52444
147 Ga0070697_100000325 3300005536 Bacteria 37744
148 Ga0070697_100006752 3300005536 Bacteria 8900
149 Ga0070697_100018875 3300005536 Bacteria 5441
150 Ga0070697_100384812 3300005536 Unclassified 1215
151 Ga0068853_100023964 3300005539 Bacteria 5115
152 Ga0068853_100303112 3300005539 Bacteria 1477
153 Ga0068853_100630530 3300005539 Unclassified 1019
154 Ga0068853_101127395 3300005539 Bacteria 757
155 Ga0070672_100077574 3300005543 Bacteria 2657
156 Ga0070672_100329522 3300005543 Unclassified 1299
157 Ga0070686_100004099 3300005544 Bacteria 8018
158 Ga0070686_100021276 3300005544 Bacteria 3853
159 Ga0070686_100089579 3300005544 Unclassified 2055
160 Ga0070695_100023645 3300005545 Bacteria 3780
161 Ga0070695_100041337 3300005545 Bacteria 2922
162 Ga0070695_100043655 3300005545 Bacteria 2851
163 Ga0070695_100048864 3300005545 Bacteria 2707
164 Ga0070695_100114936 3300005545 Bacteria 1833
165 Ga0070695_100133416 3300005545 Unclassified 1714
166 Ga0070695_100331944 3300005545 Bacteria 1134
167 Ga0070695_100403242 3300005545 Bacteria 1037
168 Ga0070695_100526672 3300005545 Bacteria 918
169 Ga0070696_100028560 3300005546 Unclassified 3806
170 Ga0070696_100047659 3300005546 Unclassified 2974
171 Ga0070696_100067725 3300005546 Bacteria 2506
172 Ga0070696_100099032 3300005546 Bacteria 2086
173 Ga0070696_100153677 3300005546 Unclassified 1691
174 Ga0070696_100156838 3300005546 Bacteria 1675
175 Ga0070696_100267293 3300005546 Bacteria 1299
176 Ga0070696_100514967 3300005546 Bacteria 954
177 Ga0070693_100003349 3300005547 Bacteria 7451
178 Ga0070693_100042123 3300005547 Bacteria 2572
179 Ga0070693_100051218 3300005547 Bacteria 2363
180 Ga0070693_100161839 3300005547 Bacteria 1426
181 Ga0070693_100269193 3300005547 Unclassified 1136
182 Ga0070693_100784649 3300005547 Archaea 705
183 Ga0070665_100119528 3300005548 Unclassified 2637
184 Ga0070665_100128446 3300005548 Bacteria 2537
185 Ga0070665_101132489 3300005548 Unclassified 794
186 Ga0070704_100050357 3300005549 Bacteria 2927
187 Ga0070704_100223597 3300005549 Bacteria 1532
188 Ga0070704_100238613 3300005549 Bacteria 1487
189 Ga0070664_100007298 3300005564 Bacteria 8909
190 Ga0070664_100152059 3300005564 Unclassified 2044
191 Ga0070664_100415179 3300005564 Unclassified 1232
192 Ga0068857_100002004 3300005577 Bacteria 16509
193 Ga0068857_100395442 3300005577 Bacteria 1285
194 Ga0068857_100775050 3300005577 Bacteria 915
195 Ga0068857_101030410 3300005577 Bacteria 793
196 Ga0068854_100043695 3300005578 Bacteria 3178
197 Ga0068854_100186610 3300005578 Unclassified 1623
198 Ga0068854_100262659 3300005578 Bacteria 1383
199 Ga0068854_100461311 3300005578 Bacteria 1063
200 Ga0070702_100037032 3300005615 Unclassified 2707
201 Ga0070702_100068563 3300005615 Unclassified 2088
202 Ga0070702_100100875 3300005615 Bacteria 1770
203 Ga0070702_100144956 3300005615 Bacteria 1517
204 Ga0070702_100436032 3300005615 Unclassified 947
205 Ga0068852_100141097 3300005616 Bacteria 2230
206 Ga0068859_100006657 3300005617 Bacteria 11735
207 Ga0068859_100017192 3300005617 Bacteria 7262
208 Ga0068859_100019681 3300005617 Bacteria 6779
209 Ga0068859_100089226 3300005617 Bacteria 3133
210 Ga0068859_100151006 3300005617 Bacteria 2398
211 Ga0068859_100175388 3300005617 Bacteria 2225
212 Ga0068859_100225087 3300005617 Bacteria 1964
213 Ga0068859_100263974 3300005617 Bacteria 1813
214 Ga0068859_100303299 3300005617 Bacteria 1690
215 Ga0068859_100315314 3300005617 Bacteria 1657
216 Ga0068859_100413150 3300005617 Bacteria 1445
217 Ga0068859_100423862 3300005617 Bacteria 1427
218 Ga0068859_100532575 3300005617 Bacteria 1269
219 Ga0068859_100657599 3300005617 Bacteria 1140
220 Ga0068859_100848974 3300005617 Unclassified 999
221 Ga0068859_101106371 3300005617 Unclassified 871
222 Ga0068864_100042911 3300005618 Bacteria 3871
223 Ga0068864_100067870 3300005618 Unclassified 3097
224 Ga0068864_100076919 3300005618 Bacteria 2917
225 Ga0068864_100097331 3300005618 Unclassified 2605
226 Ga0068864_100172325 3300005618 Bacteria 1974
227 Ga0068864_100201703 3300005618 Bacteria 1828
228 Ga0068864_100278558 3300005618 Bacteria 1560
229 Ga0068864_100382257 3300005618 Bacteria 1334
230 Ga0068864_100461908 3300005618 Bacteria 1216
231 Ga0068866_10309547 3300005718 Bacteria 989
232 Ga0068861_100005081 3300005719 Bacteria 8876
233 Ga0068861_100050654 3300005719 Bacteria 3150
234 Ga0068861_100078084 3300005719 Bacteria 2584
235 Ga0068861_100194980 3300005719 Bacteria 1696
236 Ga0068861_100510834 3300005719 Bacteria 1088
237 Ga0068870_10086706 3300005840 Bacteria 1742
238 Ga0068870_10142750 3300005840 Bacteria 1402
239 Ga0068870_10214095 3300005840 Bacteria 1175
240 Ga0068863_100447516 3300005841 Bacteria 1267
241 Ga0068858_100018036 3300005842 Bacteria 6610
242 Ga0068858_100117797 3300005842 Bacteria 2482
243 Ga0068858_100133146 3300005842 Bacteria 2332
244 Ga0068858_100230511 3300005842 Unclassified 1756
245 Ga0068858_100332267 3300005842 Unclassified 1454
246 Ga0068858_100407258 3300005842 Bacteria 1307
247 Ga0068858_100497074 3300005842 Bacteria 1178
248 Ga0068858_100641704 3300005842 Bacteria 1032
249 Ga0068860_100015460 3300005843 Bacteria 7451
250 Ga0068860_100074048 3300005843 Bacteria 3237
251 Ga0068860_100129907 3300005843 Bacteria 2417
252 Ga0068860_100166909 3300005843 Bacteria 2125
253 Ga0068860_100287712 3300005843 Bacteria 1607
254 Ga0068860_100441593 3300005843 Bacteria 1292
255 Ga0068860_100551773 3300005843 Unclassified 1154
256 Ga0068862_100021969 3300005844 Bacteria 5337
257 Ga0068862_100022514 3300005844 Bacteria 5271
258 Ga0068862_100048897 3300005844 Bacteria 3611
259 Ga0068862_100525441 3300005844 Bacteria 1127
260 Ga0081539_10000976 3300005985 Bacteria 53364
261 Ga0081539_10020530 3300005985 Bacteria 4459
262 Ga0081539_10073417 3300005985 Unclassified 1825
263 Ga0070715_10000045 3300006163 Bacteria 58311
264 Ga0070716_100013600 3300006173 Bacteria 4151
265 Ga0097621_100237930 3300006237 Bacteria 1591
266 Ga0097621_100263173 3300006237 Bacteria 1513
267 Ga0097621_100321989 3300006237 Bacteria 1370
268 Ga0068871_100096373 3300006358 Bacteria 2471
269 Ga0068871_100219312 3300006358 Bacteria 1647
270 Ga0068871_100430087 3300006358 Bacteria 1180
271 Ga0075428_100398130 3300006844 Unclassified 1476
272 Ga0075428_100426144 3300006844 Bacteria 1421
273 Ga0075428_100832870 3300006844 Bacteria 980
274 Ga0075430_100093025 3300006846 Bacteria 2520
275 Ga0075430_100213066 3300006846 Bacteria 1603
276 Ga0075431_100200886 3300006847 Bacteria 2039
277 Ga0075431_100925555 3300006847 Archaea 841
278 Ga0075431_100926485 3300006847 Unclassified 840
279 Ga0075433_10004151 3300006852 Bacteria 11245
280 Ga0075433_10023049 3300006852 Bacteria 5236
281 Ga0075433_10037824 3300006852 Bacteria 4164
282 Ga0075433_10086817 3300006852 Bacteria 2763
283 Ga0075433_10091424 3300006852 Bacteria 2690
284 Ga0075433_10130281 3300006852 Bacteria 2235
285 Ga0075433_10256605 3300006852 Bacteria 1550
286 Ga0075433_10823925 3300006852 Bacteria 810
287 Ga0075434_100042227 3300006871 Bacteria 4520
288 Ga0075434_100100465 3300006871 Bacteria 2899
289 Ga0075429_100083913 3300006880 Bacteria 2777
290 Ga0068865_100347548 3300006881 Bacteria 1200
291 Ga0075436_100000008 3300006914 Bacteria 279288
292 Ga0075436_100048045 3300006914 Bacteria 2945
293 Ga0097620_100006657 3300006931 Bacteria 11735
294 Ga0097620_100017191 3300006931 Bacteria 7262
295 Ga0097620_100019680 3300006931 Bacteria 6779
296 Ga0097620_100043289 3300006931 Bacteria 4525
297 Ga0097620_100089227 3300006931 Bacteria 3133
298 Ga0097620_100151014 3300006931 Bacteria 2398
299 Ga0097620_100175384 3300006931 Bacteria 2225
300 Ga0097620_100225068 3300006931 Bacteria 1964
301 Ga0097620_100263981 3300006931 Bacteria 1813
302 Ga0097620_100303314 3300006931 Bacteria 1690
303 Ga0097620_100315332 3300006931 Bacteria 1657
304 Ga0097620_100413159 3300006931 Bacteria 1445
305 Ga0097620_100423805 3300006931 Bacteria 1427
306 Ga0097620_100532586 3300006931 Bacteria 1269
307 Ga0097620_100657636 3300006931 Bacteria 1140
308 Ga0097620_100849125 3300006931 Unclassified 999
309 Ga0097620_101106364 3300006931 Unclassified 871
310 Ga0075435_100008739 3300007076 Bacteria 7288
311 Ga0075435_100029502 3300007076 Bacteria 4305
312 Ga0075435_100182642 3300007076 Bacteria 1773
313 Ga0099794_10001526 3300007265 Bacteria 8143
314 Ga0105240_10043576 3300009093 Bacteria 5708
315 Ga0105240_10484230 3300009093 Bacteria 1378
316 Ga0105240_11080833 3300009093 Unclassified 854
317 Ga0111539_10013191 3300009094 Bacteria 10332
318 Ga0111539_10078287 3300009094 Unclassified 3890
319 Ga0111539_10270397 3300009094 Unclassified 1978
320 Ga0111539_10313525 3300009094 Bacteria 1826
321 Ga0111539_10450078 3300009094 Bacteria 1499
322 Ga0111539_10535986 3300009094 Bacteria 1364
323 Ga0105245_10482534 3300009098 Bacteria 1253
324 Ga0105245_11064853 3300009098 Bacteria 854
325 Ga0105247_10003286 3300009101 Bacteria 10592
326 Ga0105247_10040801 3300009101 Bacteria 2839
327 Ga0105247_10047356 3300009101 Bacteria 2640
328 Ga0114129_10001731 3300009147 Bacteria 29753
329 Ga0114129_10025543 3300009147 Bacteria 8368
330 Ga0114129_10209589 3300009147 Bacteria 2635
331 Ga0114129_10277961 3300009147 Bacteria 2238
332 Ga0114129_10312521 3300009147 Bacteria 2091
333 Ga0114129_10321186 3300009147 Unclassified 2058
334 Ga0114129_10652020 3300009147 Unclassified 1358
335 Ga0114129_10701659 3300009147 Unclassified 1300
336 Ga0114129_10715848 3300009147 Unclassified 1285
337 Ga0114129_10990201 3300009147 Unclassified 1059
338 Ga0114129_11139385 3300009147 Bacteria 974
339 Ga0105243_10225675 3300009148 Bacteria 1659
340 Ga0105243_10342445 3300009148 Bacteria 1370
341 Ga0105243_10344509 3300009148 Bacteria 1366
342 Ga0105243_10434031 3300009148 Unclassified 1228
343 Ga0105243_10739279 3300009148 Unclassified 963
344 Ga0105241_10045247 3300009174 Bacteria 3339
345 Ga0105241_10105673 3300009174 Bacteria 2246
346 Ga0105241_10179487 3300009174 Bacteria 1755
347 Ga0105241_10284695 3300009174 Bacteria 1413
348 Ga0105241_10327497 3300009174 Bacteria 1323
349 Ga0105241_10331239 3300009174 Bacteria 1316
350 Ga0105241_10625254 3300009174 Bacteria 975
351 Ga0105241_10633856 3300009174 Bacteria 969
352 Ga0105242_10011786 3300009176 Bacteria 6728
353 Ga0105242_10017081 3300009176 Bacteria 5650
354 Ga0105242_10038746 3300009176 Bacteria 3834
355 Ga0105242_10307559 3300009176 Unclassified 1449
356 Ga0105242_11600960 3300009176 Bacteria 685
357 Ga0105248_10013752 3300009177 Bacteria 8909
358 Ga0105248_10028668 3300009177 Bacteria 6204
359 Ga0105248_10036636 3300009177 Bacteria 5487
360 Ga0105248_10110692 3300009177 Bacteria 3097
361 Ga0105248_10435829 3300009177 Bacteria 1476
362 Ga0105237_10001285 3300009545 Bacteria 33426
363 Ga0105237_10173116 3300009545 Bacteria 2159
364 Ga0105237_10488701 3300009545 Unclassified 1237
365 Ga0105237_11213013 3300009545 Unclassified 761
366 Ga0105238_10043815 3300009551 Bacteria 4527
367 Ga0105238_10067040 3300009551 Bacteria 3591
368 Ga0105238_10339156 3300009551 Bacteria 1491
369 Ga0105238_11132119 3300009551 Bacteria 806
370 Ga0105249_10009785 3300009553 Bacteria 8399
371 Ga0105249_10017244 3300009553 Bacteria 6409
372 Ga0105249_10358107 3300009553 Bacteria 1480
373 Ga0105249_11015660 3300009553 Unclassified 898
374 Ga0105239_10117907 3300010375 Bacteria 2946
375 Ga0105239_10223868 3300010375 Bacteria 2110
376 Ga0105239_10369032 3300010375 Bacteria 1622
377 Ga0105246_10172778 3300011119 Bacteria 1657
378 Ga0105246_10223913 3300011119 Bacteria 1476
379 Ga0105246_10297072 3300011119 Bacteria 1302
380 Ga0105246_10623644 3300011119 Bacteria 935
381 Ga0157373_10007476 3300013100 Bacteria 8129
382 Ga0157373_10201204 3300013100 Bacteria 1404
383 Ga0157373_10204644 3300013100 Bacteria 1392
384 Ga0157374_10255905 3300013296 Bacteria 1723
385 Ga0157374_10669584 3300013296 Unclassified 1050
386 Ga0157374_11177892 3300013296 Bacteria 787
387 Ga0157378_10030978 3300013297 Bacteria 4723
388 Ga0157378_10032510 3300013297 Bacteria 4609
389 Ga0157378_10197595 3300013297 Bacteria 1900
390 Ga0157378_10224034 3300013297 Unclassified 1789
391 Ga0157378_10251519 3300013297 Bacteria 1692
392 Ga0157378_10287630 3300013297 Bacteria 1586
393 Ga0157378_10331165 3300013297 Unclassified 1482
394 Ga0157378_10427911 3300013297 Bacteria 1309
395 Ga0163162_10000646 3300013306 Bacteria 32306
396 Ga0163162_10016908 3300013306 Bacteria 7132
397 Ga0163162_10052051 3300013306 Bacteria 4111
398 Ga0163162_10192091 3300013306 Bacteria 2169
399 Ga0163162_10228489 3300013306 Bacteria 1991
400 Ga0163162_10636161 3300013306 Unclassified 1191
401 Ga0163162_10866607 3300013306 Bacteria 1018
402 Ga0163162_11073622 3300013306 Bacteria 912
403 Ga0163162_11408159 3300013306 Bacteria 793
404 Ga0157372_10047127 3300013307 Unclassified 4788
405 Ga0157372_10191169 3300013307 Bacteria 2371
406 Ga0157372_10558554 3300013307 Unclassified 1334
407 Ga0157372_10726538 3300013307 Bacteria 1155
408 Ga0157375_10071478 3300013308 Bacteria 3483
409 Ga0157375_10076089 3300013308 Bacteria 3382
410 Ga0157375_10172629 3300013308 Bacteria 2310
411 Ga0157375_10523404 3300013308 Unclassified 1349
412 Ga0157375_10701775 3300013308 Bacteria 1165
413 Ga0157375_11442819 3300013308 Bacteria 811
414 Ga0157375_11546170 3300013308 Unclassified 784
415 Ga0157375_11819152 3300013308 Unclassified 722
416 Ga0163163_10000773 3300014325 Bacteria 27136
417 Ga0163163_10003689 3300014325 Bacteria 13038
418 Ga0163163_10004586 3300014325 Bacteria 11799
419 Ga0163163_10016065 3300014325 Bacteria 6942
420 Ga0163163_10021176 3300014325 Bacteria 6132
421 Ga0163163_10345640 3300014325 Bacteria 1543
422 Ga0163163_10483357 3300014325 Bacteria 1300
423 Ga0163163_10595663 3300014325 Bacteria 1169
424 Ga0163163_10638868 3300014325 Bacteria 1128
425 Ga0157380_10007451 3300014326 Bacteria 7769
426 Ga0157380_10029387 3300014326 Unclassified 4201
427 Ga0157380_10200031 3300014326 Bacteria 1772
428 Ga0157380_10220334 3300014326 Bacteria 1697
429 Ga0157380_10367708 3300014326 Bacteria 1352
430 Ga0157377_10032732 3300014745 Bacteria 2833
431 Ga0157377_10737038 3300014745 Unclassified 720
432 Ga0157379_10177826 3300014968 Bacteria 1922
433 Ga0157379_10329901 3300014968 Bacteria 1394
434 Ga0157379_10602125 3300014968 Bacteria 1026
435 Ga0157376_10029698 3300014969 Unclassified 4357
436 Ga0157376_10703679 3300014969 Bacteria 1016
437 Ga0163161_10303473 3300017792 Unclassified 1258
438 Ga0163161_10320553 3300017792 Bacteria 1225
439 Ga0163161_10735189 3300017792 Unclassified 824
440 Ga0207697_10004359 3300025315 Bacteria 6771
441 Ga0207653_10002447 3300025885 Bacteria 5899
442 Ga0207642_10377715 3300025899 Bacteria 842
443 Ga0207710_10001033 3300025900 Bacteria 14417
444 Ga0207710_10070222 3300025900 Bacteria 1604
445 Ga0207710_10223739 3300025900 Bacteria 935
446 Ga0207647_10005143 3300025904 Bacteria 9627
447 Ga0207647_10251488 3300025904 Bacteria 1013
448 Ga0207685_10000009 3300025905 Bacteria 242842
449 Ga0207685_10000032 3300025905 Bacteria 69450
450 Ga0207645_10029984 3300025907 Bacteria 3505
451 Ga0207643_10001012 3300025908 Bacteria 16739
452 Ga0207643_10050593 3300025908 Bacteria 2356
453 Ga0207643_10161341 3300025908 Bacteria 1349
454 Ga0207643_10276517 3300025908 Unclassified 1040
455 Ga0207684_10000085 3300025910 Bacteria 175922
456 Ga0207684_10011608 3300025910 Bacteria 7697
457 Ga0207684_10011671 3300025910 Bacteria 7669
458 Ga0207684_10017764 3300025910 Bacteria 6102
459 Ga0207684_10053455 3300025910 Bacteria 3428
460 Ga0207654_10032242 3300025911 Bacteria 2893
461 Ga0207654_10072223 3300025911 Bacteria 2054
462 Ga0207654_10266481 3300025911 Unclassified 1154
463 Ga0207654_10478435 3300025911 Bacteria 877
464 Ga0207707_10000503 3300025912 Bacteria 40256
465 Ga0207707_10008289 3300025912 Bacteria 9018
466 Ga0207707_10008326 3300025912 Bacteria 8996
467 Ga0207695_10076318 3300025913 Bacteria 3407
468 Ga0207671_10010970 3300025914 Bacteria 7423
469 Ga0207671_10043002 3300025914 Bacteria 3342
470 Ga0207660_10003576 3300025917 Bacteria 10120
471 Ga0207660_10044968 3300025917 Unclassified 3109
472 Ga0207660_10185945 3300025917 Bacteria 1616
473 Ga0207662_10046077 3300025918 Bacteria 2578
474 Ga0207662_10061987 3300025918 Bacteria 2246
475 Ga0207662_10098141 3300025918 Bacteria 1812
476 Ga0207662_10222710 3300025918 Bacteria 1229
477 Ga0207657_10088154 3300025919 Bacteria 2594
478 Ga0207652_10000427 3300025921 Bacteria 43779
479 Ga0207652_10177824 3300025921 Bacteria 1911
480 Ga0207646_10005836 3300025922 Bacteria 12878
481 Ga0207646_10044492 3300025922 Unclassified 3986
482 Ga0207646_10263808 3300025922 Bacteria 1556
483 Ga0207646_10535404 3300025922 Bacteria 1054
484 Ga0207646_10661245 3300025922 Bacteria 936
485 Ga0207646_10688738 3300025922 Unclassified 914
486 Ga0207681_10035151 3300025923 Bacteria 3300
487 Ga0207681_10094768 3300025923 Bacteria 2140
488 Ga0207681_10316600 3300025923 Bacteria 1239
489 Ga0207694_10019854 3300025924 Bacteria 5083
490 Ga0207694_10027332 3300025924 Bacteria 4345
491 Ga0207650_10000028 3300025925 Bacteria 236867
492 Ga0207650_10661032 3300025925 Bacteria 881
493 Ga0207650_10712830 3300025925 Unclassified 848
494 Ga0207659_10129799 3300025926 Unclassified 1944
495 Ga0207644_10000207 3300025931 Bacteria 40948
496 Ga0207644_10463697 3300025931 Unclassified 1042
497 Ga0207690_10015844 3300025932 Bacteria 4576
498 Ga0207690_10017808 3300025932 Bacteria 4347
499 Ga0207690_10253778 3300025932 Unclassified 1360
500 Ga0207706_10129322 3300025933 Bacteria 2221
501 Ga0207706_10216928 3300025933 Bacteria 1676
502 Ga0207686_10000383 3300025934 Bacteria 30902
503 Ga0207686_10145509 3300025934 Bacteria 1643
504 Ga0207686_10217742 3300025934 Bacteria 1377
505 Ga0207709_10005354 3300025935 Bacteria 7301
506 Ga0207670_10000754 3300025936 Bacteria 17010
507 Ga0207670_10113438 3300025936 Bacteria 1958
508 Ga0207670_10526182 3300025936 Bacteria 963
509 Ga0207669_10042143 3300025937 Bacteria 2662
510 Ga0207669_10542888 3300025937 Unclassified 937
511 Ga0207704_10277164 3300025938 Bacteria 1273
512 Ga0207704_10587538 3300025938 Unclassified 910
513 Ga0207665_10032441 3300025939 Bacteria 3458
514 Ga0207691_10086701 3300025940 Bacteria 2809
515 Ga0207691_10293289 3300025940 Bacteria 1398
516 Ga0207691_10803628 3300025940 Unclassified 790
517 Ga0207711_10049477 3300025941 Bacteria 3599
518 Ga0207711_10506978 3300025941 Unclassified 1125
519 Ga0207689_10064851 3300025942 Bacteria 3004
520 Ga0207689_10068221 3300025942 Unclassified 2923
521 Ga0207689_10078828 3300025942 Bacteria 2707
522 Ga0207689_10111150 3300025942 Unclassified 2252
523 Ga0207689_10315571 3300025942 Bacteria 1297
524 Ga0207689_10495578 3300025942 Bacteria 1023
525 Ga0207689_10582274 3300025942 Bacteria 941
526 Ga0207661_10612180 3300025944 Unclassified 1000
527 Ga0207679_10173756 3300025945 Bacteria 1776
528 Ga0207679_10496639 3300025945 Unclassified 1088
529 Ga0207679_10693662 3300025945 Unclassified 923
530 Ga0207679_10761465 3300025945 Unclassified 881
531 Ga0207667_10734745 3300025949 Bacteria 987
532 Ga0207651_10065347 3300025960 Bacteria 2551
533 Ga0207651_10129562 3300025960 Unclassified 1929
534 Ga0207651_10172844 3300025960 Unclassified 1706
535 Ga0207651_10183238 3300025960 Bacteria 1663
536 Ga0207651_10784892 3300025960 Unclassified 844
537 Ga0207712_10031040 3300025961 Bacteria 3596
538 Ga0207712_10076743 3300025961 Unclassified 2420
539 Ga0207712_10120186 3300025961 Unclassified 1986
540 Ga0207668_10582588 3300025972 Unclassified 973
541 Ga0207640_10028375 3300025981 Bacteria 3421
542 Ga0207640_10060623 3300025981 Bacteria 2502
543 Ga0207640_10355710 3300025981 Bacteria 1178
544 Ga0207677_10054029 3300026023 Bacteria 2738
545 Ga0207677_10299197 3300026023 Bacteria 1328
546 Ga0207703_10192277 3300026035 Unclassified 1808
547 Ga0207703_10299029 3300026035 Bacteria 1467
548 Ga0207703_10762724 3300026035 Bacteria 922
549 Ga0207639_10134410 3300026041 Bacteria 2052
550 Ga0207639_10282545 3300026041 Bacteria 1460
551 Ga0207708_10000426 3300026075 Bacteria 32859
552 Ga0207708_10002961 3300026075 Bacteria 12514
553 Ga0207708_10015598 3300026075 Bacteria 5698
554 Ga0207708_10034283 3300026075 Bacteria 3861
555 Ga0207708_10042862 3300026075 Bacteria 3448
556 Ga0207708_10084532 3300026075 Unclassified 2440
557 Ga0207708_10328191 3300026075 Bacteria 1250
558 Ga0207708_10490569 3300026075 Bacteria 1028
559 Ga0207702_10016026 3300026078 Bacteria 6204
560 Ga0207641_10086368 3300026088 Bacteria 2735
561 Ga0207641_10218642 3300026088 Bacteria 1765
562 Ga0207648_10052391 3300026089 Bacteria 3568
563 Ga0207648_10060312 3300026089 Bacteria 3308
564 Ga0207648_10122489 3300026089 Unclassified 2287
565 Ga0207648_10269186 3300026089 Unclassified 1522
566 Ga0207676_10032387 3300026095 Bacteria 3938
567 Ga0207676_10170089 3300026095 Bacteria 1897
568 Ga0207676_10238295 3300026095 Bacteria 1630
569 Ga0207676_10288710 3300026095 Bacteria 1492
570 Ga0207676_10440867 3300026095 Unclassified 1226
571 Ga0207676_10794311 3300026095 Bacteria 923
572 Ga0207676_10838111 3300026095 Unclassified 899
573 Ga0207674_10005298 3300026116 Bacteria 15341
574 Ga0207674_10150791 3300026116 Bacteria 2282
575 Ga0207674_10267320 3300026116 Bacteria 1657
576 Ga0207674_10368669 3300026116 Bacteria 1388
577 Ga0207674_11227242 3300026116 Bacteria 719
578 Ga0207675_100013849 3300026118 Bacteria 7520
579 Ga0207675_100017555 3300026118 Bacteria 6677
580 Ga0207675_100098892 3300026118 Bacteria 2748
581 Ga0207675_100203544 3300026118 Unclassified 1902
582 Ga0207675_100246835 3300026118 Bacteria 1727
583 Ga0207675_100324065 3300026118 Bacteria 1505
584 Ga0207675_100509531 3300026118 Bacteria 1199
585 Ga0207675_100518757 3300026118 Unclassified 1188
586 Ga0207698_10178355 3300026142 Unclassified 1879
587 Ga0207698_10234017 3300026142 Bacteria 1670
588 Ga0207428_10043805 3300027907 Bacteria 3613
589 Ga0207428_10181256 3300027907 Bacteria 1591
590 Ga0207428_10208965 3300027907 Bacteria 1467
591 Ga0268266_10451103 3300028379 Bacteria 1223
592 Ga0268265_10243942 3300028380 Unclassified 1587
593 Ga0268265_10487200 3300028380 Bacteria 1159
594 Ga0268264_10018654 3300028381 Bacteria 5672
595 Ga0268264_10025284 3300028381 Bacteria 4851
596 Ga0268264_10154082 3300028381 Bacteria 2063
597 Ga0268264_10208859 3300028381 Bacteria 1791
598 Ga0268264_10416103 3300028381 Bacteria 1295
599 Ga0268264_10812403 3300028381 Bacteria 935
600 Ga0268264_10931736 3300028381 Unclassified 873
601 Ga0265318_10020546 3300028577 Bacteria 2664
602 Ga0316182_1086315 3300030745 Bacteria 1164
603 Ga0265325_10019797 3300031241 Bacteria 3716
604 Ga0307408_100026857 3300031548 Unclassified 3960
605 Ga0307408_100179724 3300031548 Unclassified 1696
606 Ga0307408_101124211 3300031548 Bacteria 730
607 Ga0307405_10001871 3300031731 Bacteria 9038
608 Ga0307405_10130487 3300031731 Bacteria 1736
609 Ga0307405_10319772 3300031731 Bacteria 1185
610 Ga0307413_10053822 3300031824 Bacteria 2438
611 Ga0307413_10608381 3300031824 Unclassified 895
612 Ga0307410_10002925 3300031852 Bacteria 8416
613 Ga0307410_10597146 3300031852 Bacteria 920
614 Ga0307406_10004104 3300031901 Bacteria 7928
615 Ga0307406_10434768 3300031901 Bacteria 1049
616 Ga0307406_10973356 3300031901 Bacteria 726
617 Ga0307407_10024355 3300031903 Bacteria 3173
618 Ga0307407_10459955 3300031903 Bacteria 925
619 Ga0307412_10001510 3300031911 Bacteria 12923
620 Ga0307412_10475974 3300031911 Unclassified 1034
621 Ga0307409_100044204 3300031995 Bacteria 3353
622 Ga0307416_100008892 3300032002 Bacteria 6523
623 Ga0307416_100215514 3300032002 Unclassified 1836
624 Ga0307416_100730193 3300032002 Bacteria 1082
625 Ga0307414_10003378 3300032004 Bacteria 8522
626 Ga0307411_10068493 3300032005 Unclassified 2392
627 Ga0307411_10923840 3300032005 Unclassified 777
628 Ga0307415_100002268 3300032126 Bacteria 9535
629 Ga0307415_100135177 3300032126 Archaea 1874
630 Ga0307415_100338674 3300032126 Bacteria 1261
631 Ga0373951_0024486 3300035091 Unclassified 1398
632 Ga0373941_0030385 3300035115 Bacteria 1601
633 Ga0316574_0126388 3300035398 Bacteria 1644
634 Ga0373931_0117960 3300035691 Unclassified 1514
635 Ga0395900_0143297 3300037418 Bacteria 2446
636 Ga0395900_0185975 3300037418 Unclassified 2109
637 Ga0395900_0205655 3300037418 Bacteria 1990
638 Ga0395900_0633001 3300037418 Bacteria 1008
639 Ga0395898_0100412 3300037466 Unclassified 2779
640 Ga0395905_0010706 3300037471 Bacteria 8894
641 Ga0395901_0187422 3300038443 Bacteria 2170
642 Ga0242419_001286 3300038698 Unclassified 1525
643 Ga0242422_01110 3300038699 Unclassified 1839
644 Ga0242420_003918 3300038996 Bacteria 2222
645 Ga0436365_1230778 3300039437 Bacteria 38145
646 Ga0439448_0063497 3300042005 Bacteria 1223
647 Ga0439458_0015909 3300042157 Bacteria 1708
648 Ga0453683_0356555 3300044673 Unclassified 940
649 Ga0451576_0208076 3300045051 Unclassified 2043
650 Ga0451576_0386107 3300045051 Bacteria 1468
651 Ga0495662_0016088 3300046476 Bacteria 3627
652 Ga0495664_0241180 3300046477 Bacteria 1093
653 Ga0495608_0038537 3300046511 Bacteria 3209
654 Ga0495667_0108096 3300046559 Bacteria 1797
655 Ga0495625_0274315 3300046660 Unclassified 1087
656 Ga0495669_0232271 3300046684 Bacteria 885
657 Ga0495672_0227651 3300047320 Unclassified 917
658 Ga0496102_0605807 3300048905 Bacteria 1018
659 Ga0496102_1124599 3300048905 Unclassified 705
660 Ga0496103_0352905 3300048906 Unclassified 946
661 Ga0496104_0172756 3300048907 Bacteria 2072
662 Ga0496104_0412036 3300048907 Archaea 1263
663 Ga0496106_0112014 3300048909 Bacteria 2126
664 Ga0496106_0814094 3300048909 Bacteria 740
665 Ga0496107_0043471 3300048910 Unclassified 3228
666 Ga0496108_0137341 3300048911 Archaea 2105
667 Ga0496112_0112140 3300048915 Bacteria 2697
668 Ga0496112_0230485 3300048915 Bacteria 1807
669 Ga0496112_0402297 3300048915 Bacteria 1309
670 Ga0496112_0506794 3300048915 Unclassified 1142
671 Ga0496112_0727578 3300048915 Unclassified 919
672 Ga0496113_0034752 3300048916 Bacteria 3681
673 Ga0501291_032695 3300049514 Bacteria 884
674 Ga0501292_017470 3300049515 Unclassified 1135
675 Ga0501292_026428 3300049515 Unclassified 959
676 Ga0501296_001989 3300049519 Bacteria 2095
677 Ga0501297_009094 3300049520 Unclassified 1106
678 Ga0501298_005941 3300049521 Unclassified 1980
679 Ga0501298_010848 3300049521 Bacteria 1574
680 Ga0501298_011489 3300049521 Bacteria 1539
681 Ga0501299_001635 3300049522 Bacteria 2944
682 Ga0501300_025707 3300049523 Unclassified 864
683 Ga0501038_0005568 3300049574 Bacteria 11694
684 Ga0501072_0903638 3300049588 Bacteria 690
685 Ga0501075_0140718 3300049591 Bacteria 1839
686 Ga0501198_008561 3300049649 Bacteria 1488
687 Ga0501202_037818 3300049652 Unclassified 1032
688 Ga0501216_000878 3300049660 Bacteria 3805
689 Ga0501217_002871 3300049661 Bacteria 3440
690 Ga0501217_035654 3300049661 Bacteria 1245
691 Ga0501217_047396 3300049661 Archaea 1113
692 Ga0501223_004783 3300049663 Bacteria 2882
693 Ga0501223_071358 3300049663 Unclassified 686
694 Ga0501224_019702 3300049664 Bacteria 1005
695 Ga0501224_039015 3300049664 Unclassified 717
696 Ga0501227_000071 3300049665 Bacteria 15600
697 Ga0501235_006910 3300049669 Unclassified 2470
698 Ga0501235_111741 3300049669 Unclassified 676
699 Ga0501236_003172 3300049670 Bacteria 1906
700 Ga0501247_023987 3300049677 Unclassified 805
701 Ga0501249_032364 3300049679 Archaea 1169
702 Ga0501253_031668 3300049683 Bacteria 1013
703 Ga0501253_040244 3300049683 Bacteria 938
704 Ga0501257_021564 3300049686 Bacteria 1520
705 Ga0501258_010607 3300049687 Unclassified 977
706 Ga0501259_004720 3300049688 Bacteria 2161
707 Ga0501260_008003 3300049689 Bacteria 1037
708 Ga0501221_008346 3300049704 Bacteria 1799
709 Ga0501225_0001380 3300049705 Bacteria 7575
710 Ga0501225_0102847 3300049705 Unclassified 836
711 Ga0501229_008258 3300049706 Bacteria 1301
712 Ga0501234_005055 3300049707 Bacteria 2070
713 Ga0501079_0384107 3300049741 Bacteria 1101
714 Ga0501080_0530340 3300049742 Bacteria 1050
715 Ga0501081_0313717 3300049743 Bacteria 1152
716 Ga0501241_014452 3300049758 Bacteria 1434
717 Ga0501263_004085 3300049760 Unclassified 1593
718 Ga0501268_012518 3300049765 Bacteria 1358
719 Ga0501275_023997 3300049772 Unclassified 768
720 Ga0501282_005743 3300049778 Bacteria 1330
721 Ga0501283_016079 3300049779 Unclassified 1157
722 Ga0501226_000455 3300049853 Bacteria 5758
723 nmdc:mga05p37_101035_c1 3300050507 Bacteria 3552
724 nmdc:mga05p37_103865_c1 3300050507 Unclassified 3497
725 nmdc:mga05p37_253834_c1 3300050507 Unclassified 2108
726 nmdc:mga05p37_425696_c1 3300050507 Bacteria 1544
727 nmdc:mga05p37_683454_c1 3300050507 Bacteria 1143
728 nmdc:mga05p37_712863_c1 3300050507 Unclassified 1112
729 nmdc:mga09592_183165_c1 3300050508 Bacteria 1812
730 nmdc:mga09592_275006_c1 3300050508 Archaea 1461
731 nmdc:mga09592_363404_c1 3300050508 Bacteria 1252
732 nmdc:mga0qj67_293263_c1 3300050509 Unclassified 1318
733 nmdc:mga06r32_432332_c1 3300050510 Bacteria 1297
734 nmdc:mga08y16_15977_c1 3300050511 Bacteria 7890
735 nmdc:mga08y16_359115_c1 3300050511 Bacteria 1496
736 nmdc:mga08y16_421044_c1 3300050511 Bacteria 1365
737 nmdc:mga08y16_749423_c1 3300050511 Bacteria 973
738 nmdc:mga08y16_815149_c1 3300050511 Bacteria 925
739 nmdc:mga08y16_995223_c1 3300050511 Unclassified 819
740 nmdc:mga0n895_550589_c1 3300050512 Bacteria 1159
741 nmdc:mga0rr50_124335_c1 3300050513 Bacteria 2057
742 nmdc:mga0rr50_3070_c1 3300050513 Bacteria 9561
743 nmdc:mga08x19_10838_c1 3300050514 Bacteria 5481
744 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
745 nmdc:mga0a205_12324_c1 3300050515 Bacteria 7907
746 nmdc:mga0a205_131725_c1 3300050515 Bacteria 2400
747 nmdc:mga0a205_14894_c1 3300050515 Bacteria 7255
748 nmdc:mga0a205_172269_c1 3300050515 Bacteria 2060
749 nmdc:mga0a205_26768_c1 3300050515 Bacteria 5503
750 Ga0070698_100152683
751 CNAas_1000953
752 JGI24737J22298_10101882
753 JGI24751J29686_10000074
754 JGI25406J46586_10003242
755 Ga0065714_10064450
756 Ga0065704_10102768
757 Ga0065704_10166121
758 Ga0065712_10022669
759 Ga0065712_10033246
760 Ga0065712_10067784
761 Ga0065712_10077762
762 Ga0065715_10034878
763 Ga0065715_10091307
764 Ga0065715_10098282
765 Ga0065715_10098694
766 Ga0065715_10101185
767 Ga0065715_10106238
768 Ga0065715_10126237
769 Ga0065715_10177613
770 Ga0065707_10002958
771 Ga0065707_10102021
772 Ga0065707_10192599
773 Ga0065707_10450520
774 Ga0070676_10067199
775 Ga0070676_10214828
776 Ga0070676_10463509
777 Ga0070683_100389289
778 Ga0070690_100065921
779 Ga0070690_100409487
780 Ga0070690_100416374
781 Ga0070690_100647037
782 Ga0070670_100001763
783 Ga0070670_100048022
784 Ga0070670_100050584
785 Ga0070670_100147136
786 Ga0070670_100442455
787 Ga0068869_100169486
788 Ga0068869_100191680
789 Ga0068869_100238816
790 Ga0068869_100324855
791 Ga0068869_100421109
792 Ga0068869_100622703
793 Ga0070666_10282257
794 Ga0070666_10383670
795 Ga0070680_100000103
796 Ga0070680_100062450
797 Ga0070680_100436902
798 Ga0070682_100064536
799 Ga0068868_100048607
800 Ga0068868_100290926
801 Ga0070660_100035921
802 Ga0070689_100002181
803 Ga0070689_100020424
804 Ga0070689_100235140
805 Ga0070689_101280842
806 Ga0070687_100042227
807 Ga0070687_100065994
808 Ga0070661_100011061
809 Ga0070692_10039192
810 Ga0070692_10129494
811 Ga0070692_10388087
812 Ga0070668_100637272
813 Ga0070669_100005513
814 Ga0070669_100413504
815 Ga0070675_100083870
816 Ga0070675_100180385
817 Ga0070675_100901965
818 Ga0070671_100012037
819 Ga0070671_100048020
820 Ga0070674_100066360
821 Ga0070674_100468271
822 Ga0070673_100201076
823 Ga0070673_100245260
824 Ga0070673_100837808
825 Ga0070688_100645091
826 Ga0070659_100013426
827 Ga0070659_100028472
828 Ga0070659_100409876
829 Ga0070667_100233486
830 Ga0070667_101009405
831 Ga0070703_10029959
832 Ga0070701_10022279
833 Ga0070701_10046662
834 Ga0070701_10168438
835 Ga0070701_10212002
836 Ga0070711_100362998
837 Ga0070705_100001672
838 Ga0070705_100130880
839 Ga0070705_100326425
840 Ga0070705_100998005
841 Ga0070700_100000392
842 Ga0070700_100002664
843 Ga0070700_100008886
844 Ga0070700_100033829
845 Ga0070700_100171209
846 Ga0070700_100173291
847 Ga0070694_100027334
848 Ga0070694_100044718
849 Ga0070694_100052346
850 Ga0070694_100082332
851 Ga0070694_100187216
852 Ga0070694_100368868
853 Ga0070694_100570494
854 Ga0070694_100933715
855 Ga0070708_100000330
856 Ga0070708_100161811
857 Ga0070708_100411133
858 Ga0070708_101087413
859 Ga0070663_100273465
860 Ga0070662_100138587
861 Ga0070662_100160493
862 Ga0070662_100274486
863 Ga0070681_10000095
864 Ga0070681_10003800
865 Ga0070681_10009934
866 Ga0068867_100081208
867 Ga0068867_100377660
868 Ga0068867_100767326
869 Ga0070685_10493129
870 Ga0070706_100000920
871 Ga0070706_100005282
872 Ga0070706_100010741
873 Ga0070706_100026011
874 Ga0070706_100458808
875 Ga0070706_100873558
876 Ga0070707_100030588
877 Ga0070707_100081463
878 Ga0070707_100123066
879 Ga0070707_100624322
880 Ga0070707_100664255
881 Ga0070698_100002075
882 Ga0070698_100025445
883 Ga0070698_100067712
884 Ga0070698_100085663
885 Ga0070699_100000914
886 Ga0070699_100000990
887 Ga0070699_100014937
888 Ga0070699_100031605
889 Ga0070699_100178179
890 Ga0070699_100329888
891 Ga0070699_100411318
892 Ga0070699_100702647
893 Ga0070679_100000661
894 Ga0070679_100002862
895 Ga0070697_100000174
896 Ga0070697_100000325
897 Ga0070697_100006752
898 Ga0070697_100018875
899 Ga0070697_100384812
900 Ga0068853_100023964
901 Ga0068853_100303112
902 Ga0068853_100630530
903 Ga0068853_101127395
904 Ga0070672_100077574
905 Ga0070672_100329522
906 Ga0070686_100004099
907 Ga0070686_100021276
908 Ga0070686_100089579
909 Ga0070695_100023645
910 Ga0070695_100041337
911 Ga0070695_100043655
912 Ga0070695_100048864
913 Ga0070695_100114936
914 Ga0070695_100133416
915 Ga0070695_100331944
916 Ga0070695_100403242
917 Ga0070695_100526672
918 Ga0070696_100028560
919 Ga0070696_100047659
920 Ga0070696_100067725
921 Ga0070696_100099032
922 Ga0070696_100153677
923 Ga0070696_100156838
924 Ga0070696_100267293
925 Ga0070696_100514967
926 Ga0070693_100003349
927 Ga0070693_100042123
928 Ga0070693_100051218
929 Ga0070693_100161839
930 Ga0070693_100269193
931 Ga0070693_100784649
932 Ga0070665_100119528
933 Ga0070665_100128446
934 Ga0070665_101132489
935 Ga0070704_100050357
936 Ga0070704_100223597
937 Ga0070704_100238613
938 Ga0070664_100007298
939 Ga0070664_100152059
940 Ga0070664_100415179
941 Ga0068857_100002004
942 Ga0068857_100395442
943 Ga0068857_100775050
944 Ga0068857_101030410
945 Ga0068854_100043695
946 Ga0068854_100186610
947 Ga0068854_100262659
948 Ga0068854_100461311
949 Ga0070702_100037032
950 Ga0070702_100068563
951 Ga0070702_100100875
952 Ga0070702_100144956
953 Ga0070702_100436032
954 Ga0068852_100141097
955 Ga0068859_100006657
956 Ga0068859_100017192
957 Ga0068859_100019681
958 Ga0068859_100089226
959 Ga0068859_100151006
960 Ga0068859_100175388
961 Ga0068859_100225087
962 Ga0068859_100263974
963 Ga0068859_100303299
964 Ga0068859_100315314
965 Ga0068859_100413150
966 Ga0068859_100423862
967 Ga0068859_100532575
968 Ga0068859_100657599
969 Ga0068859_100848974
970 Ga0068859_101106371
971 Ga0068864_100042911
972 Ga0068864_100067870
973 Ga0068864_100076919
974 Ga0068864_100097331
975 Ga0068864_100172325
976 Ga0068864_100201703
977 Ga0068864_100278558
978 Ga0068864_100382257
979 Ga0068864_100461908
980 Ga0068866_10309547
981 Ga0068861_100005081
982 Ga0068861_100050654
983 Ga0068861_100078084
984 Ga0068861_100194980
985 Ga0068861_100510834
986 Ga0068870_10086706
987 Ga0068870_10142750
988 Ga0068870_10214095
989 Ga0068863_100447516
990 Ga0068858_100018036
991 Ga0068858_100117797
992 Ga0068858_100133146
993 Ga0068858_100230511
994 Ga0068858_100332267
995 Ga0068858_100407258
996 Ga0068858_100497074
997 Ga0068858_100641704
998 Ga0068860_100015460
999 Ga0068860_100074048
1000 Ga0068860_100129907
1001 Ga0068860_100166909
1002 Ga0068860_100287712
1003 Ga0068860_100441593
1004 Ga0068860_100551773
1005 Ga0068862_100021969
1006 Ga0068862_100022514
1007 Ga0068862_100048897
1008 Ga0068862_100525441
1009 Ga0081539_10000976
1010 Ga0081539_10020530
1011 Ga0081539_10073417
1012 Ga0070715_10000045
1013 Ga0070716_100013600
1014 Ga0097621_100237930
1015 Ga0097621_100263173
1016 Ga0097621_100321989
1017 Ga0068871_100096373
1018 Ga0068871_100219312
1019 Ga0068871_100430087
1020 Ga0075428_100398130
1021 Ga0075428_100426144
1022 Ga0075428_100832870
1023 Ga0075430_100093025
1024 Ga0075430_100213066
1025 Ga0075431_100200886
1026 Ga0075431_100925555
1027 Ga0075431_100926485
1028 Ga0075433_10004151
1029 Ga0075433_10023049
1030 Ga0075433_10037824
1031 Ga0075433_10086817
1032 Ga0075433_10091424
1033 Ga0075433_10130281
1034 Ga0075433_10256605
1035 Ga0075433_10823925
1036 Ga0075434_100042227
1037 Ga0075434_100100465
1038 Ga0075429_100083913
1039 Ga0068865_100347548
1040 Ga0075436_100000008
1041 Ga0075436_100048045
1042 Ga0097620_100006657
1043 Ga0097620_100017191
1044 Ga0097620_100019680
1045 Ga0097620_100043289
1046 Ga0097620_100089227
1047 Ga0097620_100151014
1048 Ga0097620_100175384
1049 Ga0097620_100225068
1050 Ga0097620_100263981
1051 Ga0097620_100303314
1052 Ga0097620_100315332
1053 Ga0097620_100413159
1054 Ga0097620_100423805
1055 Ga0097620_100532586
1056 Ga0097620_100657636
1057 Ga0097620_100849125
1058 Ga0097620_101106364
1059 Ga0075435_100008739
1060 Ga0075435_100029502
1061 Ga0075435_100182642
1062 Ga0099794_10001526
1063 Ga0105240_10043576
1064 Ga0105240_10484230
1065 Ga0105240_11080833
1066 Ga0111539_10013191
1067 Ga0111539_10078287
1068 Ga0111539_10270397
1069 Ga0111539_10313525
1070 Ga0111539_10450078
1071 Ga0111539_10535986
1072 Ga0105245_10482534
1073 Ga0105245_11064853
1074 Ga0105247_10003286
1075 Ga0105247_10040801
1076 Ga0105247_10047356
1077 Ga0114129_10001731
1078 Ga0114129_10025543
1079 Ga0114129_10209589
1080 Ga0114129_10277961
1081 Ga0114129_10312521
1082 Ga0114129_10321186
1083 Ga0114129_10652020
1084 Ga0114129_10701659
1085 Ga0114129_10715848
1086 Ga0114129_10990201
1087 Ga0114129_11139385
1088 Ga0105243_10225675
1089 Ga0105243_10342445
1090 Ga0105243_10344509
1091 Ga0105243_10434031
1092 Ga0105243_10739279
1093 Ga0105241_10045247
1094 Ga0105241_10105673
1095 Ga0105241_10179487
1096 Ga0105241_10284695
1097 Ga0105241_10327497
1098 Ga0105241_10331239
1099 Ga0105241_10625254
1100 Ga0105241_10633856
1101 Ga0105242_10011786
1102 Ga0105242_10017081
1103 Ga0105242_10038746
1104 Ga0105242_10307559
1105 Ga0105242_11600960
1106 Ga0105248_10013752
1107 Ga0105248_10028668
1108 Ga0105248_10036636
1109 Ga0105248_10110692
1110 Ga0105248_10435829
1111 Ga0105237_10001285
1112 Ga0105237_10173116
1113 Ga0105237_10488701
1114 Ga0105237_11213013
1115 Ga0105238_10043815
1116 Ga0105238_10067040
1117 Ga0105238_10339156
1118 Ga0105238_11132119
1119 Ga0105249_10009785
1120 Ga0105249_10017244
1121 Ga0105249_10358107
1122 Ga0105249_11015660
1123 Ga0105239_10117907
1124 Ga0105239_10223868
1125 Ga0105239_10369032
1126 Ga0105246_10172778
1127 Ga0105246_10223913
1128 Ga0105246_10297072
1129 Ga0105246_10623644
1130 Ga0157373_10007476
1131 Ga0157373_10201204
1132 Ga0157373_10204644
1133 Ga0157374_10255905
1134 Ga0157374_10669584
1135 Ga0157374_11177892
1136 Ga0157378_10030978
1137 Ga0157378_10032510
1138 Ga0157378_10197595
1139 Ga0157378_10224034
1140 Ga0157378_10251519
1141 Ga0157378_10287630
1142 Ga0157378_10331165
1143 Ga0157378_10427911
1144 Ga0163162_10000646
1145 Ga0163162_10016908
1146 Ga0163162_10052051
1147 Ga0163162_10192091
1148 Ga0163162_10228489
1149 Ga0163162_10636161
1150 Ga0163162_10866607
1151 Ga0163162_11073622
1152 Ga0163162_11408159
1153 Ga0157372_10047127
1154 Ga0157372_10191169
1155 Ga0157372_10558554
1156 Ga0157372_10726538
1157 Ga0157375_10071478
1158 Ga0157375_10076089
1159 Ga0157375_10172629
1160 Ga0157375_10523404
1161 Ga0157375_10701775
1162 Ga0157375_11442819
1163 Ga0157375_11546170
1164 Ga0157375_11819152
1165 Ga0163163_10000773
1166 Ga0163163_10003689
1167 Ga0163163_10004586
1168 Ga0163163_10016065
1169 Ga0163163_10021176
1170 Ga0163163_10345640
1171 Ga0163163_10483357
1172 Ga0163163_10595663
1173 Ga0163163_10638868
1174 Ga0157380_10007451
1175 Ga0157380_10029387
1176 Ga0157380_10200031
1177 Ga0157380_10220334
1178 Ga0157380_10367708
1179 Ga0157377_10032732
1180 Ga0157377_10737038
1181 Ga0157379_10177826
1182 Ga0157379_10329901
1183 Ga0157379_10602125
1184 Ga0157376_10029698
1185 Ga0157376_10703679
1186 Ga0163161_10303473
1187 Ga0163161_10320553
1188 Ga0163161_10735189
1189 Ga0207697_10004359
1190 Ga0207653_10002447
1191 Ga0207642_10377715
1192 Ga0207710_10001033
1193 Ga0207710_10070222
1194 Ga0207710_10223739
1195 Ga0207647_10005143
1196 Ga0207647_10251488
1197 Ga0207685_10000009
1198 Ga0207685_10000032
1199 Ga0207645_10029984
1200 Ga0207643_10001012
1201 Ga0207643_10050593
1202 Ga0207643_10161341
1203 Ga0207643_10276517
1204 Ga0207684_10000085
1205 Ga0207684_10011608
1206 Ga0207684_10011671
1207 Ga0207684_10017764
1208 Ga0207684_10053455
1209 Ga0207654_10032242
1210 Ga0207654_10072223
1211 Ga0207654_10266481
1212 Ga0207654_10478435
1213 Ga0207707_10000503
1214 Ga0207707_10008289
1215 Ga0207707_10008326
1216 Ga0207695_10076318
1217 Ga0207671_10010970
1218 Ga0207671_10043002
1219 Ga0207660_10003576
1220 Ga0207660_10044968
1221 Ga0207660_10185945
1222 Ga0207662_10046077
1223 Ga0207662_10061987
1224 Ga0207662_10098141
1225 Ga0207662_10222710
1226 Ga0207657_10088154
1227 Ga0207652_10000427
1228 Ga0207652_10177824
1229 Ga0207646_10005836
1230 Ga0207646_10044492
1231 Ga0207646_10263808
1232 Ga0207646_10535404
1233 Ga0207646_10661245
1234 Ga0207646_10688738
1235 Ga0207681_10035151
1236 Ga0207681_10094768
1237 Ga0207681_10316600
1238 Ga0207694_10019854
1239 Ga0207694_10027332
1240 Ga0207650_10000028
1241 Ga0207650_10661032
1242 Ga0207650_10712830
1243 Ga0207659_10129799
1244 Ga0207644_10000207
1245 Ga0207644_10463697
1246 Ga0207690_10015844
1247 Ga0207690_10017808
1248 Ga0207690_10253778
1249 Ga0207706_10129322
1250 Ga0207706_10216928
1251 Ga0207686_10000383
1252 Ga0207686_10145509
1253 Ga0207686_10217742
1254 Ga0207709_10005354
1255 Ga0207670_10000754
1256 Ga0207670_10113438
1257 Ga0207670_10526182
1258 Ga0207669_10042143
1259 Ga0207669_10542888
1260 Ga0207704_10277164
1261 Ga0207704_10587538
1262 Ga0207665_10032441
1263 Ga0207691_10086701
1264 Ga0207691_10293289
1265 Ga0207691_10803628
1266 Ga0207711_10049477
1267 Ga0207711_10506978
1268 Ga0207689_10064851
1269 Ga0207689_10068221
1270 Ga0207689_10078828
1271 Ga0207689_10111150
1272 Ga0207689_10315571
1273 Ga0207689_10495578
1274 Ga0207689_10582274
1275 Ga0207661_10612180
1276 Ga0207679_10173756
1277 Ga0207679_10496639
1278 Ga0207679_10693662
1279 Ga0207679_10761465
1280 Ga0207667_10734745
1281 Ga0207651_10065347
1282 Ga0207651_10129562
1283 Ga0207651_10172844
1284 Ga0207651_10183238
1285 Ga0207651_10784892
1286 Ga0207712_10031040
1287 Ga0207712_10076743
1288 Ga0207712_10120186
1289 Ga0207668_10582588
1290 Ga0207640_10028375
1291 Ga0207640_10060623
1292 Ga0207640_10355710
1293 Ga0207677_10054029
1294 Ga0207677_10299197
1295 Ga0207703_10192277
1296 Ga0207703_10299029
1297 Ga0207703_10762724
1298 Ga0207639_10134410
1299 Ga0207639_10282545
1300 Ga0207708_10000426
1301 Ga0207708_10002961
1302 Ga0207708_10015598
1303 Ga0207708_10034283
1304 Ga0207708_10042862
1305 Ga0207708_10084532
1306 Ga0207708_10328191
1307 Ga0207708_10490569
1308 Ga0207702_10016026
1309 Ga0207641_10086368
1310 Ga0207641_10218642
1311 Ga0207648_10052391
1312 Ga0207648_10060312
1313 Ga0207648_10122489
1314 Ga0207648_10269186
1315 Ga0207676_10032387
1316 Ga0207676_10170089
1317 Ga0207676_10238295
1318 Ga0207676_10288710
1319 Ga0207676_10440867
1320 Ga0207676_10794311
1321 Ga0207676_10838111
1322 Ga0207674_10005298
1323 Ga0207674_10150791
1324 Ga0207674_10267320
1325 Ga0207674_10368669
1326 Ga0207674_11227242
1327 Ga0207675_100013849
1328 Ga0207675_100017555
1329 Ga0207675_100098892
1330 Ga0207675_100203544
1331 Ga0207675_100246835
1332 Ga0207675_100324065
1333 Ga0207675_100509531
1334 Ga0207675_100518757
1335 Ga0207698_10178355
1336 Ga0207698_10234017
1337 Ga0207428_10043805
1338 Ga0207428_10181256
1339 Ga0207428_10208965
1340 Ga0268266_10451103
1341 Ga0268265_10243942
1342 Ga0268265_10487200
1343 Ga0268264_10018654
1344 Ga0268264_10025284
1345 Ga0268264_10154082
1346 Ga0268264_10208859
1347 Ga0268264_10416103
1348 Ga0268264_10812403
1349 Ga0268264_10931736
1350 Ga0265318_10020546
1351 Ga0316182_1086315
1352 Ga0265325_10019797
1353 Ga0307408_100026857
1354 Ga0307408_100179724
1355 Ga0307408_101124211
1356 Ga0307405_10001871
1357 Ga0307405_10130487
1358 Ga0307405_10319772
1359 Ga0307413_10053822
1360 Ga0307413_10608381
1361 Ga0307410_10002925
1362 Ga0307410_10597146
1363 Ga0307406_10004104
1364 Ga0307406_10434768
1365 Ga0307406_10973356
1366 Ga0307407_10024355
1367 Ga0307407_10459955
1368 Ga0307412_10001510
1369 Ga0307412_10475974
1370 Ga0307409_100044204
1371 Ga0307416_100008892
1372 Ga0307416_100215514
1373 Ga0307416_100730193
1374 Ga0307414_10003378
1375 Ga0307411_10068493
1376 Ga0307411_10923840
1377 Ga0307415_100002268
1378 Ga0307415_100135177
1379 Ga0307415_100338674
1380 Ga0373951_0024486
1381 Ga0373941_0030385
1382 Ga0316574_0126388
1383 Ga0373931_0117960
1384 Ga0395900_0143297
1385 Ga0395900_0185975
1386 Ga0395900_0205655
1387 Ga0395900_0633001
1388 Ga0395898_0100412
1389 Ga0395905_0010706
1390 Ga0395901_0187422
1391 Ga0242419_001286
1392 Ga0242422_01110
1393 Ga0242420_003918
1394 Ga0436365_1230778
1395 Ga0439448_0063497
1396 Ga0439458_0015909
1397 Ga0453683_0356555
1398 Ga0451576_0208076
1399 Ga0451576_0386107
1400 Ga0495662_0016088
1401 Ga0495664_0241180
1402 Ga0495608_0038537
1403 Ga0495667_0108096
1404 Ga0495625_0274315
1405 Ga0495669_0232271
1406 Ga0495672_0227651
1407 Ga0496102_0605807
1408 Ga0496102_1124599
1409 Ga0496103_0352905
1410 Ga0496104_0172756
1411 Ga0496104_0412036
1412 Ga0496106_0112014
1413 Ga0496106_0814094
1414 Ga0496107_0043471
1415 Ga0496108_0137341
1416 Ga0496112_0112140
1417 Ga0496112_0230485
1418 Ga0496112_0402297
1419 Ga0496112_0506794
1420 Ga0496112_0727578
1421 Ga0496113_0034752
1422 Ga0501291_032695
1423 Ga0501292_017470
1424 Ga0501292_026428
1425 Ga0501296_001989
1426 Ga0501297_009094
1427 Ga0501298_005941
1428 Ga0501298_010848
1429 Ga0501298_011489
1430 Ga0501299_001635
1431 Ga0501300_025707
1432 Ga0501038_0005568
1433 Ga0501072_0903638
1434 Ga0501075_0140718
1435 Ga0501198_008561
1436 Ga0501202_037818
1437 Ga0501216_000878
1438 Ga0501217_002871
1439 Ga0501217_035654
1440 Ga0501217_047396
1441 Ga0501223_004783
1442 Ga0501223_071358
1443 Ga0501224_019702
1444 Ga0501224_039015
1445 Ga0501227_000071
1446 Ga0501235_006910
1447 Ga0501235_111741
1448 Ga0501236_003172
1449 Ga0501247_023987
1450 Ga0501249_032364
1451 Ga0501253_031668
1452 Ga0501253_040244
1453 Ga0501257_021564
1454 Ga0501258_010607
1455 Ga0501259_004720
1456 Ga0501260_008003
1457 Ga0501221_008346
1458 Ga0501225_0001380
1459 Ga0501225_0102847
1460 Ga0501229_008258
1461 Ga0501234_005055
1462 Ga0501079_0384107
1463 Ga0501080_0530340
1464 Ga0501081_0313717
1465 Ga0501241_014452
1466 Ga0501263_004085
1467 Ga0501268_012518
1468 Ga0501275_023997
1469 Ga0501282_005743
1470 Ga0501283_016079
1471 Ga0501226_000455
1472 nmdc:mga05p37_101035_c1
1473 nmdc:mga05p37_103865_c1
1474 nmdc:mga05p37_253834_c1
1475 nmdc:mga05p37_425696_c1
1476 nmdc:mga05p37_683454_c1
1477 nmdc:mga05p37_712863_c1
1478 nmdc:mga09592_183165_c1
1479 nmdc:mga09592_275006_c1
1480 nmdc:mga09592_363404_c1
1481 nmdc:mga0qj67_293263_c1
1482 nmdc:mga06r32_432332_c1
1483 nmdc:mga08y16_15977_c1
1484 nmdc:mga08y16_359115_c1
1485 nmdc:mga08y16_421044_c1
1486 nmdc:mga08y16_749423_c1
1487 nmdc:mga08y16_815149_c1
1488 nmdc:mga08y16_995223_c1
1489 nmdc:mga0n895_550589_c1
1490 nmdc:mga0rr50_124335_c1
1491 nmdc:mga0rr50_3070_c1
1492 nmdc:mga08x19_10838_c1
1493 nmdc:mga08x19_16_c1
1494 nmdc:mga0a205_12324_c1
1495 nmdc:mga0a205_131725_c1
1496 nmdc:mga0a205_14894_c1
1497 nmdc:mga0a205_172269_c1
1498 nmdc:mga0a205_26768_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

62

205

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9831 10 189
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9809 8 191
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9804 8 191
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9801 10 191
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.97 8 191
ID Description Score Start End Superfamily
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9857 98 189 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.982 98 189 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9734 98 188 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9713 98 189 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9689 8 97 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A521SES1-F1-model_v4 deleted 1.002 11 65
AF-A0A7C3H6T6-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.9855 8 185 GO:0000105
GO:0004424
GO:0005737
AF-A0A2D5QH10-F1-model_v4 Imidazoleglycerol-phosphate dehydratase (EC 4.2.1.19) 0.985 9 177 GO:0000105
GO:0004424
GO:0005737
AF-A0A3B9UGK8-F1-model_v4 deleted 0.9848 10 181
AF-A0A6A5L3B1-F1-model_v4 deleted 0.9838 8 191

Map