F478982
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 748 | 380 | 1496 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0499693|Ga0501032_0499693_94_747 |
| Length | 217 |
| Sequence | MADELPLAQTDDTATECRKLEFRELRDAWGGCMTDLTADVAVLPDKSLLVLDDDAPLRTRLGRALEQRGFEPTLVASVAEALAAVRVHAPAFAVLDMRLEDGTGLKVVEAVRDARPDAKIIMLTGYGNIATAVQAVKAGAVDYLSKPADADDVVRALLVRGDRPAAPPDNPMSADRVRWEHIQRVYELCNHNVSETARRLNMHRRTLQRILAKRAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 135 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 143 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 162 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 163 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 164 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 180 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 186 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 187 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 188 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 301 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 302 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 304 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 305 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 306 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 307 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 310 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 313 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 314 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 316 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 318 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 319 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 323 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 325 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 326 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 327 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 328 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 331 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 332 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 333 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 334 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 336 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 337 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 338 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 345 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 346 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 347 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 348 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 349 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 350 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 351 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 352 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 353 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 354 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 355 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 356 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 357 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 358 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 359 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 360 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 361 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 362 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 363 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 364 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 365 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 366 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 367 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 368 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 369 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 370 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 371 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 372 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 373 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 374 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 375 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 376 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 377 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 378 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 379 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 380 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.79 |
| Metatranscriptomes | 0.27 |
| Isolates | 4.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.05 |
| Nodule | 0.27 |
| Rhizoplane | 3.07 |
| Rhizosphere | 68.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0499693 | 3300049569 | Bacteria | 777 |
| 2 | JGI25153J46596_10054105 | 3300003215 | Bacteria | 1132 |
| 3 | JGI25153J46596_10059833 | 3300003215 | Bacteria | 1040 |
| 4 | Ga0006562J51391_1100661 | 3300003578 | Bacteria | 6340 |
| 5 | Ga0006562J51391_1100662 | 3300003578 | Bacteria | 5890 |
| 6 | Ga0055526_1036975 | 3300003771 | Bacteria | 1285 |
| 7 | Ga0055537_1004057 | 3300003773 | Bacteria | 4297 |
| 8 | Ga0055524_1004330 | 3300003775 | Bacteria | 6578 |
| 9 | Ga0055536_1000922 | 3300003781 | Bacteria | 18976 |
| 10 | Ga0055536_1001003 | 3300003781 | Bacteria | 17938 |
| 11 | Ga0055536_1001808 | 3300003781 | Bacteria | 12576 |
| 12 | Ga0055528_1011938 | 3300003790 | Bacteria | 3407 |
| 13 | Ga0055530_10004136 | 3300003791 | Bacteria | 7680 |
| 14 | Ga0055530_10013311 | 3300003791 | Bacteria | 2815 |
| 15 | Ga0055531_10000820 | 3300003794 | Bacteria | 25755 |
| 16 | Ga0055531_10003394 | 3300003794 | Bacteria | 10179 |
| 17 | Ga0055531_10004973 | 3300003794 | Bacteria | 7890 |
| 18 | Ga0055531_10052231 | 3300003794 | Bacteria | 1066 |
| 19 | Ga0065165_1000561 | 3300005262 | Bacteria | 55325 |
| 20 | Ga0065165_1000896 | 3300005262 | Bacteria | 38454 |
| 21 | Ga0065165_1059625 | 3300005262 | Bacteria | 1050 |
| 22 | Ga0070658_10034828 | 3300005327 | Bacteria | 4052 |
| 23 | Ga0070658_10138442 | 3300005327 | Bacteria | 2032 |
| 24 | Ga0070658_10149859 | 3300005327 | Bacteria | 1952 |
| 25 | Ga0070670_100000022 | 3300005331 | Bacteria | 199146 |
| 26 | Ga0070670_100012197 | 3300005331 | Bacteria | 7349 |
| 27 | Ga0070670_101109573 | 3300005331 | Bacteria | 722 |
| 28 | Ga0070666_10341744 | 3300005335 | Bacteria | 1070 |
| 29 | Ga0070680_100013150 | 3300005336 | Bacteria | 6444 |
| 30 | Ga0070680_100040088 | 3300005336 | Bacteria | 3790 |
| 31 | Ga0070680_100177258 | 3300005336 | Bacteria | 1794 |
| 32 | Ga0070660_100004808 | 3300005339 | Bacteria | 9343 |
| 33 | Ga0070660_100024618 | 3300005339 | Bacteria | 4465 |
| 34 | Ga0070660_100184598 | 3300005339 | Bacteria | 1688 |
| 35 | Ga0070660_100528800 | 3300005339 | Bacteria | 983 |
| 36 | Ga0070689_100173885 | 3300005340 | Bacteria | 1746 |
| 37 | Ga0070691_10035767 | 3300005341 | Bacteria | 2339 |
| 38 | Ga0070661_100887144 | 3300005344 | Bacteria | 736 |
| 39 | Ga0070668_100000960 | 3300005347 | Bacteria | 20151 |
| 40 | Ga0070668_100002198 | 3300005347 | Bacteria | 14320 |
| 41 | Ga0070668_100292843 | 3300005347 | Bacteria | 1363 |
| 42 | Ga0070669_100027883 | 3300005353 | Bacteria | 4065 |
| 43 | Ga0070669_100659540 | 3300005353 | Bacteria | 881 |
| 44 | Ga0070671_100003754 | 3300005355 | Bacteria | 11927 |
| 45 | Ga0070673_100008560 | 3300005364 | Bacteria | 6809 |
| 46 | Ga0070659_100000399 | 3300005366 | Bacteria | 32898 |
| 47 | Ga0070659_100017079 | 3300005366 | Bacteria | 5455 |
| 48 | Ga0070659_100052331 | 3300005366 | Bacteria | 3211 |
| 49 | Ga0070667_100000369 | 3300005367 | Bacteria | 49025 |
| 50 | Ga0070667_100003519 | 3300005367 | Bacteria | 13338 |
| 51 | Ga0070667_100009968 | 3300005367 | Bacteria | 7874 |
| 52 | Ga0070678_100397111 | 3300005456 | Bacteria | 1197 |
| 53 | Ga0070662_100014973 | 3300005457 | Bacteria | 5187 |
| 54 | Ga0070681_10002223 | 3300005458 | Bacteria | 17678 |
| 55 | Ga0070681_10007028 | 3300005458 | Bacteria | 10958 |
| 56 | Ga0070681_10043540 | 3300005458 | Bacteria | 4496 |
| 57 | Ga0070698_100380044 | 3300005471 | Bacteria | 1345 |
| 58 | Ga0070679_100004560 | 3300005530 | Bacteria | 12792 |
| 59 | Ga0068853_100005703 | 3300005539 | Bacteria | 9794 |
| 60 | Ga0068853_100006784 | 3300005539 | Bacteria | 9126 |
| 61 | Ga0068853_100069411 | 3300005539 | Bacteria | 3065 |
| 62 | Ga0068853_100519190 | 3300005539 | Bacteria | 1126 |
| 63 | Ga0068853_100858787 | 3300005539 | Bacteria | 871 |
| 64 | Ga0070665_100000418 | 3300005548 | Bacteria | 62048 |
| 65 | Ga0070665_100002841 | 3300005548 | Bacteria | 18748 |
| 66 | Ga0070665_100005108 | 3300005548 | Bacteria | 13608 |
| 67 | Ga0070665_100026201 | 3300005548 | Bacteria | 5872 |
| 68 | Ga0070665_100158332 | 3300005548 | Bacteria | 2267 |
| 69 | Ga0068855_100013908 | 3300005563 | Bacteria | 9705 |
| 70 | Ga0068855_100015063 | 3300005563 | Bacteria | 9311 |
| 71 | Ga0068855_100020847 | 3300005563 | Bacteria | 7860 |
| 72 | Ga0068855_100067092 | 3300005563 | Bacteria | 4181 |
| 73 | Ga0068855_100090730 | 3300005563 | Bacteria | 3526 |
| 74 | Ga0068855_100222524 | 3300005563 | Bacteria | 2116 |
| 75 | Ga0068855_100740579 | 3300005563 | Bacteria | 1049 |
| 76 | Ga0070664_100165888 | 3300005564 | Bacteria | 1957 |
| 77 | Ga0068857_100377626 | 3300005577 | Bacteria | 1316 |
| 78 | Ga0068854_100106189 | 3300005578 | Bacteria | 2112 |
| 79 | Ga0068854_101053095 | 3300005578 | Bacteria | 723 |
| 80 | Ga0068856_100063027 | 3300005614 | Bacteria | 3662 |
| 81 | Ga0068856_100252492 | 3300005614 | Bacteria | 1779 |
| 82 | Ga0068856_100304772 | 3300005614 | Bacteria | 1611 |
| 83 | Ga0068856_100570421 | 3300005614 | Bacteria | 1153 |
| 84 | Ga0068852_100005865 | 3300005616 | Bacteria | 8827 |
| 85 | Ga0068859_100002621 | 3300005617 | Bacteria | 18302 |
| 86 | Ga0068859_100184191 | 3300005617 | Bacteria | 2171 |
| 87 | Ga0068859_100374304 | 3300005617 | Bacteria | 1520 |
| 88 | Ga0068864_100000839 | 3300005618 | Bacteria | 25903 |
| 89 | Ga0068864_100011984 | 3300005618 | Bacteria | 7159 |
| 90 | Ga0068864_100023880 | 3300005618 | Bacteria | 5138 |
| 91 | Ga0068864_100659204 | 3300005618 | Bacteria | 1020 |
| 92 | Ga0068864_100815692 | 3300005618 | Bacteria | 918 |
| 93 | Ga0068863_100000119 | 3300005841 | Bacteria | 82539 |
| 94 | Ga0068863_100009241 | 3300005841 | Bacteria | 9616 |
| 95 | Ga0068858_100003066 | 3300005842 | Bacteria | 16744 |
| 96 | Ga0068858_100065787 | 3300005842 | Bacteria | 3355 |
| 97 | Ga0068860_100000507 | 3300005843 | Bacteria | 48348 |
| 98 | Ga0068860_100071705 | 3300005843 | Bacteria | 3291 |
| 99 | Ga0068860_100468985 | 3300005843 | Bacteria | 1254 |
| 100 | Ga0068862_100000551 | 3300005844 | Bacteria | 39201 |
| 101 | Ga0068862_100110830 | 3300005844 | Bacteria | 2408 |
| 102 | Ga0068862_100405932 | 3300005844 | Bacteria | 1275 |
| 103 | Ga0068862_100638687 | 3300005844 | Bacteria | 1026 |
| 104 | Ga0081455_10009422 | 3300005937 | Bacteria | 10046 |
| 105 | Ga0081539_10000129 | 3300005985 | Bacteria | 178675 |
| 106 | Ga0075368_10001395 | 3300006042 | Bacteria | 7708 |
| 107 | Ga0075363_100023948 | 3300006048 | Bacteria | 3100 |
| 108 | Ga0075364_10000245 | 3300006051 | Bacteria | 26164 |
| 109 | Ga0075364_10039975 | 3300006051 | Bacteria | 3041 |
| 110 | Ga0075364_10071432 | 3300006051 | Bacteria | 2286 |
| 111 | Ga0075362_10107531 | 3300006177 | Bacteria | 1310 |
| 112 | Ga0075367_10000631 | 3300006178 | Bacteria | 13490 |
| 113 | Ga0075369_10090421 | 3300006186 | Bacteria | 1366 |
| 114 | Ga0075366_10007087 | 3300006195 | Bacteria | 6171 |
| 115 | Ga0075366_10052025 | 3300006195 | Bacteria | 2434 |
| 116 | Ga0075366_10056240 | 3300006195 | Bacteria | 2337 |
| 117 | Ga0075366_10171437 | 3300006195 | Bacteria | 1316 |
| 118 | Ga0097621_100544337 | 3300006237 | Bacteria | 1056 |
| 119 | Ga0075370_10105600 | 3300006353 | Bacteria | 1633 |
| 120 | Ga0075370_10115318 | 3300006353 | Bacteria | 1561 |
| 121 | Ga0075370_10334697 | 3300006353 | Bacteria | 903 |
| 122 | Ga0075431_100582693 | 3300006847 | Bacteria | 1104 |
| 123 | Ga0068865_100014233 | 3300006881 | Bacteria | 5050 |
| 124 | Ga0097620_100002621 | 3300006931 | Bacteria | 18302 |
| 125 | Ga0097620_100184187 | 3300006931 | Bacteria | 2171 |
| 126 | Ga0097620_100374338 | 3300006931 | Bacteria | 1520 |
| 127 | Ga0079104_1040601 | 3300006946 | Bacteria | 1089 |
| 128 | Ga0105240_10035893 | 3300009093 | Bacteria | 6384 |
| 129 | Ga0105240_10067391 | 3300009093 | Bacteria | 4437 |
| 130 | Ga0105240_10266505 | 3300009093 | Bacteria | 1974 |
| 131 | Ga0105245_10183200 | 3300009098 | Bacteria | 2002 |
| 132 | Ga0105243_11709312 | 3300009148 | Bacteria | 658 |
| 133 | Ga0105241_10496106 | 3300009174 | Bacteria | 1088 |
| 134 | Ga0105241_10754949 | 3300009174 | Bacteria | 892 |
| 135 | Ga0105242_10585791 | 3300009176 | Bacteria | 1075 |
| 136 | Ga0105248_10004095 | 3300009177 | Bacteria | 16121 |
| 137 | Ga0105248_10008698 | 3300009177 | Bacteria | 11156 |
| 138 | Ga0105248_10011018 | 3300009177 | Bacteria | 9973 |
| 139 | Ga0105248_10529584 | 3300009177 | Bacteria | 1329 |
| 140 | Ga0105248_10757564 | 3300009177 | Bacteria | 1096 |
| 141 | Ga0105237_10003533 | 3300009545 | Bacteria | 18525 |
| 142 | Ga0105237_10479121 | 3300009545 | Bacteria | 1251 |
| 143 | Ga0105238_10023580 | 3300009551 | Bacteria | 6270 |
| 144 | Ga0105238_10027667 | 3300009551 | Bacteria | 5779 |
| 145 | Ga0105238_10299503 | 3300009551 | Bacteria | 1591 |
| 146 | Ga0105249_10000729 | 3300009553 | Bacteria | 29775 |
| 147 | Ga0105249_10394581 | 3300009553 | Bacteria | 1413 |
| 148 | Ga0105249_10466072 | 3300009553 | Bacteria | 1304 |
| 149 | Ga0105239_10137186 | 3300010375 | Bacteria | 2723 |
| 150 | Ga0105246_10435597 | 3300011119 | Bacteria | 1098 |
| 151 | Ga0157373_10000445 | 3300013100 | Bacteria | 32823 |
| 152 | Ga0157373_10000769 | 3300013100 | Bacteria | 24730 |
| 153 | Ga0157371_10011051 | 3300013102 | Bacteria | 6993 |
| 154 | Ga0157370_10012691 | 3300013104 | Bacteria | 8720 |
| 155 | Ga0157370_10027913 | 3300013104 | Bacteria | 5560 |
| 156 | Ga0157369_10152171 | 3300013105 | Bacteria | 2445 |
| 157 | Ga0157369_10710989 | 3300013105 | Bacteria | 1034 |
| 158 | Ga0157369_10727236 | 3300013105 | Bacteria | 1022 |
| 159 | Ga0157369_10919950 | 3300013105 | Bacteria | 897 |
| 160 | Ga0163162_10094055 | 3300013306 | Bacteria | 3083 |
| 161 | Ga0163162_10195308 | 3300013306 | Bacteria | 2152 |
| 162 | Ga0157372_10670550 | 3300013307 | Bacteria | 1207 |
| 163 | Ga0163163_10002724 | 3300014325 | Bacteria | 14914 |
| 164 | Ga0163163_10111417 | 3300014325 | Bacteria | 2765 |
| 165 | Ga0163163_10437199 | 3300014325 | Bacteria | 1368 |
| 166 | Ga0163163_10455557 | 3300014325 | Bacteria | 1339 |
| 167 | Ga0163163_11656718 | 3300014325 | Bacteria | 700 |
| 168 | Ga0182008_10266229 | 3300014497 | Bacteria | 888 |
| 169 | Ga0157377_10539814 | 3300014745 | Bacteria | 822 |
| 170 | Ga0157379_10002078 | 3300014968 | Bacteria | 16637 |
| 171 | Ga0157379_10122544 | 3300014968 | Bacteria | 2339 |
| 172 | Ga0182006_1062523 | 3300015261 | Bacteria | 1400 |
| 173 | Ga0182005_1003061 | 3300015265 | Bacteria | 5768 |
| 174 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 175 | Ga0163161_10599635 | 3300017792 | Bacteria | 908 |
| 176 | Ga0213874_10012812 | 3300021377 | Bacteria | 2159 |
| 177 | Ga0213876_10000571 | 3300021384 | Bacteria | 27421 |
| 178 | Ga0213876_10011133 | 3300021384 | Bacteria | 4811 |
| 179 | Ga0209026_1009261 | 3300025250 | Bacteria | 1951 |
| 180 | Ga0209026_1014848 | 3300025250 | Bacteria | 1291 |
| 181 | Ga0209148_1006423 | 3300025254 | Bacteria | 2548 |
| 182 | Ga0209565_1004647 | 3300025263 | Bacteria | 4138 |
| 183 | Ga0209673_1001534 | 3300025273 | Bacteria | 21014 |
| 184 | Ga0209675_1004417 | 3300025291 | Bacteria | 6256 |
| 185 | Ga0209676_1000283 | 3300025292 | Bacteria | 105260 |
| 186 | Ga0209676_1000319 | 3300025292 | Bacteria | 93542 |
| 187 | Ga0209676_1000401 | 3300025292 | Bacteria | 78968 |
| 188 | Ga0209676_1001427 | 3300025292 | Bacteria | 22666 |
| 189 | Ga0209564_1007906 | 3300025295 | Bacteria | 5371 |
| 190 | Ga0209564_1015664 | 3300025295 | Bacteria | 3068 |
| 191 | Ga0209758_1000936 | 3300025297 | Bacteria | 39430 |
| 192 | Ga0209758_1001446 | 3300025297 | Bacteria | 27968 |
| 193 | Ga0209758_1005528 | 3300025297 | Bacteria | 9652 |
| 194 | Ga0209050_1000245 | 3300025298 | Bacteria | 116929 |
| 195 | Ga0209050_1000584 | 3300025298 | Bacteria | 59071 |
| 196 | Ga0209050_1001426 | 3300025298 | Bacteria | 25794 |
| 197 | Ga0209050_1019676 | 3300025298 | Bacteria | 2551 |
| 198 | Ga0209256_1004881 | 3300025299 | Bacteria | 8078 |
| 199 | Ga0209256_1005664 | 3300025299 | Bacteria | 7032 |
| 200 | Ga0209051_1001183 | 3300025303 | Bacteria | 23584 |
| 201 | Ga0209257_1000184 | 3300025304 | Bacteria | 156438 |
| 202 | Ga0209257_1000352 | 3300025304 | Bacteria | 94530 |
| 203 | Ga0209257_1000995 | 3300025304 | Bacteria | 38407 |
| 204 | Ga0209257_1001133 | 3300025304 | Bacteria | 34214 |
| 205 | Ga0209257_1001595 | 3300025304 | Bacteria | 25963 |
| 206 | Ga0209257_1005790 | 3300025304 | Bacteria | 8416 |
| 207 | Ga0207697_10194531 | 3300025315 | Bacteria | 891 |
| 208 | Ga0207680_10105802 | 3300025903 | Bacteria | 1816 |
| 209 | Ga0207680_10381387 | 3300025903 | Bacteria | 994 |
| 210 | Ga0207705_10010302 | 3300025909 | Bacteria | 6799 |
| 211 | Ga0207705_10057833 | 3300025909 | Bacteria | 2797 |
| 212 | Ga0207705_10067665 | 3300025909 | Bacteria | 2585 |
| 213 | Ga0207705_10576507 | 3300025909 | Bacteria | 875 |
| 214 | Ga0207707_10013631 | 3300025912 | Bacteria | 7089 |
| 215 | Ga0207707_10030418 | 3300025912 | Bacteria | 4724 |
| 216 | Ga0207707_10070584 | 3300025912 | Bacteria | 3044 |
| 217 | Ga0207695_10000837 | 3300025913 | Bacteria | 56634 |
| 218 | Ga0207695_10005140 | 3300025913 | Bacteria | 17526 |
| 219 | Ga0207695_10013898 | 3300025913 | Bacteria | 9570 |
| 220 | Ga0207695_10048219 | 3300025913 | Bacteria | 4500 |
| 221 | Ga0207671_10001343 | 3300025914 | Bacteria | 28757 |
| 222 | Ga0207660_10001046 | 3300025917 | Bacteria | 18312 |
| 223 | Ga0207660_10033108 | 3300025917 | Bacteria | 3572 |
| 224 | Ga0207660_10038049 | 3300025917 | Bacteria | 3356 |
| 225 | Ga0207657_10004700 | 3300025919 | Bacteria | 14417 |
| 226 | Ga0207657_10010320 | 3300025919 | Bacteria | 9326 |
| 227 | Ga0207652_10004972 | 3300025921 | Bacteria | 10762 |
| 228 | Ga0207652_10118615 | 3300025921 | Bacteria | 2352 |
| 229 | Ga0207681_10027089 | 3300025923 | Bacteria | 3703 |
| 230 | Ga0207694_10018908 | 3300025924 | Bacteria | 5209 |
| 231 | Ga0207694_10039683 | 3300025924 | Bacteria | 3623 |
| 232 | Ga0207694_11176790 | 3300025924 | Bacteria | 649 |
| 233 | Ga0207650_10000016 | 3300025925 | Bacteria | 361958 |
| 234 | Ga0207650_10007596 | 3300025925 | Bacteria | 7390 |
| 235 | Ga0207644_10005639 | 3300025931 | Bacteria | 8152 |
| 236 | Ga0207690_10000695 | 3300025932 | Bacteria | 21662 |
| 237 | Ga0207690_10083286 | 3300025932 | Bacteria | 2239 |
| 238 | Ga0207690_10099777 | 3300025932 | Bacteria | 2071 |
| 239 | Ga0207706_10031710 | 3300025933 | Bacteria | 4706 |
| 240 | Ga0207670_10254092 | 3300025936 | Bacteria | 1360 |
| 241 | Ga0207669_10907873 | 3300025937 | Bacteria | 736 |
| 242 | Ga0207704_10029709 | 3300025938 | Bacteria | 3053 |
| 243 | Ga0207711_10001468 | 3300025941 | Bacteria | 21987 |
| 244 | Ga0207711_10007218 | 3300025941 | Bacteria | 9314 |
| 245 | Ga0207711_10373626 | 3300025941 | Bacteria | 1322 |
| 246 | Ga0207711_10720479 | 3300025941 | Bacteria | 930 |
| 247 | Ga0207711_10988358 | 3300025941 | Bacteria | 781 |
| 248 | Ga0207661_10088101 | 3300025944 | Bacteria | 2580 |
| 249 | Ga0207679_10137765 | 3300025945 | Bacteria | 1968 |
| 250 | Ga0207679_10145569 | 3300025945 | Bacteria | 1921 |
| 251 | Ga0207667_10001958 | 3300025949 | Bacteria | 25792 |
| 252 | Ga0207667_10021156 | 3300025949 | Bacteria | 7213 |
| 253 | Ga0207667_10108241 | 3300025949 | Bacteria | 2868 |
| 254 | Ga0207667_10201234 | 3300025949 | Bacteria | 2043 |
| 255 | Ga0207667_10348877 | 3300025949 | Bacteria | 1510 |
| 256 | Ga0207667_10506781 | 3300025949 | Bacteria | 1224 |
| 257 | Ga0207667_10603643 | 3300025949 | Bacteria | 1106 |
| 258 | Ga0207651_10038193 | 3300025960 | Bacteria | 3153 |
| 259 | Ga0207712_10004155 | 3300025961 | Bacteria | 9143 |
| 260 | Ga0207712_10102634 | 3300025961 | Bacteria | 2129 |
| 261 | Ga0207668_10000019 | 3300025972 | Bacteria | 152108 |
| 262 | Ga0207668_10000241 | 3300025972 | Bacteria | 36742 |
| 263 | Ga0207668_10008731 | 3300025972 | Bacteria | 6054 |
| 264 | Ga0207668_10233090 | 3300025972 | Bacteria | 1485 |
| 265 | Ga0207658_10000295 | 3300025986 | Bacteria | 52135 |
| 266 | Ga0207658_10004237 | 3300025986 | Bacteria | 9992 |
| 267 | Ga0207677_10096546 | 3300026023 | Bacteria | 2163 |
| 268 | Ga0207677_10764608 | 3300026023 | Bacteria | 862 |
| 269 | Ga0207703_10003003 | 3300026035 | Bacteria | 14304 |
| 270 | Ga0207703_10003368 | 3300026035 | Bacteria | 13432 |
| 271 | Ga0207639_10017371 | 3300026041 | Bacteria | 5099 |
| 272 | Ga0207639_10079810 | 3300026041 | Bacteria | 2587 |
| 273 | Ga0207678_11090360 | 3300026067 | Bacteria | 707 |
| 274 | Ga0207702_10386514 | 3300026078 | Bacteria | 1347 |
| 275 | Ga0207641_10002594 | 3300026088 | Bacteria | 16606 |
| 276 | Ga0207641_10014411 | 3300026088 | Bacteria | 6478 |
| 277 | Ga0207641_10768328 | 3300026088 | Bacteria | 952 |
| 278 | Ga0207676_10000408 | 3300026095 | Bacteria | 36341 |
| 279 | Ga0207676_10016500 | 3300026095 | Bacteria | 5348 |
| 280 | Ga0207676_10477413 | 3300026095 | Bacteria | 1180 |
| 281 | Ga0207675_100196638 | 3300026118 | Bacteria | 1935 |
| 282 | Ga0207683_10285280 | 3300026121 | Bacteria | 1509 |
| 283 | Ga0209281_1027887 | 3300027111 | Bacteria | 1030 |
| 284 | Ga0209981_1000192 | 3300027378 | Bacteria | 7563 |
| 285 | Ga0209983_1003863 | 3300027665 | Bacteria | 3171 |
| 286 | Ga0209813_10001034 | 3300027866 | Bacteria | 6268 |
| 287 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 288 | Ga0268266_10000481 | 3300028379 | Bacteria | 57341 |
| 289 | Ga0268266_10001814 | 3300028379 | Bacteria | 24161 |
| 290 | Ga0268266_10005619 | 3300028379 | Bacteria | 11645 |
| 291 | Ga0268266_10030422 | 3300028379 | Bacteria | 4587 |
| 292 | Ga0268266_10134524 | 3300028379 | Bacteria | 2213 |
| 293 | Ga0268266_10171512 | 3300028379 | Bacteria | 1969 |
| 294 | Ga0268266_10631626 | 3300028379 | Bacteria | 1030 |
| 295 | Ga0268265_10017989 | 3300028380 | Bacteria | 4890 |
| 296 | Ga0268265_10072266 | 3300028380 | Bacteria | 2690 |
| 297 | Ga0268265_10613165 | 3300028380 | Bacteria | 1041 |
| 298 | Ga0268264_10000207 | 3300028381 | Bacteria | 120086 |
| 299 | Ga0268264_10019198 | 3300028381 | Bacteria | 5586 |
| 300 | Ga0268264_10097566 | 3300028381 | Bacteria | 2547 |
| 301 | Ga0265337_1010913 | 3300028556 | Bacteria | 3158 |
| 302 | Ga0265334_10013950 | 3300028573 | Bacteria | 3356 |
| 303 | Ga0307517_10000835 | 3300028786 | Bacteria | 53001 |
| 304 | Ga0307515_10141502 | 3300028794 | Bacteria | 2577 |
| 305 | Ga0307515_10176794 | 3300028794 | Bacteria | 2102 |
| 306 | Ga0307515_10341904 | 3300028794 | Bacteria | 1148 |
| 307 | Ga0265338_10014807 | 3300028800 | Bacteria | 8631 |
| 308 | Ga0265338_10017120 | 3300028800 | Bacteria | 7834 |
| 309 | Ga0265338_10023871 | 3300028800 | Bacteria | 6269 |
| 310 | Ga0265338_10059145 | 3300028800 | Bacteria | 3377 |
| 311 | Ga0265338_10115360 | 3300028800 | Bacteria | 2153 |
| 312 | Ga0265338_10806293 | 3300028800 | Bacteria | 643 |
| 313 | Ga0307511_10009787 | 3300030521 | Bacteria | 9545 |
| 314 | Ga0265332_10192499 | 3300031238 | Bacteria | 849 |
| 315 | Ga0265325_10003959 | 3300031241 | Bacteria | 9478 |
| 316 | Ga0265339_10019644 | 3300031249 | Bacteria | 3963 |
| 317 | Ga0265327_10000442 | 3300031251 | Bacteria | 75162 |
| 318 | Ga0265327_10004607 | 3300031251 | Bacteria | 12121 |
| 319 | Ga0265327_10006001 | 3300031251 | Bacteria | 9880 |
| 320 | Ga0265316_10354738 | 3300031344 | Bacteria | 1061 |
| 321 | Ga0307513_10000873 | 3300031456 | Bacteria | 43622 |
| 322 | Ga0307513_10013077 | 3300031456 | Bacteria | 10204 |
| 323 | Ga0307513_10023666 | 3300031456 | Bacteria | 7170 |
| 324 | Ga0307513_10044795 | 3300031456 | Bacteria | 4842 |
| 325 | Ga0307513_10539250 | 3300031456 | Bacteria | 880 |
| 326 | Ga0307408_100168680 | 3300031548 | Bacteria | 1746 |
| 327 | Ga0307408_100578557 | 3300031548 | Bacteria | 995 |
| 328 | Ga0265313_10000062 | 3300031595 | Bacteria | 106169 |
| 329 | Ga0265313_10006275 | 3300031595 | Bacteria | 8470 |
| 330 | Ga0265314_10029233 | 3300031711 | Bacteria | 4099 |
| 331 | Ga0265314_10082875 | 3300031711 | Bacteria | 2109 |
| 332 | Ga0307516_10000030 | 3300031730 | Bacteria | 159694 |
| 333 | Ga0307516_10261999 | 3300031730 | Bacteria | 1419 |
| 334 | Ga0307405_10940581 | 3300031731 | Bacteria | 734 |
| 335 | Ga0307413_10364092 | 3300031824 | Bacteria | 1120 |
| 336 | Ga0307413_10955520 | 3300031824 | Bacteria | 731 |
| 337 | Ga0307406_10000448 | 3300031901 | Bacteria | 24069 |
| 338 | Ga0307406_10419836 | 3300031901 | Bacteria | 1065 |
| 339 | Ga0307412_10003082 | 3300031911 | Bacteria | 9244 |
| 340 | Ga0307412_10434990 | 3300031911 | Bacteria | 1077 |
| 341 | Ga0307412_10729119 | 3300031911 | Bacteria | 854 |
| 342 | Ga0307414_10021392 | 3300032004 | Bacteria | 4058 |
| 343 | Ga0307414_10031686 | 3300032004 | Bacteria | 3471 |
| 344 | Ga0307414_10035550 | 3300032004 | Bacteria | 3316 |
| 345 | Ga0307414_10062866 | 3300032004 | Bacteria | 2636 |
| 346 | Ga0307414_10299184 | 3300032004 | Bacteria | 1360 |
| 347 | Ga0307414_10303875 | 3300032004 | Bacteria | 1351 |
| 348 | Ga0307414_10341403 | 3300032004 | Bacteria | 1282 |
| 349 | Ga0307414_10401487 | 3300032004 | Bacteria | 1190 |
| 350 | Ga0307414_10406222 | 3300032004 | Bacteria | 1184 |
| 351 | Ga0307411_10204690 | 3300032005 | Bacteria | 1519 |
| 352 | Ga0307510_10055823 | 3300033180 | Bacteria | 4121 |
| 353 | Ga0373944_0006252 | 3300035089 | Bacteria | 3157 |
| 354 | Ga0373960_0103400 | 3300035121 | Bacteria | 926 |
| 355 | Ga0373943_0019233 | 3300035170 | Bacteria | 3140 |
| 356 | Ga0373931_0091036 | 3300035691 | Bacteria | 1699 |
| 357 | Ga0373931_0126924 | 3300035691 | Bacteria | 1464 |
| 358 | Ga0373935_0018852 | 3300035692 | Bacteria | 4206 |
| 359 | Ga0373927_0001188 | 3300035695 | Bacteria | 19756 |
| 360 | Ga0373933_0289069 | 3300035724 | Bacteria | 1060 |
| 361 | Ga0373937_0540524 | 3300036401 | Bacteria | 1107 |
| 362 | Ga0373937_0749643 | 3300036401 | Bacteria | 924 |
| 363 | Ga0373925_0000089 | 3300037068 | Bacteria | 98449 |
| 364 | Ga0373925_0714430 | 3300037068 | Bacteria | 826 |
| 365 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 366 | Ga0395899_0000790 | 3300037312 | Bacteria | 30999 |
| 367 | Ga0395899_0114223 | 3300037312 | Bacteria | 1939 |
| 368 | Ga0395899_0179821 | 3300037312 | Bacteria | 1485 |
| 369 | Ga0395900_0000844 | 3300037418 | Bacteria | 40400 |
| 370 | Ga0395900_0010379 | 3300037418 | Bacteria | 9524 |
| 371 | Ga0395900_0753155 | 3300037418 | Bacteria | 904 |
| 372 | Ga0395900_1019874 | 3300037418 | Bacteria | 747 |
| 373 | Ga0395898_0006267 | 3300037466 | Bacteria | 12723 |
| 374 | Ga0395898_0048541 | 3300037466 | Bacteria | 4162 |
| 375 | Ga0395898_0436481 | 3300037466 | Bacteria | 1247 |
| 376 | Ga0395898_0856108 | 3300037466 | Bacteria | 848 |
| 377 | Ga0395905_0047804 | 3300037471 | Bacteria | 4009 |
| 378 | Ga0395905_0073027 | 3300037471 | Bacteria | 3216 |
| 379 | Ga0395905_0086332 | 3300037471 | Bacteria | 2940 |
| 380 | Ga0395905_0152211 | 3300037471 | Bacteria | 2176 |
| 381 | Ga0395905_0282901 | 3300037471 | Bacteria | 1545 |
| 382 | Ga0395905_0364318 | 3300037471 | Bacteria | 1338 |
| 383 | Ga0395905_0374535 | 3300037471 | Bacteria | 1317 |
| 384 | Ga0395905_0400318 | 3300037471 | Bacteria | 1268 |
| 385 | Ga0395905_0426155 | 3300037471 | Bacteria | 1223 |
| 386 | Ga0436364_0305192 | 3300037853 | Bacteria | 1329 |
| 387 | Ga0436364_0505125 | 3300037853 | Bacteria | 704 |
| 388 | Ga0395901_0000052 | 3300038443 | Bacteria | 165888 |
| 389 | Ga0395901_0055218 | 3300038443 | Bacteria | 4130 |
| 390 | Ga0395901_0108202 | 3300038443 | Bacteria | 2918 |
| 391 | Ga0395901_0417902 | 3300038443 | Bacteria | 1375 |
| 392 | Ga0395901_0813505 | 3300038443 | Bacteria | 922 |
| 393 | Ga0400483_090428 | 3300039062 | Unclassified | 1397 |
| 394 | Ga0400483_230835 | 3300039062 | Bacteria | 1539 |
| 395 | Ga0436365_1465717 | 3300039437 | Bacteria | 857 |
| 396 | Ga0436365_1586327 | 3300039437 | Bacteria | 63407 |
| 397 | Ga0436360_0954883 | 3300039438 | Bacteria | 5684 |
| 398 | Ga0436361_0030985 | 3300039447 | Bacteria | 20368 |
| 399 | Ga0436361_0583434 | 3300039447 | Bacteria | 7014 |
| 400 | Ga0436361_0914864 | 3300039447 | Bacteria | 941 |
| 401 | Ga0436361_0916358 | 3300039447 | Bacteria | 1055 |
| 402 | Ga0436363_0512795 | 3300039450 | Bacteria | 1807 |
| 403 | Ga0436363_1260763 | 3300039450 | Bacteria | 1817 |
| 404 | Ga0451789_1067160 | 3300041443 | Bacteria | 698 |
| 405 | Ga0439431_0060500 | 3300041997 | Bacteria | 996 |
| 406 | Ga0439435_0022485 | 3300042436 | Bacteria | 1646 |
| 407 | Ga0439459_0010297 | 3300042438 | Bacteria | 1629 |
| 408 | Ga0450901_002469 | 3300042533 | Bacteria | 1990 |
| 409 | Ga0451577_0191866 | 3300042876 | Bacteria | 1843 |
| 410 | Ga0466969_0004404 | 3300044656 | Bacteria | 7490 |
| 411 | Ga0466969_0078330 | 3300044656 | Bacteria | 1581 |
| 412 | Ga0466965_0351851 | 3300044683 | Bacteria | 807 |
| 413 | Ga0466966_0003880 | 3300044684 | Bacteria | 9876 |
| 414 | Ga0466961_0003730 | 3300044693 | Bacteria | 9516 |
| 415 | Ga0466963_0011309 | 3300044694 | Bacteria | 5431 |
| 416 | Ga0466964_0376996 | 3300044706 | Bacteria | 735 |
| 417 | Ga0466971_0002511 | 3300044719 | Bacteria | 7759 |
| 418 | Ga0466968_0059582 | 3300044735 | Bacteria | 1645 |
| 419 | Ga0466970_0003930 | 3300044765 | Bacteria | 7283 |
| 420 | Ga0466957_0003256 | 3300044842 | Bacteria | 8888 |
| 421 | Ga0466959_0000163 | 3300045049 | Bacteria | 43940 |
| 422 | Ga0466959_0090707 | 3300045049 | Bacteria | 2195 |
| 423 | Ga0466958_0001982 | 3300045836 | Bacteria | 10062 |
| 424 | Ga0495627_000233 | 3300046453 | Bacteria | 58913 |
| 425 | Ga0495590_0000309 | 3300046457 | Bacteria | 25577 |
| 426 | Ga0495629_0019750 | 3300046459 | Bacteria | 4810 |
| 427 | Ga0495638_0000782 | 3300046460 | Bacteria | 33588 |
| 428 | Ga0495638_0000972 | 3300046460 | Bacteria | 28909 |
| 429 | Ga0495638_0001365 | 3300046460 | Bacteria | 22403 |
| 430 | Ga0495638_0002372 | 3300046460 | Bacteria | 15421 |
| 431 | Ga0495638_0002789 | 3300046460 | Bacteria | 14025 |
| 432 | Ga0495638_0043914 | 3300046460 | Bacteria | 2818 |
| 433 | Ga0495638_0336506 | 3300046460 | Bacteria | 801 |
| 434 | Ga0495653_0520051 | 3300046463 | Bacteria | 740 |
| 435 | Ga0495650_0005658 | 3300046471 | Bacteria | 8027 |
| 436 | Ga0495650_0059179 | 3300046471 | Bacteria | 1544 |
| 437 | Ga0495650_0234581 | 3300046471 | Bacteria | 628 |
| 438 | Ga0495585_0149832 | 3300046492 | Bacteria | 1217 |
| 439 | Ga0495585_0409871 | 3300046492 | Bacteria | 652 |
| 440 | Ga0495583_0000399 | 3300046506 | Bacteria | 66020 |
| 441 | Ga0495583_0003991 | 3300046506 | Bacteria | 10890 |
| 442 | Ga0495583_0068888 | 3300046506 | Bacteria | 1559 |
| 443 | Ga0495606_0120126 | 3300046507 | Bacteria | 1574 |
| 444 | Ga0495606_0156077 | 3300046507 | Bacteria | 1335 |
| 445 | Ga0495606_0182496 | 3300046507 | Bacteria | 1209 |
| 446 | Ga0495606_0219822 | 3300046507 | Bacteria | 1071 |
| 447 | Ga0495610_0001275 | 3300046512 | Bacteria | 22573 |
| 448 | Ga0495610_0001981 | 3300046512 | Bacteria | 17476 |
| 449 | Ga0495610_0002726 | 3300046512 | Bacteria | 14517 |
| 450 | Ga0495610_0144869 | 3300046512 | Bacteria | 1019 |
| 451 | Ga0495616_0006268 | 3300046513 | Bacteria | 7223 |
| 452 | Ga0495620_0033148 | 3300046515 | Bacteria | 2347 |
| 453 | Ga0495620_0039036 | 3300046515 | Bacteria | 2102 |
| 454 | Ga0495628_0181256 | 3300046516 | Bacteria | 1593 |
| 455 | Ga0495628_0302073 | 3300046516 | Bacteria | 1184 |
| 456 | Ga0495628_0321870 | 3300046516 | Bacteria | 1141 |
| 457 | Ga0495630_0071860 | 3300046517 | Bacteria | 2605 |
| 458 | Ga0495631_0036900 | 3300046518 | Bacteria | 2180 |
| 459 | Ga0495632_0000665 | 3300046519 | Bacteria | 31450 |
| 460 | Ga0495632_0228225 | 3300046519 | Bacteria | 840 |
| 461 | Ga0495632_0325011 | 3300046519 | Bacteria | 679 |
| 462 | Ga0495637_0011651 | 3300046520 | Bacteria | 4220 |
| 463 | Ga0495637_0046265 | 3300046520 | Bacteria | 1841 |
| 464 | Ga0495637_0073941 | 3300046520 | Bacteria | 1370 |
| 465 | Ga0495643_0054338 | 3300046522 | Bacteria | 2144 |
| 466 | Ga0495643_0305903 | 3300046522 | Bacteria | 723 |
| 467 | Ga0495648_0000039 | 3300046524 | Bacteria | 185430 |
| 468 | Ga0495648_0094775 | 3300046524 | Bacteria | 1662 |
| 469 | Ga0495648_0175733 | 3300046524 | Bacteria | 1093 |
| 470 | Ga0495642_0085553 | 3300046528 | Bacteria | 1331 |
| 471 | Ga0495652_0413896 | 3300046529 | Bacteria | 951 |
| 472 | Ga0495654_0000016 | 3300046530 | Bacteria | 306416 |
| 473 | Ga0495654_0106876 | 3300046530 | Bacteria | 1281 |
| 474 | Ga0495665_0186088 | 3300046531 | Bacteria | 1078 |
| 475 | Ga0495597_0004569 | 3300046542 | Bacteria | 7566 |
| 476 | Ga0495597_0030588 | 3300046542 | Bacteria | 2454 |
| 477 | Ga0495597_0106226 | 3300046542 | Bacteria | 1180 |
| 478 | Ga0495597_0135459 | 3300046542 | Bacteria | 1019 |
| 479 | Ga0495645_0143970 | 3300046543 | Bacteria | 1661 |
| 480 | Ga0495645_0214804 | 3300046543 | Bacteria | 1297 |
| 481 | Ga0495645_0347208 | 3300046543 | Bacteria | 957 |
| 482 | Ga0495645_0508019 | 3300046543 | Bacteria | 752 |
| 483 | Ga0495622_0002431 | 3300046557 | Bacteria | 9037 |
| 484 | Ga0495633_0000423 | 3300046558 | Bacteria | 43996 |
| 485 | Ga0495667_0374545 | 3300046559 | Bacteria | 898 |
| 486 | Ga0495668_0000221 | 3300046616 | Bacteria | 82680 |
| 487 | Ga0495668_0004400 | 3300046616 | Bacteria | 10026 |
| 488 | Ga0495668_0008124 | 3300046616 | Bacteria | 6603 |
| 489 | Ga0495668_0035031 | 3300046616 | Bacteria | 2814 |
| 490 | Ga0495668_0103514 | 3300046616 | Bacteria | 1557 |
| 491 | Ga0495668_0141456 | 3300046616 | Bacteria | 1317 |
| 492 | Ga0495611_0010563 | 3300046648 | Bacteria | 3906 |
| 493 | Ga0495625_0000034 | 3300046660 | Bacteria | 225120 |
| 494 | Ga0495625_0003961 | 3300046660 | Bacteria | 14221 |
| 495 | Ga0495625_0013206 | 3300046660 | Bacteria | 6650 |
| 496 | Ga0495625_0053383 | 3300046660 | Bacteria | 2890 |
| 497 | Ga0495625_0214016 | 3300046660 | Bacteria | 1265 |
| 498 | Ga0495625_0570701 | 3300046660 | Bacteria | 683 |
| 499 | Ga0495657_0060854 | 3300046675 | Bacteria | 2500 |
| 500 | Ga0495669_0000014 | 3300046684 | Bacteria | 140832 |
| 501 | Ga0495669_0000081 | 3300046684 | Bacteria | 63806 |
| 502 | Ga0495669_0042118 | 3300046684 | Bacteria | 2029 |
| 503 | Ga0495613_0008104 | 3300046689 | Bacteria | 7812 |
| 504 | Ga0495613_0198589 | 3300046689 | Bacteria | 1415 |
| 505 | Ga0495670_0116522 | 3300046691 | Bacteria | 1386 |
| 506 | Ga0495671_0137501 | 3300046692 | Bacteria | 1191 |
| 507 | Ga0495671_0164492 | 3300046692 | Bacteria | 1079 |
| 508 | Ga0495649_0000803 | 3300046694 | Bacteria | 25314 |
| 509 | Ga0495589_0008679 | 3300046794 | Bacteria | 5293 |
| 510 | Ga0495660_0015514 | 3300046810 | Bacteria | 4400 |
| 511 | Ga0495660_0069672 | 3300046810 | Bacteria | 1869 |
| 512 | Ga0495636_0203891 | 3300047318 | Bacteria | 904 |
| 513 | Ga0495672_0000196 | 3300047320 | Bacteria | 86506 |
| 514 | Ga0495672_0000986 | 3300047320 | Bacteria | 29423 |
| 515 | Ga0495672_0013127 | 3300047320 | Bacteria | 5731 |
| 516 | Ga0495672_0074578 | 3300047320 | Bacteria | 1910 |
| 517 | Ga0495683_0083101 | 3300047323 | Bacteria | 1559 |
| 518 | Ga0495677_0045818 | 3300047445 | Bacteria | 1605 |
| 519 | Ga0495679_007810 | 3300047446 | Bacteria | 4414 |
| 520 | Ga0495673_0000277 | 3300047469 | Bacteria | 69419 |
| 521 | Ga0495673_0001410 | 3300047469 | Bacteria | 19281 |
| 522 | Ga0495673_0001949 | 3300047469 | Bacteria | 15315 |
| 523 | Ga0495686_0000074 | 3300047472 | Bacteria | 208094 |
| 524 | Ga0495686_0001197 | 3300047472 | Bacteria | 29986 |
| 525 | Ga0495686_0002903 | 3300047472 | Bacteria | 15390 |
| 526 | Ga0495686_0019755 | 3300047472 | Bacteria | 4498 |
| 527 | Ga0495686_0125718 | 3300047472 | Bacteria | 1524 |
| 528 | Ga0495686_0144981 | 3300047472 | Bacteria | 1398 |
| 529 | Ga0495593_0010025 | 3300047673 | Bacteria | 5491 |
| 530 | Ga0496100_0066328 | 3300048903 | Bacteria | 2394 |
| 531 | Ga0496100_0966649 | 3300048903 | Bacteria | 670 |
| 532 | Ga0496102_0135975 | 3300048905 | Bacteria | 2303 |
| 533 | Ga0496103_0363731 | 3300048906 | Bacteria | 930 |
| 534 | Ga0496105_0056885 | 3300048908 | Bacteria | 3229 |
| 535 | Ga0496106_0071453 | 3300048909 | Bacteria | 2653 |
| 536 | Ga0496106_0521464 | 3300048909 | Bacteria | 954 |
| 537 | Ga0496106_0848375 | 3300048909 | Bacteria | 723 |
| 538 | Ga0496107_0132578 | 3300048910 | Bacteria | 1840 |
| 539 | Ga0496112_0033967 | 3300048915 | Bacteria | 4962 |
| 540 | Ga0496112_0108728 | 3300048915 | Bacteria | 2743 |
| 541 | Ga0496112_0393395 | 3300048915 | Bacteria | 1326 |
| 542 | Ga0496112_0454480 | 3300048915 | Bacteria | 1218 |
| 543 | Ga0496113_0305489 | 3300048916 | Bacteria | 1274 |
| 544 | Ga0496113_0574058 | 3300048916 | Bacteria | 904 |
| 545 | Ga0496114_0929386 | 3300048917 | Bacteria | 752 |
| 546 | Ga0496115_0009445 | 3300048918 | Bacteria | 7246 |
| 547 | Ga0496115_0012341 | 3300048918 | Bacteria | 6425 |
| 548 | Ga0496115_0020970 | 3300048918 | Bacteria | 5042 |
| 549 | Ga0496115_0034833 | 3300048918 | Bacteria | 3979 |
| 550 | Ga0496115_0401667 | 3300048918 | Bacteria | 1112 |
| 551 | Ga0496116_0012484 | 3300048919 | Bacteria | 6938 |
| 552 | Ga0496116_0104743 | 3300048919 | Bacteria | 1680 |
| 553 | Ga0496117_0040108 | 3300048920 | Bacteria | 3449 |
| 554 | Ga0496117_0091795 | 3300048920 | Bacteria | 1952 |
| 555 | Ga0496118_0012352 | 3300048921 | Bacteria | 8211 |
| 556 | Ga0496118_0014192 | 3300048921 | Bacteria | 7471 |
| 557 | Ga0496119_0148870 | 3300048922 | Bacteria | 1256 |
| 558 | Ga0496119_0364311 | 3300048922 | Bacteria | 697 |
| 559 | Ga0496120_0071132 | 3300048923 | Bacteria | 1911 |
| 560 | Ga0496121_0000035 | 3300048924 | Bacteria | 374316 |
| 561 | Ga0496121_0013712 | 3300048924 | Bacteria | 8686 |
| 562 | Ga0496121_0064604 | 3300048924 | Bacteria | 2983 |
| 563 | Ga0496121_0158478 | 3300048924 | Bacteria | 1658 |
| 564 | Ga0496122_0002994 | 3300048925 | Bacteria | 22994 |
| 565 | Ga0496123_0004303 | 3300048926 | Bacteria | 15121 |
| 566 | Ga0496124_0063597 | 3300048927 | Bacteria | 3082 |
| 567 | Ga0496124_0274749 | 3300048927 | Bacteria | 1232 |
| 568 | Ga0496124_0316445 | 3300048927 | Bacteria | 1120 |
| 569 | Ga0496125_0001013 | 3300048928 | Bacteria | 43693 |
| 570 | Ga0496125_0016889 | 3300048928 | Bacteria | 6987 |
| 571 | Ga0496125_0329196 | 3300048928 | Bacteria | 922 |
| 572 | Ga0496126_0149172 | 3300048929 | Bacteria | 2005 |
| 573 | Ga0496126_0358509 | 3300048929 | Bacteria | 1191 |
| 574 | Ga0495678_000773 | 3300049459 | Bacteria | 28865 |
| 575 | Ga0501033_0002538 | 3300049570 | Bacteria | 15455 |
| 576 | Ga0501033_0134799 | 3300049570 | Bacteria | 1787 |
| 577 | Ga0501033_0149123 | 3300049570 | Bacteria | 1688 |
| 578 | Ga0501034_0034395 | 3300049571 | Bacteria | 5137 |
| 579 | Ga0501034_0405909 | 3300049571 | Bacteria | 1285 |
| 580 | Ga0501034_0804813 | 3300049571 | Bacteria | 832 |
| 581 | Ga0501034_1309958 | 3300049571 | Bacteria | 601 |
| 582 | Ga0501036_0069717 | 3300049572 | Bacteria | 2974 |
| 583 | Ga0501036_0288634 | 3300049572 | Bacteria | 1373 |
| 584 | Ga0501037_0008727 | 3300049573 | Bacteria | 7431 |
| 585 | Ga0501037_0014126 | 3300049573 | Bacteria | 5883 |
| 586 | Ga0501037_0061325 | 3300049573 | Bacteria | 2742 |
| 587 | Ga0501037_0780570 | 3300049573 | Bacteria | 632 |
| 588 | Ga0501038_0249883 | 3300049574 | Bacteria | 1405 |
| 589 | Ga0501038_0281287 | 3300049574 | Bacteria | 1310 |
| 590 | Ga0501043_0047212 | 3300049579 | Bacteria | 3385 |
| 591 | Ga0501043_0081076 | 3300049579 | Bacteria | 2549 |
| 592 | Ga0501043_0102371 | 3300049579 | Bacteria | 2251 |
| 593 | Ga0501046_0241749 | 3300049580 | Bacteria | 1331 |
| 594 | Ga0501046_0726547 | 3300049580 | Bacteria | 698 |
| 595 | Ga0501047_0043548 | 3300049581 | Bacteria | 4336 |
| 596 | Ga0501047_0054044 | 3300049581 | Bacteria | 3885 |
| 597 | Ga0501047_0096003 | 3300049581 | Bacteria | 2843 |
| 598 | Ga0501047_0224249 | 3300049581 | Bacteria | 1735 |
| 599 | Ga0501047_0294087 | 3300049581 | Bacteria | 1467 |
| 600 | Ga0501047_0326879 | 3300049581 | Bacteria | 1372 |
| 601 | Ga0501047_0760063 | 3300049581 | Bacteria | 785 |
| 602 | Ga0501048_0238662 | 3300049582 | Bacteria | 1290 |
| 603 | Ga0501067_0000210 | 3300049583 | Bacteria | 32414 |
| 604 | Ga0501067_0038780 | 3300049583 | Bacteria | 2645 |
| 605 | Ga0501068_0000231 | 3300049584 | Bacteria | 27187 |
| 606 | Ga0501070_0540562 | 3300049586 | Bacteria | 933 |
| 607 | Ga0501072_0015337 | 3300049588 | Bacteria | 5878 |
| 608 | Ga0501073_0000002 | 3300049589 | Bacteria | 323865 |
| 609 | Ga0501073_0011697 | 3300049589 | Bacteria | 6407 |
| 610 | Ga0501073_0045456 | 3300049589 | Bacteria | 3092 |
| 611 | Ga0501074_0186235 | 3300049590 | Bacteria | 1480 |
| 612 | Ga0501077_0000003 | 3300049593 | Bacteria | 143061 |
| 613 | Ga0501077_0060131 | 3300049593 | Bacteria | 2412 |
| 614 | Ga0501238_001246 | 3300049671 | Bacteria | 2922 |
| 615 | Ga0501080_0009896 | 3300049742 | Bacteria | 8710 |
| 616 | Ga0501080_0010816 | 3300049742 | Bacteria | 8348 |
| 617 | Ga0501080_0022086 | 3300049742 | Bacteria | 5895 |
| 618 | Ga0501080_0181923 | 3300049742 | Bacteria | 1934 |
| 619 | Ga0501080_0196936 | 3300049742 | Bacteria | 1850 |
| 620 | Ga0501083_0002845 | 3300049744 | Bacteria | 11967 |
| 621 | Ga0501083_0007673 | 3300049744 | Bacteria | 7650 |
| 622 | Ga0501083_0049533 | 3300049744 | Bacteria | 2831 |
| 623 | Ga0501083_0129652 | 3300049744 | Bacteria | 1653 |
| 624 | Ga0501035_0280449 | 3300049822 | Bacteria | 1408 |
| 625 | Ga0501044_0002455 | 3300049823 | Bacteria | 21138 |
| 626 | Ga0501044_0004301 | 3300049823 | Bacteria | 15971 |
| 627 | Ga0501044_0005226 | 3300049823 | Bacteria | 14444 |
| 628 | Ga0501044_0070117 | 3300049823 | Bacteria | 3567 |
| 629 | Ga0501044_0207648 | 3300049823 | Bacteria | 1914 |
| 630 | nmdc:mga03683_467496_c1 | 3300050489 | Bacteria | 608 |
| 631 | nmdc:mga03n38_44855_c1 | 3300050490 | Bacteria | 1944 |
| 632 | nmdc:mga00v17_344_c1 | 3300050491 | Bacteria | 26181 |
| 633 | nmdc:mga00v17_3983_c1 | 3300050491 | Bacteria | 7623 |
| 634 | nmdc:mga0k408_259835_c1 | 3300050493 | Bacteria | 1037 |
| 635 | nmdc:mga0k408_82415_c1 | 3300050493 | Bacteria | 1885 |
| 636 | nmdc:mga04h51_3658_c1 | 3300050495 | Bacteria | 3760 |
| 637 | nmdc:mga07m45_1519_c1 | 3300050496 | Bacteria | 10643 |
| 638 | nmdc:mga07m45_164686_c1 | 3300050496 | Bacteria | 1288 |
| 639 | nmdc:mga07m45_271914_c1 | 3300050496 | Bacteria | 986 |
| 640 | Ga0500635_0000252 | 3300053080 | Bacteria | 22210 |
| 641 | Ga0500635_0000381 | 3300053080 | Bacteria | 13714 |
| 642 | Ga0500635_0036245 | 3300053080 | Bacteria | 1625 |
| 643 | Ga0495619_0104544 | 3300053085 | Bacteria | 1930 |
| 644 | Ga0500578_0001117 | 3300053086 | Bacteria | 28820 |
| 645 | Ga0500578_0205274 | 3300053086 | Bacteria | 1204 |
| 646 | Ga0500643_004997 | 3300053087 | Bacteria | 5819 |
| 647 | Ga0500643_007800 | 3300053087 | Bacteria | 4269 |
| 648 | Ga0500643_009670 | 3300053087 | Bacteria | 3661 |
| 649 | Ga0500644_0000903 | 3300053088 | Bacteria | 9484 |
| 650 | Ga0500646_0007024 | 3300053090 | Bacteria | 2871 |
| 651 | Ga0500647_0001015 | 3300053091 | Bacteria | 8948 |
| 652 | Ga0500647_0021841 | 3300053091 | Bacteria | 2989 |
| 653 | Ga0500583_0388516 | 3300053092 | Bacteria | 671 |
| 654 | Ga0500651_0001298 | 3300053093 | Bacteria | 12461 |
| 655 | Ga0500651_0030734 | 3300053093 | Bacteria | 3381 |
| 656 | Ga0500566_0030594 | 3300053094 | Bacteria | 3139 |
| 657 | Ga0500641_0000471 | 3300053096 | Bacteria | 14669 |
| 658 | Ga0500641_0021092 | 3300053096 | Bacteria | 2478 |
| 659 | Ga0500650_0390451 | 3300053098 | Bacteria | 603 |
| 660 | Ga0500555_004945 | 3300053103 | Bacteria | 3781 |
| 661 | Ga0500556_0001676 | 3300053104 | Bacteria | 8570 |
| 662 | Ga0500562_001028 | 3300053108 | Bacteria | 6833 |
| 663 | Ga0500562_001576 | 3300053108 | Bacteria | 5663 |
| 664 | Ga0500562_005914 | 3300053108 | Bacteria | 3080 |
| 665 | Ga0500569_000507 | 3300053109 | Bacteria | 6488 |
| 666 | Ga0500572_000158 | 3300053111 | Bacteria | 23700 |
| 667 | Ga0500595_023625 | 3300053119 | Bacteria | 2157 |
| 668 | Ga0500595_027809 | 3300053119 | Bacteria | 1933 |
| 669 | Ga0500597_104715 | 3300053120 | Bacteria | 1230 |
| 670 | Ga0500608_000127 | 3300053122 | Bacteria | 31011 |
| 671 | Ga0500608_002789 | 3300053122 | Bacteria | 6443 |
| 672 | Ga0500608_178394 | 3300053122 | Bacteria | 902 |
| 673 | Ga0500614_020946 | 3300053123 | Bacteria | 1513 |
| 674 | Ga0500618_000152 | 3300053125 | Bacteria | 57055 |
| 675 | Ga0500658_0003919 | 3300053134 | Bacteria | 5594 |
| 676 | Ga0500559_0000048 | 3300053136 | Bacteria | 93755 |
| 677 | Ga0500559_0000054 | 3300053136 | Bacteria | 90695 |
| 678 | Ga0500559_0005611 | 3300053136 | Bacteria | 5751 |
| 679 | Ga0500559_0034704 | 3300053136 | Bacteria | 2176 |
| 680 | Ga0500559_0095559 | 3300053136 | Bacteria | 1364 |
| 681 | Ga0500564_005035 | 3300053138 | Bacteria | 5363 |
| 682 | Ga0500568_0111226 | 3300053139 | Bacteria | 1024 |
| 683 | Ga0500573_0194425 | 3300053140 | Bacteria | 1081 |
| 684 | Ga0500573_0240470 | 3300053140 | Bacteria | 939 |
| 685 | Ga0500577_0002187 | 3300053142 | Bacteria | 4994 |
| 686 | Ga0500590_008271 | 3300053148 | Bacteria | 5185 |
| 687 | Ga0500604_0128126 | 3300053151 | Bacteria | 852 |
| 688 | Ga0500616_0044371 | 3300053153 | Bacteria | 2372 |
| 689 | Ga0500619_025885 | 3300053154 | Bacteria | 1742 |
| 690 | Ga0500622_0005017 | 3300053156 | Bacteria | 8065 |
| 691 | Ga0500622_0009953 | 3300053156 | Bacteria | 5245 |
| 692 | Ga0500622_0014793 | 3300053156 | Bacteria | 4183 |
| 693 | Ga0500627_0006052 | 3300053158 | Bacteria | 4080 |
| 694 | Ga0500633_0080684 | 3300053160 | Bacteria | 1177 |
| 695 | Ga0500638_094956 | 3300053162 | Bacteria | 1399 |
| 696 | Ga0500636_0015413 | 3300053177 | Bacteria | 4504 |
| 697 | Ga0500637_0002566 | 3300053178 | Bacteria | 8114 |
| 698 | Ga0500611_007453 | 3300053727 | Bacteria | 1645 |
| 699 | Ga0500625_007542 | 3300053729 | Bacteria | 4737 |
| 700 | Ga0500645_001218 | 3300053730 | Bacteria | 13594 |
| 701 | Ga0500645_002274 | 3300053730 | Bacteria | 8720 |
| 702 | Ga0500645_039525 | 3300053730 | Bacteria | 1397 |
| 703 | Ga0500645_074201 | 3300053730 | Bacteria | 974 |
| 704 | Ga0500609_001688 | 3300053731 | Bacteria | 3215 |
| 705 | Ga0500596_007463 | 3300053735 | Bacteria | 1791 |
| 706 | Ga0501084_0105102 | 3300054114 | Bacteria | 2371 |
| 707 | Ga0501082_0010360 | 3300060353 | Bacteria | 8028 |
| 708 | Ga0501082_0564256 | 3300060353 | Bacteria | 996 |
| 709 | Ga0501082_0878883 | 3300060353 | Bacteria | 784 |
| 710 | Ga0466962_0002337 | 3300061719 | Bacteria | 8988 |
| 711 | Ga0466962_0060442 | 3300061719 | Bacteria | 1809 |
| 712 | 2511123838 | 2510917020 | Bacteria | 5657507 |
| 713 | 2585148289 | 2582581279 | Bacteria | 4980720 |
| 714 | 2585150977 | 2582581280 | Bacteria | 5994497 |
| 715 | 2585196362 | 2582581293 | Bacteria | 5907401 |
| 716 | 2587919161 | 2585428106 | Bacteria | 5179711 |
| 717 | 2603861884 | 2602042107 | Bacteria | 6226103 |
| 718 | 2643750332 | 2643221545 | Bacteria | 5083237 |
| 719 | 2643780397 | 2643221552 | Bacteria | 5708754 |
| 720 | 2643882366 | 2643221574 | Bacteria | 2789653 |
| 721 | 2643926880 | 2643221583 | Bacteria | 5218014 |
| 722 | 2643929724 | 2643221584 | Bacteria | 5511711 |
| 723 | 2643998733 | 2643221598 | Bacteria | 4578346 |
| 724 | 2644087316 | 2643221614 | Bacteria | 4260023 |
| 725 | 2644237048 | 2643221642 | Bacteria | 5357871 |
| 726 | 2644344640 | 2643221661 | Bacteria | 4267604 |
| 727 | 2644353546 | 2643221663 | Bacteria | 3425771 |
| 728 | 2644366676 | 2643221666 | Bacteria | 4265935 |
| 729 | 2644507221 | 2643221691 | Bacteria | 5093099 |
| 730 | 2644548642 | 2643221699 | Bacteria | 5731501 |
| 731 | 2739792681 | 2739367756 | Bacteria | 4553612 |
| 732 | 2792461287 | 2791355048 | Bacteria | 5832535 |
| 733 | 2819538370 | 2818991435 | Bacteria | 5433759 |
| 734 | 2819648185 | 2818991454 | Bacteria | 5563326 |
| 735 | 2843745357 | 2843744320 | Bacteria | 5659202 |
| 736 | 2849564637 | 2849560528 | Bacteria | 5393480 |
| 737 | 2849577743 | 2849573788 | Bacteria | 5421256 |
| 738 | 2851155630 | 2851153111 | Bacteria | 5542585 |
| 739 | 2857508435 | 2857504554 | Bacteria | 5369913 |
| 740 | 2857526051 | 2857524615 | Bacteria | 6615449 |
| 741 | 2884961237 | 2884960567 | Bacteria | 5437054 |
| 742 | 2893067674 | 2893066018 | Bacteria | 6158120 |
| 743 | 2898331111 | 2898329390 | Bacteria | 5168154 |
| 744 | 2919074097 | 2919073203 | Bacteria | 6531949 |
| 745 | 2928534569 | 2928531327 | Bacteria | 5101314 |
| 746 | 2928973369 | 2928972540 | Bacteria | 3058286 |
| 747 | 2941489406 | 2941485952 | Bacteria | 3591484 |
| 748 | 2977240656 | 2977240413 | Bacteria | 3191065 |
| 749 | Ga0501032_0499693 | |||
| 750 | JGI25153J46596_10054105 | |||
| 751 | JGI25153J46596_10059833 | |||
| 752 | Ga0006562J51391_1100661 | |||
| 753 | Ga0006562J51391_1100662 | |||
| 754 | Ga0055526_1036975 | |||
| 755 | Ga0055537_1004057 | |||
| 756 | Ga0055524_1004330 | |||
| 757 | Ga0055536_1000922 | |||
| 758 | Ga0055536_1001003 | |||
| 759 | Ga0055536_1001808 | |||
| 760 | Ga0055528_1011938 | |||
| 761 | Ga0055530_10004136 | |||
| 762 | Ga0055530_10013311 | |||
| 763 | Ga0055531_10000820 | |||
| 764 | Ga0055531_10003394 | |||
| 765 | Ga0055531_10004973 | |||
| 766 | Ga0055531_10052231 | |||
| 767 | Ga0065165_1000561 | |||
| 768 | Ga0065165_1000896 | |||
| 769 | Ga0065165_1059625 | |||
| 770 | Ga0070658_10034828 | |||
| 771 | Ga0070658_10138442 | |||
| 772 | Ga0070658_10149859 | |||
| 773 | Ga0070670_100000022 | |||
| 774 | Ga0070670_100012197 | |||
| 775 | Ga0070670_101109573 | |||
| 776 | Ga0070666_10341744 | |||
| 777 | Ga0070680_100013150 | |||
| 778 | Ga0070680_100040088 | |||
| 779 | Ga0070680_100177258 | |||
| 780 | Ga0070660_100004808 | |||
| 781 | Ga0070660_100024618 | |||
| 782 | Ga0070660_100184598 | |||
| 783 | Ga0070660_100528800 | |||
| 784 | Ga0070689_100173885 | |||
| 785 | Ga0070691_10035767 | |||
| 786 | Ga0070661_100887144 | |||
| 787 | Ga0070668_100000960 | |||
| 788 | Ga0070668_100002198 | |||
| 789 | Ga0070668_100292843 | |||
| 790 | Ga0070669_100027883 | |||
| 791 | Ga0070669_100659540 | |||
| 792 | Ga0070671_100003754 | |||
| 793 | Ga0070673_100008560 | |||
| 794 | Ga0070659_100000399 | |||
| 795 | Ga0070659_100017079 | |||
| 796 | Ga0070659_100052331 | |||
| 797 | Ga0070667_100000369 | |||
| 798 | Ga0070667_100003519 | |||
| 799 | Ga0070667_100009968 | |||
| 800 | Ga0070678_100397111 | |||
| 801 | Ga0070662_100014973 | |||
| 802 | Ga0070681_10002223 | |||
| 803 | Ga0070681_10007028 | |||
| 804 | Ga0070681_10043540 | |||
| 805 | Ga0070698_100380044 | |||
| 806 | Ga0070679_100004560 | |||
| 807 | Ga0068853_100005703 | |||
| 808 | Ga0068853_100006784 | |||
| 809 | Ga0068853_100069411 | |||
| 810 | Ga0068853_100519190 | |||
| 811 | Ga0068853_100858787 | |||
| 812 | Ga0070665_100000418 | |||
| 813 | Ga0070665_100002841 | |||
| 814 | Ga0070665_100005108 | |||
| 815 | Ga0070665_100026201 | |||
| 816 | Ga0070665_100158332 | |||
| 817 | Ga0068855_100013908 | |||
| 818 | Ga0068855_100015063 | |||
| 819 | Ga0068855_100020847 | |||
| 820 | Ga0068855_100067092 | |||
| 821 | Ga0068855_100090730 | |||
| 822 | Ga0068855_100222524 | |||
| 823 | Ga0068855_100740579 | |||
| 824 | Ga0070664_100165888 | |||
| 825 | Ga0068857_100377626 | |||
| 826 | Ga0068854_100106189 | |||
| 827 | Ga0068854_101053095 | |||
| 828 | Ga0068856_100063027 | |||
| 829 | Ga0068856_100252492 | |||
| 830 | Ga0068856_100304772 | |||
| 831 | Ga0068856_100570421 | |||
| 832 | Ga0068852_100005865 | |||
| 833 | Ga0068859_100002621 | |||
| 834 | Ga0068859_100184191 | |||
| 835 | Ga0068859_100374304 | |||
| 836 | Ga0068864_100000839 | |||
| 837 | Ga0068864_100011984 | |||
| 838 | Ga0068864_100023880 | |||
| 839 | Ga0068864_100659204 | |||
| 840 | Ga0068864_100815692 | |||
| 841 | Ga0068863_100000119 | |||
| 842 | Ga0068863_100009241 | |||
| 843 | Ga0068858_100003066 | |||
| 844 | Ga0068858_100065787 | |||
| 845 | Ga0068860_100000507 | |||
| 846 | Ga0068860_100071705 | |||
| 847 | Ga0068860_100468985 | |||
| 848 | Ga0068862_100000551 | |||
| 849 | Ga0068862_100110830 | |||
| 850 | Ga0068862_100405932 | |||
| 851 | Ga0068862_100638687 | |||
| 852 | Ga0081455_10009422 | |||
| 853 | Ga0081539_10000129 | |||
| 854 | Ga0075368_10001395 | |||
| 855 | Ga0075363_100023948 | |||
| 856 | Ga0075364_10000245 | |||
| 857 | Ga0075364_10039975 | |||
| 858 | Ga0075364_10071432 | |||
| 859 | Ga0075362_10107531 | |||
| 860 | Ga0075367_10000631 | |||
| 861 | Ga0075369_10090421 | |||
| 862 | Ga0075366_10007087 | |||
| 863 | Ga0075366_10052025 | |||
| 864 | Ga0075366_10056240 | |||
| 865 | Ga0075366_10171437 | |||
| 866 | Ga0097621_100544337 | |||
| 867 | Ga0075370_10105600 | |||
| 868 | Ga0075370_10115318 | |||
| 869 | Ga0075370_10334697 | |||
| 870 | Ga0075431_100582693 | |||
| 871 | Ga0068865_100014233 | |||
| 872 | Ga0097620_100002621 | |||
| 873 | Ga0097620_100184187 | |||
| 874 | Ga0097620_100374338 | |||
| 875 | Ga0079104_1040601 | |||
| 876 | Ga0105240_10035893 | |||
| 877 | Ga0105240_10067391 | |||
| 878 | Ga0105240_10266505 | |||
| 879 | Ga0105245_10183200 | |||
| 880 | Ga0105243_11709312 | |||
| 881 | Ga0105241_10496106 | |||
| 882 | Ga0105241_10754949 | |||
| 883 | Ga0105242_10585791 | |||
| 884 | Ga0105248_10004095 | |||
| 885 | Ga0105248_10008698 | |||
| 886 | Ga0105248_10011018 | |||
| 887 | Ga0105248_10529584 | |||
| 888 | Ga0105248_10757564 | |||
| 889 | Ga0105237_10003533 | |||
| 890 | Ga0105237_10479121 | |||
| 891 | Ga0105238_10023580 | |||
| 892 | Ga0105238_10027667 | |||
| 893 | Ga0105238_10299503 | |||
| 894 | Ga0105249_10000729 | |||
| 895 | Ga0105249_10394581 | |||
| 896 | Ga0105249_10466072 | |||
| 897 | Ga0105239_10137186 | |||
| 898 | Ga0105246_10435597 | |||
| 899 | Ga0157373_10000445 | |||
| 900 | Ga0157373_10000769 | |||
| 901 | Ga0157371_10011051 | |||
| 902 | Ga0157370_10012691 | |||
| 903 | Ga0157370_10027913 | |||
| 904 | Ga0157369_10152171 | |||
| 905 | Ga0157369_10710989 | |||
| 906 | Ga0157369_10727236 | |||
| 907 | Ga0157369_10919950 | |||
| 908 | Ga0163162_10094055 | |||
| 909 | Ga0163162_10195308 | |||
| 910 | Ga0157372_10670550 | |||
| 911 | Ga0163163_10002724 | |||
| 912 | Ga0163163_10111417 | |||
| 913 | Ga0163163_10437199 | |||
| 914 | Ga0163163_10455557 | |||
| 915 | Ga0163163_11656718 | |||
| 916 | Ga0182008_10266229 | |||
| 917 | Ga0157377_10539814 | |||
| 918 | Ga0157379_10002078 | |||
| 919 | Ga0157379_10122544 | |||
| 920 | Ga0182006_1062523 | |||
| 921 | Ga0182005_1003061 | |||
| 922 | Ga0183365_10001 | |||
| 923 | Ga0163161_10599635 | |||
| 924 | Ga0213874_10012812 | |||
| 925 | Ga0213876_10000571 | |||
| 926 | Ga0213876_10011133 | |||
| 927 | Ga0209026_1009261 | |||
| 928 | Ga0209026_1014848 | |||
| 929 | Ga0209148_1006423 | |||
| 930 | Ga0209565_1004647 | |||
| 931 | Ga0209673_1001534 | |||
| 932 | Ga0209675_1004417 | |||
| 933 | Ga0209676_1000283 | |||
| 934 | Ga0209676_1000319 | |||
| 935 | Ga0209676_1000401 | |||
| 936 | Ga0209676_1001427 | |||
| 937 | Ga0209564_1007906 | |||
| 938 | Ga0209564_1015664 | |||
| 939 | Ga0209758_1000936 | |||
| 940 | Ga0209758_1001446 | |||
| 941 | Ga0209758_1005528 | |||
| 942 | Ga0209050_1000245 | |||
| 943 | Ga0209050_1000584 | |||
| 944 | Ga0209050_1001426 | |||
| 945 | Ga0209050_1019676 | |||
| 946 | Ga0209256_1004881 | |||
| 947 | Ga0209256_1005664 | |||
| 948 | Ga0209051_1001183 | |||
| 949 | Ga0209257_1000184 | |||
| 950 | Ga0209257_1000352 | |||
| 951 | Ga0209257_1000995 | |||
| 952 | Ga0209257_1001133 | |||
| 953 | Ga0209257_1001595 | |||
| 954 | Ga0209257_1005790 | |||
| 955 | Ga0207697_10194531 | |||
| 956 | Ga0207680_10105802 | |||
| 957 | Ga0207680_10381387 | |||
| 958 | Ga0207705_10010302 | |||
| 959 | Ga0207705_10057833 | |||
| 960 | Ga0207705_10067665 | |||
| 961 | Ga0207705_10576507 | |||
| 962 | Ga0207707_10013631 | |||
| 963 | Ga0207707_10030418 | |||
| 964 | Ga0207707_10070584 | |||
| 965 | Ga0207695_10000837 | |||
| 966 | Ga0207695_10005140 | |||
| 967 | Ga0207695_10013898 | |||
| 968 | Ga0207695_10048219 | |||
| 969 | Ga0207671_10001343 | |||
| 970 | Ga0207660_10001046 | |||
| 971 | Ga0207660_10033108 | |||
| 972 | Ga0207660_10038049 | |||
| 973 | Ga0207657_10004700 | |||
| 974 | Ga0207657_10010320 | |||
| 975 | Ga0207652_10004972 | |||
| 976 | Ga0207652_10118615 | |||
| 977 | Ga0207681_10027089 | |||
| 978 | Ga0207694_10018908 | |||
| 979 | Ga0207694_10039683 | |||
| 980 | Ga0207694_11176790 | |||
| 981 | Ga0207650_10000016 | |||
| 982 | Ga0207650_10007596 | |||
| 983 | Ga0207644_10005639 | |||
| 984 | Ga0207690_10000695 | |||
| 985 | Ga0207690_10083286 | |||
| 986 | Ga0207690_10099777 | |||
| 987 | Ga0207706_10031710 | |||
| 988 | Ga0207670_10254092 | |||
| 989 | Ga0207669_10907873 | |||
| 990 | Ga0207704_10029709 | |||
| 991 | Ga0207711_10001468 | |||
| 992 | Ga0207711_10007218 | |||
| 993 | Ga0207711_10373626 | |||
| 994 | Ga0207711_10720479 | |||
| 995 | Ga0207711_10988358 | |||
| 996 | Ga0207661_10088101 | |||
| 997 | Ga0207679_10137765 | |||
| 998 | Ga0207679_10145569 | |||
| 999 | Ga0207667_10001958 | |||
| 1000 | Ga0207667_10021156 | |||
| 1001 | Ga0207667_10108241 | |||
| 1002 | Ga0207667_10201234 | |||
| 1003 | Ga0207667_10348877 | |||
| 1004 | Ga0207667_10506781 | |||
| 1005 | Ga0207667_10603643 | |||
| 1006 | Ga0207651_10038193 | |||
| 1007 | Ga0207712_10004155 | |||
| 1008 | Ga0207712_10102634 | |||
| 1009 | Ga0207668_10000019 | |||
| 1010 | Ga0207668_10000241 | |||
| 1011 | Ga0207668_10008731 | |||
| 1012 | Ga0207668_10233090 | |||
| 1013 | Ga0207658_10000295 | |||
| 1014 | Ga0207658_10004237 | |||
| 1015 | Ga0207677_10096546 | |||
| 1016 | Ga0207677_10764608 | |||
| 1017 | Ga0207703_10003003 | |||
| 1018 | Ga0207703_10003368 | |||
| 1019 | Ga0207639_10017371 | |||
| 1020 | Ga0207639_10079810 | |||
| 1021 | Ga0207678_11090360 | |||
| 1022 | Ga0207702_10386514 | |||
| 1023 | Ga0207641_10002594 | |||
| 1024 | Ga0207641_10014411 | |||
| 1025 | Ga0207641_10768328 | |||
| 1026 | Ga0207676_10000408 | |||
| 1027 | Ga0207676_10016500 | |||
| 1028 | Ga0207676_10477413 | |||
| 1029 | Ga0207675_100196638 | |||
| 1030 | Ga0207683_10285280 | |||
| 1031 | Ga0209281_1027887 | |||
| 1032 | Ga0209981_1000192 | |||
| 1033 | Ga0209983_1003863 | |||
| 1034 | Ga0209813_10001034 | |||
| 1035 | Ga0268266_10000003 | |||
| 1036 | Ga0268266_10000481 | |||
| 1037 | Ga0268266_10001814 | |||
| 1038 | Ga0268266_10005619 | |||
| 1039 | Ga0268266_10030422 | |||
| 1040 | Ga0268266_10134524 | |||
| 1041 | Ga0268266_10171512 | |||
| 1042 | Ga0268266_10631626 | |||
| 1043 | Ga0268265_10017989 | |||
| 1044 | Ga0268265_10072266 | |||
| 1045 | Ga0268265_10613165 | |||
| 1046 | Ga0268264_10000207 | |||
| 1047 | Ga0268264_10019198 | |||
| 1048 | Ga0268264_10097566 | |||
| 1049 | Ga0265337_1010913 | |||
| 1050 | Ga0265334_10013950 | |||
| 1051 | Ga0307517_10000835 | |||
| 1052 | Ga0307515_10141502 | |||
| 1053 | Ga0307515_10176794 | |||
| 1054 | Ga0307515_10341904 | |||
| 1055 | Ga0265338_10014807 | |||
| 1056 | Ga0265338_10017120 | |||
| 1057 | Ga0265338_10023871 | |||
| 1058 | Ga0265338_10059145 | |||
| 1059 | Ga0265338_10115360 | |||
| 1060 | Ga0265338_10806293 | |||
| 1061 | Ga0307511_10009787 | |||
| 1062 | Ga0265332_10192499 | |||
| 1063 | Ga0265325_10003959 | |||
| 1064 | Ga0265339_10019644 | |||
| 1065 | Ga0265327_10000442 | |||
| 1066 | Ga0265327_10004607 | |||
| 1067 | Ga0265327_10006001 | |||
| 1068 | Ga0265316_10354738 | |||
| 1069 | Ga0307513_10000873 | |||
| 1070 | Ga0307513_10013077 | |||
| 1071 | Ga0307513_10023666 | |||
| 1072 | Ga0307513_10044795 | |||
| 1073 | Ga0307513_10539250 | |||
| 1074 | Ga0307408_100168680 | |||
| 1075 | Ga0307408_100578557 | |||
| 1076 | Ga0265313_10000062 | |||
| 1077 | Ga0265313_10006275 | |||
| 1078 | Ga0265314_10029233 | |||
| 1079 | Ga0265314_10082875 | |||
| 1080 | Ga0307516_10000030 | |||
| 1081 | Ga0307516_10261999 | |||
| 1082 | Ga0307405_10940581 | |||
| 1083 | Ga0307413_10364092 | |||
| 1084 | Ga0307413_10955520 | |||
| 1085 | Ga0307406_10000448 | |||
| 1086 | Ga0307406_10419836 | |||
| 1087 | Ga0307412_10003082 | |||
| 1088 | Ga0307412_10434990 | |||
| 1089 | Ga0307412_10729119 | |||
| 1090 | Ga0307414_10021392 | |||
| 1091 | Ga0307414_10031686 | |||
| 1092 | Ga0307414_10035550 | |||
| 1093 | Ga0307414_10062866 | |||
| 1094 | Ga0307414_10299184 | |||
| 1095 | Ga0307414_10303875 | |||
| 1096 | Ga0307414_10341403 | |||
| 1097 | Ga0307414_10401487 | |||
| 1098 | Ga0307414_10406222 | |||
| 1099 | Ga0307411_10204690 | |||
| 1100 | Ga0307510_10055823 | |||
| 1101 | Ga0373944_0006252 | |||
| 1102 | Ga0373960_0103400 | |||
| 1103 | Ga0373943_0019233 | |||
| 1104 | Ga0373931_0091036 | |||
| 1105 | Ga0373931_0126924 | |||
| 1106 | Ga0373935_0018852 | |||
| 1107 | Ga0373927_0001188 | |||
| 1108 | Ga0373933_0289069 | |||
| 1109 | Ga0373937_0540524 | |||
| 1110 | Ga0373937_0749643 | |||
| 1111 | Ga0373925_0000089 | |||
| 1112 | Ga0373925_0714430 | |||
| 1113 | Ga0395899_0000003 | |||
| 1114 | Ga0395899_0000790 | |||
| 1115 | Ga0395899_0114223 | |||
| 1116 | Ga0395899_0179821 | |||
| 1117 | Ga0395900_0000844 | |||
| 1118 | Ga0395900_0010379 | |||
| 1119 | Ga0395900_0753155 | |||
| 1120 | Ga0395900_1019874 | |||
| 1121 | Ga0395898_0006267 | |||
| 1122 | Ga0395898_0048541 | |||
| 1123 | Ga0395898_0436481 | |||
| 1124 | Ga0395898_0856108 | |||
| 1125 | Ga0395905_0047804 | |||
| 1126 | Ga0395905_0073027 | |||
| 1127 | Ga0395905_0086332 | |||
| 1128 | Ga0395905_0152211 | |||
| 1129 | Ga0395905_0282901 | |||
| 1130 | Ga0395905_0364318 | |||
| 1131 | Ga0395905_0374535 | |||
| 1132 | Ga0395905_0400318 | |||
| 1133 | Ga0395905_0426155 | |||
| 1134 | Ga0436364_0305192 | |||
| 1135 | Ga0436364_0505125 | |||
| 1136 | Ga0395901_0000052 | |||
| 1137 | Ga0395901_0055218 | |||
| 1138 | Ga0395901_0108202 | |||
| 1139 | Ga0395901_0417902 | |||
| 1140 | Ga0395901_0813505 | |||
| 1141 | Ga0400483_090428 | |||
| 1142 | Ga0400483_230835 | |||
| 1143 | Ga0436365_1465717 | |||
| 1144 | Ga0436365_1586327 | |||
| 1145 | Ga0436360_0954883 | |||
| 1146 | Ga0436361_0030985 | |||
| 1147 | Ga0436361_0583434 | |||
| 1148 | Ga0436361_0914864 | |||
| 1149 | Ga0436361_0916358 | |||
| 1150 | Ga0436363_0512795 | |||
| 1151 | Ga0436363_1260763 | |||
| 1152 | Ga0451789_1067160 | |||
| 1153 | Ga0439431_0060500 | |||
| 1154 | Ga0439435_0022485 | |||
| 1155 | Ga0439459_0010297 | |||
| 1156 | Ga0450901_002469 | |||
| 1157 | Ga0451577_0191866 | |||
| 1158 | Ga0466969_0004404 | |||
| 1159 | Ga0466969_0078330 | |||
| 1160 | Ga0466965_0351851 | |||
| 1161 | Ga0466966_0003880 | |||
| 1162 | Ga0466961_0003730 | |||
| 1163 | Ga0466963_0011309 | |||
| 1164 | Ga0466964_0376996 | |||
| 1165 | Ga0466971_0002511 | |||
| 1166 | Ga0466968_0059582 | |||
| 1167 | Ga0466970_0003930 | |||
| 1168 | Ga0466957_0003256 | |||
| 1169 | Ga0466959_0000163 | |||
| 1170 | Ga0466959_0090707 | |||
| 1171 | Ga0466958_0001982 | |||
| 1172 | Ga0495627_000233 | |||
| 1173 | Ga0495590_0000309 | |||
| 1174 | Ga0495629_0019750 | |||
| 1175 | Ga0495638_0000782 | |||
| 1176 | Ga0495638_0000972 | |||
| 1177 | Ga0495638_0001365 | |||
| 1178 | Ga0495638_0002372 | |||
| 1179 | Ga0495638_0002789 | |||
| 1180 | Ga0495638_0043914 | |||
| 1181 | Ga0495638_0336506 | |||
| 1182 | Ga0495653_0520051 | |||
| 1183 | Ga0495650_0005658 | |||
| 1184 | Ga0495650_0059179 | |||
| 1185 | Ga0495650_0234581 | |||
| 1186 | Ga0495585_0149832 | |||
| 1187 | Ga0495585_0409871 | |||
| 1188 | Ga0495583_0000399 | |||
| 1189 | Ga0495583_0003991 | |||
| 1190 | Ga0495583_0068888 | |||
| 1191 | Ga0495606_0120126 | |||
| 1192 | Ga0495606_0156077 | |||
| 1193 | Ga0495606_0182496 | |||
| 1194 | Ga0495606_0219822 | |||
| 1195 | Ga0495610_0001275 | |||
| 1196 | Ga0495610_0001981 | |||
| 1197 | Ga0495610_0002726 | |||
| 1198 | Ga0495610_0144869 | |||
| 1199 | Ga0495616_0006268 | |||
| 1200 | Ga0495620_0033148 | |||
| 1201 | Ga0495620_0039036 | |||
| 1202 | Ga0495628_0181256 | |||
| 1203 | Ga0495628_0302073 | |||
| 1204 | Ga0495628_0321870 | |||
| 1205 | Ga0495630_0071860 | |||
| 1206 | Ga0495631_0036900 | |||
| 1207 | Ga0495632_0000665 | |||
| 1208 | Ga0495632_0228225 | |||
| 1209 | Ga0495632_0325011 | |||
| 1210 | Ga0495637_0011651 | |||
| 1211 | Ga0495637_0046265 | |||
| 1212 | Ga0495637_0073941 | |||
| 1213 | Ga0495643_0054338 | |||
| 1214 | Ga0495643_0305903 | |||
| 1215 | Ga0495648_0000039 | |||
| 1216 | Ga0495648_0094775 | |||
| 1217 | Ga0495648_0175733 | |||
| 1218 | Ga0495642_0085553 | |||
| 1219 | Ga0495652_0413896 | |||
| 1220 | Ga0495654_0000016 | |||
| 1221 | Ga0495654_0106876 | |||
| 1222 | Ga0495665_0186088 | |||
| 1223 | Ga0495597_0004569 | |||
| 1224 | Ga0495597_0030588 | |||
| 1225 | Ga0495597_0106226 | |||
| 1226 | Ga0495597_0135459 | |||
| 1227 | Ga0495645_0143970 | |||
| 1228 | Ga0495645_0214804 | |||
| 1229 | Ga0495645_0347208 | |||
| 1230 | Ga0495645_0508019 | |||
| 1231 | Ga0495622_0002431 | |||
| 1232 | Ga0495633_0000423 | |||
| 1233 | Ga0495667_0374545 | |||
| 1234 | Ga0495668_0000221 | |||
| 1235 | Ga0495668_0004400 | |||
| 1236 | Ga0495668_0008124 | |||
| 1237 | Ga0495668_0035031 | |||
| 1238 | Ga0495668_0103514 | |||
| 1239 | Ga0495668_0141456 | |||
| 1240 | Ga0495611_0010563 | |||
| 1241 | Ga0495625_0000034 | |||
| 1242 | Ga0495625_0003961 | |||
| 1243 | Ga0495625_0013206 | |||
| 1244 | Ga0495625_0053383 | |||
| 1245 | Ga0495625_0214016 | |||
| 1246 | Ga0495625_0570701 | |||
| 1247 | Ga0495657_0060854 | |||
| 1248 | Ga0495669_0000014 | |||
| 1249 | Ga0495669_0000081 | |||
| 1250 | Ga0495669_0042118 | |||
| 1251 | Ga0495613_0008104 | |||
| 1252 | Ga0495613_0198589 | |||
| 1253 | Ga0495670_0116522 | |||
| 1254 | Ga0495671_0137501 | |||
| 1255 | Ga0495671_0164492 | |||
| 1256 | Ga0495649_0000803 | |||
| 1257 | Ga0495589_0008679 | |||
| 1258 | Ga0495660_0015514 | |||
| 1259 | Ga0495660_0069672 | |||
| 1260 | Ga0495636_0203891 | |||
| 1261 | Ga0495672_0000196 | |||
| 1262 | Ga0495672_0000986 | |||
| 1263 | Ga0495672_0013127 | |||
| 1264 | Ga0495672_0074578 | |||
| 1265 | Ga0495683_0083101 | |||
| 1266 | Ga0495677_0045818 | |||
| 1267 | Ga0495679_007810 | |||
| 1268 | Ga0495673_0000277 | |||
| 1269 | Ga0495673_0001410 | |||
| 1270 | Ga0495673_0001949 | |||
| 1271 | Ga0495686_0000074 | |||
| 1272 | Ga0495686_0001197 | |||
| 1273 | Ga0495686_0002903 | |||
| 1274 | Ga0495686_0019755 | |||
| 1275 | Ga0495686_0125718 | |||
| 1276 | Ga0495686_0144981 | |||
| 1277 | Ga0495593_0010025 | |||
| 1278 | Ga0496100_0066328 | |||
| 1279 | Ga0496100_0966649 | |||
| 1280 | Ga0496102_0135975 | |||
| 1281 | Ga0496103_0363731 | |||
| 1282 | Ga0496105_0056885 | |||
| 1283 | Ga0496106_0071453 | |||
| 1284 | Ga0496106_0521464 | |||
| 1285 | Ga0496106_0848375 | |||
| 1286 | Ga0496107_0132578 | |||
| 1287 | Ga0496112_0033967 | |||
| 1288 | Ga0496112_0108728 | |||
| 1289 | Ga0496112_0393395 | |||
| 1290 | Ga0496112_0454480 | |||
| 1291 | Ga0496113_0305489 | |||
| 1292 | Ga0496113_0574058 | |||
| 1293 | Ga0496114_0929386 | |||
| 1294 | Ga0496115_0009445 | |||
| 1295 | Ga0496115_0012341 | |||
| 1296 | Ga0496115_0020970 | |||
| 1297 | Ga0496115_0034833 | |||
| 1298 | Ga0496115_0401667 | |||
| 1299 | Ga0496116_0012484 | |||
| 1300 | Ga0496116_0104743 | |||
| 1301 | Ga0496117_0040108 | |||
| 1302 | Ga0496117_0091795 | |||
| 1303 | Ga0496118_0012352 | |||
| 1304 | Ga0496118_0014192 | |||
| 1305 | Ga0496119_0148870 | |||
| 1306 | Ga0496119_0364311 | |||
| 1307 | Ga0496120_0071132 | |||
| 1308 | Ga0496121_0000035 | |||
| 1309 | Ga0496121_0013712 | |||
| 1310 | Ga0496121_0064604 | |||
| 1311 | Ga0496121_0158478 | |||
| 1312 | Ga0496122_0002994 | |||
| 1313 | Ga0496123_0004303 | |||
| 1314 | Ga0496124_0063597 | |||
| 1315 | Ga0496124_0274749 | |||
| 1316 | Ga0496124_0316445 | |||
| 1317 | Ga0496125_0001013 | |||
| 1318 | Ga0496125_0016889 | |||
| 1319 | Ga0496125_0329196 | |||
| 1320 | Ga0496126_0149172 | |||
| 1321 | Ga0496126_0358509 | |||
| 1322 | Ga0495678_000773 | |||
| 1323 | Ga0501033_0002538 | |||
| 1324 | Ga0501033_0134799 | |||
| 1325 | Ga0501033_0149123 | |||
| 1326 | Ga0501034_0034395 | |||
| 1327 | Ga0501034_0405909 | |||
| 1328 | Ga0501034_0804813 | |||
| 1329 | Ga0501034_1309958 | |||
| 1330 | Ga0501036_0069717 | |||
| 1331 | Ga0501036_0288634 | |||
| 1332 | Ga0501037_0008727 | |||
| 1333 | Ga0501037_0014126 | |||
| 1334 | Ga0501037_0061325 | |||
| 1335 | Ga0501037_0780570 | |||
| 1336 | Ga0501038_0249883 | |||
| 1337 | Ga0501038_0281287 | |||
| 1338 | Ga0501043_0047212 | |||
| 1339 | Ga0501043_0081076 | |||
| 1340 | Ga0501043_0102371 | |||
| 1341 | Ga0501046_0241749 | |||
| 1342 | Ga0501046_0726547 | |||
| 1343 | Ga0501047_0043548 | |||
| 1344 | Ga0501047_0054044 | |||
| 1345 | Ga0501047_0096003 | |||
| 1346 | Ga0501047_0224249 | |||
| 1347 | Ga0501047_0294087 | |||
| 1348 | Ga0501047_0326879 | |||
| 1349 | Ga0501047_0760063 | |||
| 1350 | Ga0501048_0238662 | |||
| 1351 | Ga0501067_0000210 | |||
| 1352 | Ga0501067_0038780 | |||
| 1353 | Ga0501068_0000231 | |||
| 1354 | Ga0501070_0540562 | |||
| 1355 | Ga0501072_0015337 | |||
| 1356 | Ga0501073_0000002 | |||
| 1357 | Ga0501073_0011697 | |||
| 1358 | Ga0501073_0045456 | |||
| 1359 | Ga0501074_0186235 | |||
| 1360 | Ga0501077_0000003 | |||
| 1361 | Ga0501077_0060131 | |||
| 1362 | Ga0501238_001246 | |||
| 1363 | Ga0501080_0009896 | |||
| 1364 | Ga0501080_0010816 | |||
| 1365 | Ga0501080_0022086 | |||
| 1366 | Ga0501080_0181923 | |||
| 1367 | Ga0501080_0196936 | |||
| 1368 | Ga0501083_0002845 | |||
| 1369 | Ga0501083_0007673 | |||
| 1370 | Ga0501083_0049533 | |||
| 1371 | Ga0501083_0129652 | |||
| 1372 | Ga0501035_0280449 | |||
| 1373 | Ga0501044_0002455 | |||
| 1374 | Ga0501044_0004301 | |||
| 1375 | Ga0501044_0005226 | |||
| 1376 | Ga0501044_0070117 | |||
| 1377 | Ga0501044_0207648 | |||
| 1378 | nmdc:mga03683_467496_c1 | |||
| 1379 | nmdc:mga03n38_44855_c1 | |||
| 1380 | nmdc:mga00v17_344_c1 | |||
| 1381 | nmdc:mga00v17_3983_c1 | |||
| 1382 | nmdc:mga0k408_259835_c1 | |||
| 1383 | nmdc:mga0k408_82415_c1 | |||
| 1384 | nmdc:mga04h51_3658_c1 | |||
| 1385 | nmdc:mga07m45_1519_c1 | |||
| 1386 | nmdc:mga07m45_164686_c1 | |||
| 1387 | nmdc:mga07m45_271914_c1 | |||
| 1388 | Ga0500635_0000252 | |||
| 1389 | Ga0500635_0000381 | |||
| 1390 | Ga0500635_0036245 | |||
| 1391 | Ga0495619_0104544 | |||
| 1392 | Ga0500578_0001117 | |||
| 1393 | Ga0500578_0205274 | |||
| 1394 | Ga0500643_004997 | |||
| 1395 | Ga0500643_007800 | |||
| 1396 | Ga0500643_009670 | |||
| 1397 | Ga0500644_0000903 | |||
| 1398 | Ga0500646_0007024 | |||
| 1399 | Ga0500647_0001015 | |||
| 1400 | Ga0500647_0021841 | |||
| 1401 | Ga0500583_0388516 | |||
| 1402 | Ga0500651_0001298 | |||
| 1403 | Ga0500651_0030734 | |||
| 1404 | Ga0500566_0030594 | |||
| 1405 | Ga0500641_0000471 | |||
| 1406 | Ga0500641_0021092 | |||
| 1407 | Ga0500650_0390451 | |||
| 1408 | Ga0500555_004945 | |||
| 1409 | Ga0500556_0001676 | |||
| 1410 | Ga0500562_001028 | |||
| 1411 | Ga0500562_001576 | |||
| 1412 | Ga0500562_005914 | |||
| 1413 | Ga0500569_000507 | |||
| 1414 | Ga0500572_000158 | |||
| 1415 | Ga0500595_023625 | |||
| 1416 | Ga0500595_027809 | |||
| 1417 | Ga0500597_104715 | |||
| 1418 | Ga0500608_000127 | |||
| 1419 | Ga0500608_002789 | |||
| 1420 | Ga0500608_178394 | |||
| 1421 | Ga0500614_020946 | |||
| 1422 | Ga0500618_000152 | |||
| 1423 | Ga0500658_0003919 | |||
| 1424 | Ga0500559_0000048 | |||
| 1425 | Ga0500559_0000054 | |||
| 1426 | Ga0500559_0005611 | |||
| 1427 | Ga0500559_0034704 | |||
| 1428 | Ga0500559_0095559 | |||
| 1429 | Ga0500564_005035 | |||
| 1430 | Ga0500568_0111226 | |||
| 1431 | Ga0500573_0194425 | |||
| 1432 | Ga0500573_0240470 | |||
| 1433 | Ga0500577_0002187 | |||
| 1434 | Ga0500590_008271 | |||
| 1435 | Ga0500604_0128126 | |||
| 1436 | Ga0500616_0044371 | |||
| 1437 | Ga0500619_025885 | |||
| 1438 | Ga0500622_0005017 | |||
| 1439 | Ga0500622_0009953 | |||
| 1440 | Ga0500622_0014793 | |||
| 1441 | Ga0500627_0006052 | |||
| 1442 | Ga0500633_0080684 | |||
| 1443 | Ga0500638_094956 | |||
| 1444 | Ga0500636_0015413 | |||
| 1445 | Ga0500637_0002566 | |||
| 1446 | Ga0500611_007453 | |||
| 1447 | Ga0500625_007542 | |||
| 1448 | Ga0500645_001218 | |||
| 1449 | Ga0500645_002274 | |||
| 1450 | Ga0500645_039525 | |||
| 1451 | Ga0500645_074201 | |||
| 1452 | Ga0500609_001688 | |||
| 1453 | Ga0500596_007463 | |||
| 1454 | Ga0501084_0105102 | |||
| 1455 | Ga0501082_0010360 | |||
| 1456 | Ga0501082_0564256 | |||
| 1457 | Ga0501082_0878883 | |||
| 1458 | Ga0466962_0002337 | |||
| 1459 | Ga0466962_0060442 | |||
| 1460 | 2511123838 | |||
| 1461 | 2585148289 | |||
| 1462 | 2585150977 | |||
| 1463 | 2585196362 | |||
| 1464 | 2587919161 | |||
| 1465 | 2603861884 | |||
| 1466 | 2643750332 | |||
| 1467 | 2643780397 | |||
| 1468 | 2643882366 | |||
| 1469 | 2643926880 | |||
| 1470 | 2643929724 | |||
| 1471 | 2643998733 | |||
| 1472 | 2644087316 | |||
| 1473 | 2644237048 | |||
| 1474 | 2644344640 | |||
| 1475 | 2644353546 | |||
| 1476 | 2644366676 | |||
| 1477 | 2644507221 | |||
| 1478 | 2644548642 | |||
| 1479 | 2739792681 | |||
| 1480 | 2792461287 | |||
| 1481 | 2819538370 | |||
| 1482 | 2819648185 | |||
| 1483 | 2843745357 | |||
| 1484 | 2849564637 | |||
| 1485 | 2849577743 | |||
| 1486 | 2851155630 | |||
| 1487 | 2857508435 | |||
| 1488 | 2857526051 | |||
| 1489 | 2884961237 | |||
| 1490 | 2893067674 | |||
| 1491 | 2898331111 | |||
| 1492 | 2919074097 | |||
| 1493 | 2928534569 | |||
| 1494 | 2928973369 | |||
| 1495 | 2941489406 | |||
| 1496 | 2977240656 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3crn-assembly1.cif.gz_B | crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 | 0.9161 | 14 | 121 |
| 6lgq-assembly1.cif.gz_D | the crystal complex structure of histidine kinase and response regulator | 0.9126 | 14 | 121 |
| 7w9h-assembly1.cif.gz_A | crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa | 0.9099 | 14 | 122 |
| 3q15-assembly1.cif.gz_C-2 | crystal structure of raph complexed with spo0f | 0.907 | 15 | 124 |
| 7lza-assembly1.cif.gz_A | activated form of vanr from s. coelicolor | 0.9038 | 14 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9449 | 15 | 93 | 3.40.50.2300 |
| af_Q2FVQ9_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9152 | 15 | 93 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9121 | 15 | 93 | 3.40.50.2300 |
| af_Q2G2U6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9113 | 15 | 93 | 3.40.50.2300 |
| af_P71814_19_100_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9104 | 15 | 93 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537MTC4-F1-model_v4 | Response regulator | 0.977 | 11 | 128 |
GO:0000160
|
| AF-A0A5R2N4K3-F1-model_v4 | Response regulator | 0.9665 | 10 | 121 |
GO:0000160
|
| AF-A0A350ACA4-F1-model_v4 | Two-component system response regulator | 0.9511 | 6 | 115 |
GO:0000160
|
| AF-A0A7V3BLX4-F1-model_v4 | Response regulator | 0.9393 | 11 | 125 |
GO:0000160
|
| AF-A0A849ZNT2-F1-model_v4 | Response regulator | 0.931 | 13 | 127 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |