F478982

General Info

Members Datasets Scaffolds Average Seq Length
748 380 1496 185

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0499693|Ga0501032_0499693_94_747
Length 217
Sequence MADELPLAQTDDTATECRKLEFRELRDAWGGCMTDLTADVAVLPDKSLLVLDDDAPLRTRLGRALEQRGFEPTLVASVAEALAAVRVHAPAFAVLDMRLEDGTGLKVVEAVRDARPDAKIIMLTGYGNIATAVQAVKAGAVDYLSKPADADDVVRALLVRGDRPAAPPDNPMSADRVRWEHIQRVYELCNHNVSETARRLNMHRRTLQRILAKRAPR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
83 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
135 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
143 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
245 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
301 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
302 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
303 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
304 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
305 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
306 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
307 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
312 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
313 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
314 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
315 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
316 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
317 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
318 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
319 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
325 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
326 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
327 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
330 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
331 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
332 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
333 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
334 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
335 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
336 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
337 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
338 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
339 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
340 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
345 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
346 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
347 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
348 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
349 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
350 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
351 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
352 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
353 2643221583 Caulobacter sp. Root655 Isolate Unclassified
354 2643221584 Caulobacter sp. Root656 Isolate Unclassified
355 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
356 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
357 2643221642 Caulobacter sp. Root343 Isolate Unclassified
358 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
359 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
360 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
361 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
362 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
363 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
364 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
365 2818991435 Caulobacter henricii 536 Isolate Unclassified
366 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
367 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
368 2849560528 Caulobacter zeae 410 Isolate Unclassified
369 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
370 2851153111 Caulobacter radicis 736 Isolate Unclassified
371 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
372 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
373 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
374 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
375 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
376 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
377 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
378 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
379 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
380 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.79
Metatranscriptomes 0.27
Isolates 4.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.05
Nodule 0.27
Rhizoplane 3.07
Rhizosphere 68.45
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0499693 3300049569 Bacteria 777
2 JGI25153J46596_10054105 3300003215 Bacteria 1132
3 JGI25153J46596_10059833 3300003215 Bacteria 1040
4 Ga0006562J51391_1100661 3300003578 Bacteria 6340
5 Ga0006562J51391_1100662 3300003578 Bacteria 5890
6 Ga0055526_1036975 3300003771 Bacteria 1285
7 Ga0055537_1004057 3300003773 Bacteria 4297
8 Ga0055524_1004330 3300003775 Bacteria 6578
9 Ga0055536_1000922 3300003781 Bacteria 18976
10 Ga0055536_1001003 3300003781 Bacteria 17938
11 Ga0055536_1001808 3300003781 Bacteria 12576
12 Ga0055528_1011938 3300003790 Bacteria 3407
13 Ga0055530_10004136 3300003791 Bacteria 7680
14 Ga0055530_10013311 3300003791 Bacteria 2815
15 Ga0055531_10000820 3300003794 Bacteria 25755
16 Ga0055531_10003394 3300003794 Bacteria 10179
17 Ga0055531_10004973 3300003794 Bacteria 7890
18 Ga0055531_10052231 3300003794 Bacteria 1066
19 Ga0065165_1000561 3300005262 Bacteria 55325
20 Ga0065165_1000896 3300005262 Bacteria 38454
21 Ga0065165_1059625 3300005262 Bacteria 1050
22 Ga0070658_10034828 3300005327 Bacteria 4052
23 Ga0070658_10138442 3300005327 Bacteria 2032
24 Ga0070658_10149859 3300005327 Bacteria 1952
25 Ga0070670_100000022 3300005331 Bacteria 199146
26 Ga0070670_100012197 3300005331 Bacteria 7349
27 Ga0070670_101109573 3300005331 Bacteria 722
28 Ga0070666_10341744 3300005335 Bacteria 1070
29 Ga0070680_100013150 3300005336 Bacteria 6444
30 Ga0070680_100040088 3300005336 Bacteria 3790
31 Ga0070680_100177258 3300005336 Bacteria 1794
32 Ga0070660_100004808 3300005339 Bacteria 9343
33 Ga0070660_100024618 3300005339 Bacteria 4465
34 Ga0070660_100184598 3300005339 Bacteria 1688
35 Ga0070660_100528800 3300005339 Bacteria 983
36 Ga0070689_100173885 3300005340 Bacteria 1746
37 Ga0070691_10035767 3300005341 Bacteria 2339
38 Ga0070661_100887144 3300005344 Bacteria 736
39 Ga0070668_100000960 3300005347 Bacteria 20151
40 Ga0070668_100002198 3300005347 Bacteria 14320
41 Ga0070668_100292843 3300005347 Bacteria 1363
42 Ga0070669_100027883 3300005353 Bacteria 4065
43 Ga0070669_100659540 3300005353 Bacteria 881
44 Ga0070671_100003754 3300005355 Bacteria 11927
45 Ga0070673_100008560 3300005364 Bacteria 6809
46 Ga0070659_100000399 3300005366 Bacteria 32898
47 Ga0070659_100017079 3300005366 Bacteria 5455
48 Ga0070659_100052331 3300005366 Bacteria 3211
49 Ga0070667_100000369 3300005367 Bacteria 49025
50 Ga0070667_100003519 3300005367 Bacteria 13338
51 Ga0070667_100009968 3300005367 Bacteria 7874
52 Ga0070678_100397111 3300005456 Bacteria 1197
53 Ga0070662_100014973 3300005457 Bacteria 5187
54 Ga0070681_10002223 3300005458 Bacteria 17678
55 Ga0070681_10007028 3300005458 Bacteria 10958
56 Ga0070681_10043540 3300005458 Bacteria 4496
57 Ga0070698_100380044 3300005471 Bacteria 1345
58 Ga0070679_100004560 3300005530 Bacteria 12792
59 Ga0068853_100005703 3300005539 Bacteria 9794
60 Ga0068853_100006784 3300005539 Bacteria 9126
61 Ga0068853_100069411 3300005539 Bacteria 3065
62 Ga0068853_100519190 3300005539 Bacteria 1126
63 Ga0068853_100858787 3300005539 Bacteria 871
64 Ga0070665_100000418 3300005548 Bacteria 62048
65 Ga0070665_100002841 3300005548 Bacteria 18748
66 Ga0070665_100005108 3300005548 Bacteria 13608
67 Ga0070665_100026201 3300005548 Bacteria 5872
68 Ga0070665_100158332 3300005548 Bacteria 2267
69 Ga0068855_100013908 3300005563 Bacteria 9705
70 Ga0068855_100015063 3300005563 Bacteria 9311
71 Ga0068855_100020847 3300005563 Bacteria 7860
72 Ga0068855_100067092 3300005563 Bacteria 4181
73 Ga0068855_100090730 3300005563 Bacteria 3526
74 Ga0068855_100222524 3300005563 Bacteria 2116
75 Ga0068855_100740579 3300005563 Bacteria 1049
76 Ga0070664_100165888 3300005564 Bacteria 1957
77 Ga0068857_100377626 3300005577 Bacteria 1316
78 Ga0068854_100106189 3300005578 Bacteria 2112
79 Ga0068854_101053095 3300005578 Bacteria 723
80 Ga0068856_100063027 3300005614 Bacteria 3662
81 Ga0068856_100252492 3300005614 Bacteria 1779
82 Ga0068856_100304772 3300005614 Bacteria 1611
83 Ga0068856_100570421 3300005614 Bacteria 1153
84 Ga0068852_100005865 3300005616 Bacteria 8827
85 Ga0068859_100002621 3300005617 Bacteria 18302
86 Ga0068859_100184191 3300005617 Bacteria 2171
87 Ga0068859_100374304 3300005617 Bacteria 1520
88 Ga0068864_100000839 3300005618 Bacteria 25903
89 Ga0068864_100011984 3300005618 Bacteria 7159
90 Ga0068864_100023880 3300005618 Bacteria 5138
91 Ga0068864_100659204 3300005618 Bacteria 1020
92 Ga0068864_100815692 3300005618 Bacteria 918
93 Ga0068863_100000119 3300005841 Bacteria 82539
94 Ga0068863_100009241 3300005841 Bacteria 9616
95 Ga0068858_100003066 3300005842 Bacteria 16744
96 Ga0068858_100065787 3300005842 Bacteria 3355
97 Ga0068860_100000507 3300005843 Bacteria 48348
98 Ga0068860_100071705 3300005843 Bacteria 3291
99 Ga0068860_100468985 3300005843 Bacteria 1254
100 Ga0068862_100000551 3300005844 Bacteria 39201
101 Ga0068862_100110830 3300005844 Bacteria 2408
102 Ga0068862_100405932 3300005844 Bacteria 1275
103 Ga0068862_100638687 3300005844 Bacteria 1026
104 Ga0081455_10009422 3300005937 Bacteria 10046
105 Ga0081539_10000129 3300005985 Bacteria 178675
106 Ga0075368_10001395 3300006042 Bacteria 7708
107 Ga0075363_100023948 3300006048 Bacteria 3100
108 Ga0075364_10000245 3300006051 Bacteria 26164
109 Ga0075364_10039975 3300006051 Bacteria 3041
110 Ga0075364_10071432 3300006051 Bacteria 2286
111 Ga0075362_10107531 3300006177 Bacteria 1310
112 Ga0075367_10000631 3300006178 Bacteria 13490
113 Ga0075369_10090421 3300006186 Bacteria 1366
114 Ga0075366_10007087 3300006195 Bacteria 6171
115 Ga0075366_10052025 3300006195 Bacteria 2434
116 Ga0075366_10056240 3300006195 Bacteria 2337
117 Ga0075366_10171437 3300006195 Bacteria 1316
118 Ga0097621_100544337 3300006237 Bacteria 1056
119 Ga0075370_10105600 3300006353 Bacteria 1633
120 Ga0075370_10115318 3300006353 Bacteria 1561
121 Ga0075370_10334697 3300006353 Bacteria 903
122 Ga0075431_100582693 3300006847 Bacteria 1104
123 Ga0068865_100014233 3300006881 Bacteria 5050
124 Ga0097620_100002621 3300006931 Bacteria 18302
125 Ga0097620_100184187 3300006931 Bacteria 2171
126 Ga0097620_100374338 3300006931 Bacteria 1520
127 Ga0079104_1040601 3300006946 Bacteria 1089
128 Ga0105240_10035893 3300009093 Bacteria 6384
129 Ga0105240_10067391 3300009093 Bacteria 4437
130 Ga0105240_10266505 3300009093 Bacteria 1974
131 Ga0105245_10183200 3300009098 Bacteria 2002
132 Ga0105243_11709312 3300009148 Bacteria 658
133 Ga0105241_10496106 3300009174 Bacteria 1088
134 Ga0105241_10754949 3300009174 Bacteria 892
135 Ga0105242_10585791 3300009176 Bacteria 1075
136 Ga0105248_10004095 3300009177 Bacteria 16121
137 Ga0105248_10008698 3300009177 Bacteria 11156
138 Ga0105248_10011018 3300009177 Bacteria 9973
139 Ga0105248_10529584 3300009177 Bacteria 1329
140 Ga0105248_10757564 3300009177 Bacteria 1096
141 Ga0105237_10003533 3300009545 Bacteria 18525
142 Ga0105237_10479121 3300009545 Bacteria 1251
143 Ga0105238_10023580 3300009551 Bacteria 6270
144 Ga0105238_10027667 3300009551 Bacteria 5779
145 Ga0105238_10299503 3300009551 Bacteria 1591
146 Ga0105249_10000729 3300009553 Bacteria 29775
147 Ga0105249_10394581 3300009553 Bacteria 1413
148 Ga0105249_10466072 3300009553 Bacteria 1304
149 Ga0105239_10137186 3300010375 Bacteria 2723
150 Ga0105246_10435597 3300011119 Bacteria 1098
151 Ga0157373_10000445 3300013100 Bacteria 32823
152 Ga0157373_10000769 3300013100 Bacteria 24730
153 Ga0157371_10011051 3300013102 Bacteria 6993
154 Ga0157370_10012691 3300013104 Bacteria 8720
155 Ga0157370_10027913 3300013104 Bacteria 5560
156 Ga0157369_10152171 3300013105 Bacteria 2445
157 Ga0157369_10710989 3300013105 Bacteria 1034
158 Ga0157369_10727236 3300013105 Bacteria 1022
159 Ga0157369_10919950 3300013105 Bacteria 897
160 Ga0163162_10094055 3300013306 Bacteria 3083
161 Ga0163162_10195308 3300013306 Bacteria 2152
162 Ga0157372_10670550 3300013307 Bacteria 1207
163 Ga0163163_10002724 3300014325 Bacteria 14914
164 Ga0163163_10111417 3300014325 Bacteria 2765
165 Ga0163163_10437199 3300014325 Bacteria 1368
166 Ga0163163_10455557 3300014325 Bacteria 1339
167 Ga0163163_11656718 3300014325 Bacteria 700
168 Ga0182008_10266229 3300014497 Bacteria 888
169 Ga0157377_10539814 3300014745 Bacteria 822
170 Ga0157379_10002078 3300014968 Bacteria 16637
171 Ga0157379_10122544 3300014968 Bacteria 2339
172 Ga0182006_1062523 3300015261 Bacteria 1400
173 Ga0182005_1003061 3300015265 Bacteria 5768
174 Ga0183365_10001 3300015684 Bacteria 2090444
175 Ga0163161_10599635 3300017792 Bacteria 908
176 Ga0213874_10012812 3300021377 Bacteria 2159
177 Ga0213876_10000571 3300021384 Bacteria 27421
178 Ga0213876_10011133 3300021384 Bacteria 4811
179 Ga0209026_1009261 3300025250 Bacteria 1951
180 Ga0209026_1014848 3300025250 Bacteria 1291
181 Ga0209148_1006423 3300025254 Bacteria 2548
182 Ga0209565_1004647 3300025263 Bacteria 4138
183 Ga0209673_1001534 3300025273 Bacteria 21014
184 Ga0209675_1004417 3300025291 Bacteria 6256
185 Ga0209676_1000283 3300025292 Bacteria 105260
186 Ga0209676_1000319 3300025292 Bacteria 93542
187 Ga0209676_1000401 3300025292 Bacteria 78968
188 Ga0209676_1001427 3300025292 Bacteria 22666
189 Ga0209564_1007906 3300025295 Bacteria 5371
190 Ga0209564_1015664 3300025295 Bacteria 3068
191 Ga0209758_1000936 3300025297 Bacteria 39430
192 Ga0209758_1001446 3300025297 Bacteria 27968
193 Ga0209758_1005528 3300025297 Bacteria 9652
194 Ga0209050_1000245 3300025298 Bacteria 116929
195 Ga0209050_1000584 3300025298 Bacteria 59071
196 Ga0209050_1001426 3300025298 Bacteria 25794
197 Ga0209050_1019676 3300025298 Bacteria 2551
198 Ga0209256_1004881 3300025299 Bacteria 8078
199 Ga0209256_1005664 3300025299 Bacteria 7032
200 Ga0209051_1001183 3300025303 Bacteria 23584
201 Ga0209257_1000184 3300025304 Bacteria 156438
202 Ga0209257_1000352 3300025304 Bacteria 94530
203 Ga0209257_1000995 3300025304 Bacteria 38407
204 Ga0209257_1001133 3300025304 Bacteria 34214
205 Ga0209257_1001595 3300025304 Bacteria 25963
206 Ga0209257_1005790 3300025304 Bacteria 8416
207 Ga0207697_10194531 3300025315 Bacteria 891
208 Ga0207680_10105802 3300025903 Bacteria 1816
209 Ga0207680_10381387 3300025903 Bacteria 994
210 Ga0207705_10010302 3300025909 Bacteria 6799
211 Ga0207705_10057833 3300025909 Bacteria 2797
212 Ga0207705_10067665 3300025909 Bacteria 2585
213 Ga0207705_10576507 3300025909 Bacteria 875
214 Ga0207707_10013631 3300025912 Bacteria 7089
215 Ga0207707_10030418 3300025912 Bacteria 4724
216 Ga0207707_10070584 3300025912 Bacteria 3044
217 Ga0207695_10000837 3300025913 Bacteria 56634
218 Ga0207695_10005140 3300025913 Bacteria 17526
219 Ga0207695_10013898 3300025913 Bacteria 9570
220 Ga0207695_10048219 3300025913 Bacteria 4500
221 Ga0207671_10001343 3300025914 Bacteria 28757
222 Ga0207660_10001046 3300025917 Bacteria 18312
223 Ga0207660_10033108 3300025917 Bacteria 3572
224 Ga0207660_10038049 3300025917 Bacteria 3356
225 Ga0207657_10004700 3300025919 Bacteria 14417
226 Ga0207657_10010320 3300025919 Bacteria 9326
227 Ga0207652_10004972 3300025921 Bacteria 10762
228 Ga0207652_10118615 3300025921 Bacteria 2352
229 Ga0207681_10027089 3300025923 Bacteria 3703
230 Ga0207694_10018908 3300025924 Bacteria 5209
231 Ga0207694_10039683 3300025924 Bacteria 3623
232 Ga0207694_11176790 3300025924 Bacteria 649
233 Ga0207650_10000016 3300025925 Bacteria 361958
234 Ga0207650_10007596 3300025925 Bacteria 7390
235 Ga0207644_10005639 3300025931 Bacteria 8152
236 Ga0207690_10000695 3300025932 Bacteria 21662
237 Ga0207690_10083286 3300025932 Bacteria 2239
238 Ga0207690_10099777 3300025932 Bacteria 2071
239 Ga0207706_10031710 3300025933 Bacteria 4706
240 Ga0207670_10254092 3300025936 Bacteria 1360
241 Ga0207669_10907873 3300025937 Bacteria 736
242 Ga0207704_10029709 3300025938 Bacteria 3053
243 Ga0207711_10001468 3300025941 Bacteria 21987
244 Ga0207711_10007218 3300025941 Bacteria 9314
245 Ga0207711_10373626 3300025941 Bacteria 1322
246 Ga0207711_10720479 3300025941 Bacteria 930
247 Ga0207711_10988358 3300025941 Bacteria 781
248 Ga0207661_10088101 3300025944 Bacteria 2580
249 Ga0207679_10137765 3300025945 Bacteria 1968
250 Ga0207679_10145569 3300025945 Bacteria 1921
251 Ga0207667_10001958 3300025949 Bacteria 25792
252 Ga0207667_10021156 3300025949 Bacteria 7213
253 Ga0207667_10108241 3300025949 Bacteria 2868
254 Ga0207667_10201234 3300025949 Bacteria 2043
255 Ga0207667_10348877 3300025949 Bacteria 1510
256 Ga0207667_10506781 3300025949 Bacteria 1224
257 Ga0207667_10603643 3300025949 Bacteria 1106
258 Ga0207651_10038193 3300025960 Bacteria 3153
259 Ga0207712_10004155 3300025961 Bacteria 9143
260 Ga0207712_10102634 3300025961 Bacteria 2129
261 Ga0207668_10000019 3300025972 Bacteria 152108
262 Ga0207668_10000241 3300025972 Bacteria 36742
263 Ga0207668_10008731 3300025972 Bacteria 6054
264 Ga0207668_10233090 3300025972 Bacteria 1485
265 Ga0207658_10000295 3300025986 Bacteria 52135
266 Ga0207658_10004237 3300025986 Bacteria 9992
267 Ga0207677_10096546 3300026023 Bacteria 2163
268 Ga0207677_10764608 3300026023 Bacteria 862
269 Ga0207703_10003003 3300026035 Bacteria 14304
270 Ga0207703_10003368 3300026035 Bacteria 13432
271 Ga0207639_10017371 3300026041 Bacteria 5099
272 Ga0207639_10079810 3300026041 Bacteria 2587
273 Ga0207678_11090360 3300026067 Bacteria 707
274 Ga0207702_10386514 3300026078 Bacteria 1347
275 Ga0207641_10002594 3300026088 Bacteria 16606
276 Ga0207641_10014411 3300026088 Bacteria 6478
277 Ga0207641_10768328 3300026088 Bacteria 952
278 Ga0207676_10000408 3300026095 Bacteria 36341
279 Ga0207676_10016500 3300026095 Bacteria 5348
280 Ga0207676_10477413 3300026095 Bacteria 1180
281 Ga0207675_100196638 3300026118 Bacteria 1935
282 Ga0207683_10285280 3300026121 Bacteria 1509
283 Ga0209281_1027887 3300027111 Bacteria 1030
284 Ga0209981_1000192 3300027378 Bacteria 7563
285 Ga0209983_1003863 3300027665 Bacteria 3171
286 Ga0209813_10001034 3300027866 Bacteria 6268
287 Ga0268266_10000003 3300028379 Bacteria 1701703
288 Ga0268266_10000481 3300028379 Bacteria 57341
289 Ga0268266_10001814 3300028379 Bacteria 24161
290 Ga0268266_10005619 3300028379 Bacteria 11645
291 Ga0268266_10030422 3300028379 Bacteria 4587
292 Ga0268266_10134524 3300028379 Bacteria 2213
293 Ga0268266_10171512 3300028379 Bacteria 1969
294 Ga0268266_10631626 3300028379 Bacteria 1030
295 Ga0268265_10017989 3300028380 Bacteria 4890
296 Ga0268265_10072266 3300028380 Bacteria 2690
297 Ga0268265_10613165 3300028380 Bacteria 1041
298 Ga0268264_10000207 3300028381 Bacteria 120086
299 Ga0268264_10019198 3300028381 Bacteria 5586
300 Ga0268264_10097566 3300028381 Bacteria 2547
301 Ga0265337_1010913 3300028556 Bacteria 3158
302 Ga0265334_10013950 3300028573 Bacteria 3356
303 Ga0307517_10000835 3300028786 Bacteria 53001
304 Ga0307515_10141502 3300028794 Bacteria 2577
305 Ga0307515_10176794 3300028794 Bacteria 2102
306 Ga0307515_10341904 3300028794 Bacteria 1148
307 Ga0265338_10014807 3300028800 Bacteria 8631
308 Ga0265338_10017120 3300028800 Bacteria 7834
309 Ga0265338_10023871 3300028800 Bacteria 6269
310 Ga0265338_10059145 3300028800 Bacteria 3377
311 Ga0265338_10115360 3300028800 Bacteria 2153
312 Ga0265338_10806293 3300028800 Bacteria 643
313 Ga0307511_10009787 3300030521 Bacteria 9545
314 Ga0265332_10192499 3300031238 Bacteria 849
315 Ga0265325_10003959 3300031241 Bacteria 9478
316 Ga0265339_10019644 3300031249 Bacteria 3963
317 Ga0265327_10000442 3300031251 Bacteria 75162
318 Ga0265327_10004607 3300031251 Bacteria 12121
319 Ga0265327_10006001 3300031251 Bacteria 9880
320 Ga0265316_10354738 3300031344 Bacteria 1061
321 Ga0307513_10000873 3300031456 Bacteria 43622
322 Ga0307513_10013077 3300031456 Bacteria 10204
323 Ga0307513_10023666 3300031456 Bacteria 7170
324 Ga0307513_10044795 3300031456 Bacteria 4842
325 Ga0307513_10539250 3300031456 Bacteria 880
326 Ga0307408_100168680 3300031548 Bacteria 1746
327 Ga0307408_100578557 3300031548 Bacteria 995
328 Ga0265313_10000062 3300031595 Bacteria 106169
329 Ga0265313_10006275 3300031595 Bacteria 8470
330 Ga0265314_10029233 3300031711 Bacteria 4099
331 Ga0265314_10082875 3300031711 Bacteria 2109
332 Ga0307516_10000030 3300031730 Bacteria 159694
333 Ga0307516_10261999 3300031730 Bacteria 1419
334 Ga0307405_10940581 3300031731 Bacteria 734
335 Ga0307413_10364092 3300031824 Bacteria 1120
336 Ga0307413_10955520 3300031824 Bacteria 731
337 Ga0307406_10000448 3300031901 Bacteria 24069
338 Ga0307406_10419836 3300031901 Bacteria 1065
339 Ga0307412_10003082 3300031911 Bacteria 9244
340 Ga0307412_10434990 3300031911 Bacteria 1077
341 Ga0307412_10729119 3300031911 Bacteria 854
342 Ga0307414_10021392 3300032004 Bacteria 4058
343 Ga0307414_10031686 3300032004 Bacteria 3471
344 Ga0307414_10035550 3300032004 Bacteria 3316
345 Ga0307414_10062866 3300032004 Bacteria 2636
346 Ga0307414_10299184 3300032004 Bacteria 1360
347 Ga0307414_10303875 3300032004 Bacteria 1351
348 Ga0307414_10341403 3300032004 Bacteria 1282
349 Ga0307414_10401487 3300032004 Bacteria 1190
350 Ga0307414_10406222 3300032004 Bacteria 1184
351 Ga0307411_10204690 3300032005 Bacteria 1519
352 Ga0307510_10055823 3300033180 Bacteria 4121
353 Ga0373944_0006252 3300035089 Bacteria 3157
354 Ga0373960_0103400 3300035121 Bacteria 926
355 Ga0373943_0019233 3300035170 Bacteria 3140
356 Ga0373931_0091036 3300035691 Bacteria 1699
357 Ga0373931_0126924 3300035691 Bacteria 1464
358 Ga0373935_0018852 3300035692 Bacteria 4206
359 Ga0373927_0001188 3300035695 Bacteria 19756
360 Ga0373933_0289069 3300035724 Bacteria 1060
361 Ga0373937_0540524 3300036401 Bacteria 1107
362 Ga0373937_0749643 3300036401 Bacteria 924
363 Ga0373925_0000089 3300037068 Bacteria 98449
364 Ga0373925_0714430 3300037068 Bacteria 826
365 Ga0395899_0000003 3300037312 Bacteria 1232684
366 Ga0395899_0000790 3300037312 Bacteria 30999
367 Ga0395899_0114223 3300037312 Bacteria 1939
368 Ga0395899_0179821 3300037312 Bacteria 1485
369 Ga0395900_0000844 3300037418 Bacteria 40400
370 Ga0395900_0010379 3300037418 Bacteria 9524
371 Ga0395900_0753155 3300037418 Bacteria 904
372 Ga0395900_1019874 3300037418 Bacteria 747
373 Ga0395898_0006267 3300037466 Bacteria 12723
374 Ga0395898_0048541 3300037466 Bacteria 4162
375 Ga0395898_0436481 3300037466 Bacteria 1247
376 Ga0395898_0856108 3300037466 Bacteria 848
377 Ga0395905_0047804 3300037471 Bacteria 4009
378 Ga0395905_0073027 3300037471 Bacteria 3216
379 Ga0395905_0086332 3300037471 Bacteria 2940
380 Ga0395905_0152211 3300037471 Bacteria 2176
381 Ga0395905_0282901 3300037471 Bacteria 1545
382 Ga0395905_0364318 3300037471 Bacteria 1338
383 Ga0395905_0374535 3300037471 Bacteria 1317
384 Ga0395905_0400318 3300037471 Bacteria 1268
385 Ga0395905_0426155 3300037471 Bacteria 1223
386 Ga0436364_0305192 3300037853 Bacteria 1329
387 Ga0436364_0505125 3300037853 Bacteria 704
388 Ga0395901_0000052 3300038443 Bacteria 165888
389 Ga0395901_0055218 3300038443 Bacteria 4130
390 Ga0395901_0108202 3300038443 Bacteria 2918
391 Ga0395901_0417902 3300038443 Bacteria 1375
392 Ga0395901_0813505 3300038443 Bacteria 922
393 Ga0400483_090428 3300039062 Unclassified 1397
394 Ga0400483_230835 3300039062 Bacteria 1539
395 Ga0436365_1465717 3300039437 Bacteria 857
396 Ga0436365_1586327 3300039437 Bacteria 63407
397 Ga0436360_0954883 3300039438 Bacteria 5684
398 Ga0436361_0030985 3300039447 Bacteria 20368
399 Ga0436361_0583434 3300039447 Bacteria 7014
400 Ga0436361_0914864 3300039447 Bacteria 941
401 Ga0436361_0916358 3300039447 Bacteria 1055
402 Ga0436363_0512795 3300039450 Bacteria 1807
403 Ga0436363_1260763 3300039450 Bacteria 1817
404 Ga0451789_1067160 3300041443 Bacteria 698
405 Ga0439431_0060500 3300041997 Bacteria 996
406 Ga0439435_0022485 3300042436 Bacteria 1646
407 Ga0439459_0010297 3300042438 Bacteria 1629
408 Ga0450901_002469 3300042533 Bacteria 1990
409 Ga0451577_0191866 3300042876 Bacteria 1843
410 Ga0466969_0004404 3300044656 Bacteria 7490
411 Ga0466969_0078330 3300044656 Bacteria 1581
412 Ga0466965_0351851 3300044683 Bacteria 807
413 Ga0466966_0003880 3300044684 Bacteria 9876
414 Ga0466961_0003730 3300044693 Bacteria 9516
415 Ga0466963_0011309 3300044694 Bacteria 5431
416 Ga0466964_0376996 3300044706 Bacteria 735
417 Ga0466971_0002511 3300044719 Bacteria 7759
418 Ga0466968_0059582 3300044735 Bacteria 1645
419 Ga0466970_0003930 3300044765 Bacteria 7283
420 Ga0466957_0003256 3300044842 Bacteria 8888
421 Ga0466959_0000163 3300045049 Bacteria 43940
422 Ga0466959_0090707 3300045049 Bacteria 2195
423 Ga0466958_0001982 3300045836 Bacteria 10062
424 Ga0495627_000233 3300046453 Bacteria 58913
425 Ga0495590_0000309 3300046457 Bacteria 25577
426 Ga0495629_0019750 3300046459 Bacteria 4810
427 Ga0495638_0000782 3300046460 Bacteria 33588
428 Ga0495638_0000972 3300046460 Bacteria 28909
429 Ga0495638_0001365 3300046460 Bacteria 22403
430 Ga0495638_0002372 3300046460 Bacteria 15421
431 Ga0495638_0002789 3300046460 Bacteria 14025
432 Ga0495638_0043914 3300046460 Bacteria 2818
433 Ga0495638_0336506 3300046460 Bacteria 801
434 Ga0495653_0520051 3300046463 Bacteria 740
435 Ga0495650_0005658 3300046471 Bacteria 8027
436 Ga0495650_0059179 3300046471 Bacteria 1544
437 Ga0495650_0234581 3300046471 Bacteria 628
438 Ga0495585_0149832 3300046492 Bacteria 1217
439 Ga0495585_0409871 3300046492 Bacteria 652
440 Ga0495583_0000399 3300046506 Bacteria 66020
441 Ga0495583_0003991 3300046506 Bacteria 10890
442 Ga0495583_0068888 3300046506 Bacteria 1559
443 Ga0495606_0120126 3300046507 Bacteria 1574
444 Ga0495606_0156077 3300046507 Bacteria 1335
445 Ga0495606_0182496 3300046507 Bacteria 1209
446 Ga0495606_0219822 3300046507 Bacteria 1071
447 Ga0495610_0001275 3300046512 Bacteria 22573
448 Ga0495610_0001981 3300046512 Bacteria 17476
449 Ga0495610_0002726 3300046512 Bacteria 14517
450 Ga0495610_0144869 3300046512 Bacteria 1019
451 Ga0495616_0006268 3300046513 Bacteria 7223
452 Ga0495620_0033148 3300046515 Bacteria 2347
453 Ga0495620_0039036 3300046515 Bacteria 2102
454 Ga0495628_0181256 3300046516 Bacteria 1593
455 Ga0495628_0302073 3300046516 Bacteria 1184
456 Ga0495628_0321870 3300046516 Bacteria 1141
457 Ga0495630_0071860 3300046517 Bacteria 2605
458 Ga0495631_0036900 3300046518 Bacteria 2180
459 Ga0495632_0000665 3300046519 Bacteria 31450
460 Ga0495632_0228225 3300046519 Bacteria 840
461 Ga0495632_0325011 3300046519 Bacteria 679
462 Ga0495637_0011651 3300046520 Bacteria 4220
463 Ga0495637_0046265 3300046520 Bacteria 1841
464 Ga0495637_0073941 3300046520 Bacteria 1370
465 Ga0495643_0054338 3300046522 Bacteria 2144
466 Ga0495643_0305903 3300046522 Bacteria 723
467 Ga0495648_0000039 3300046524 Bacteria 185430
468 Ga0495648_0094775 3300046524 Bacteria 1662
469 Ga0495648_0175733 3300046524 Bacteria 1093
470 Ga0495642_0085553 3300046528 Bacteria 1331
471 Ga0495652_0413896 3300046529 Bacteria 951
472 Ga0495654_0000016 3300046530 Bacteria 306416
473 Ga0495654_0106876 3300046530 Bacteria 1281
474 Ga0495665_0186088 3300046531 Bacteria 1078
475 Ga0495597_0004569 3300046542 Bacteria 7566
476 Ga0495597_0030588 3300046542 Bacteria 2454
477 Ga0495597_0106226 3300046542 Bacteria 1180
478 Ga0495597_0135459 3300046542 Bacteria 1019
479 Ga0495645_0143970 3300046543 Bacteria 1661
480 Ga0495645_0214804 3300046543 Bacteria 1297
481 Ga0495645_0347208 3300046543 Bacteria 957
482 Ga0495645_0508019 3300046543 Bacteria 752
483 Ga0495622_0002431 3300046557 Bacteria 9037
484 Ga0495633_0000423 3300046558 Bacteria 43996
485 Ga0495667_0374545 3300046559 Bacteria 898
486 Ga0495668_0000221 3300046616 Bacteria 82680
487 Ga0495668_0004400 3300046616 Bacteria 10026
488 Ga0495668_0008124 3300046616 Bacteria 6603
489 Ga0495668_0035031 3300046616 Bacteria 2814
490 Ga0495668_0103514 3300046616 Bacteria 1557
491 Ga0495668_0141456 3300046616 Bacteria 1317
492 Ga0495611_0010563 3300046648 Bacteria 3906
493 Ga0495625_0000034 3300046660 Bacteria 225120
494 Ga0495625_0003961 3300046660 Bacteria 14221
495 Ga0495625_0013206 3300046660 Bacteria 6650
496 Ga0495625_0053383 3300046660 Bacteria 2890
497 Ga0495625_0214016 3300046660 Bacteria 1265
498 Ga0495625_0570701 3300046660 Bacteria 683
499 Ga0495657_0060854 3300046675 Bacteria 2500
500 Ga0495669_0000014 3300046684 Bacteria 140832
501 Ga0495669_0000081 3300046684 Bacteria 63806
502 Ga0495669_0042118 3300046684 Bacteria 2029
503 Ga0495613_0008104 3300046689 Bacteria 7812
504 Ga0495613_0198589 3300046689 Bacteria 1415
505 Ga0495670_0116522 3300046691 Bacteria 1386
506 Ga0495671_0137501 3300046692 Bacteria 1191
507 Ga0495671_0164492 3300046692 Bacteria 1079
508 Ga0495649_0000803 3300046694 Bacteria 25314
509 Ga0495589_0008679 3300046794 Bacteria 5293
510 Ga0495660_0015514 3300046810 Bacteria 4400
511 Ga0495660_0069672 3300046810 Bacteria 1869
512 Ga0495636_0203891 3300047318 Bacteria 904
513 Ga0495672_0000196 3300047320 Bacteria 86506
514 Ga0495672_0000986 3300047320 Bacteria 29423
515 Ga0495672_0013127 3300047320 Bacteria 5731
516 Ga0495672_0074578 3300047320 Bacteria 1910
517 Ga0495683_0083101 3300047323 Bacteria 1559
518 Ga0495677_0045818 3300047445 Bacteria 1605
519 Ga0495679_007810 3300047446 Bacteria 4414
520 Ga0495673_0000277 3300047469 Bacteria 69419
521 Ga0495673_0001410 3300047469 Bacteria 19281
522 Ga0495673_0001949 3300047469 Bacteria 15315
523 Ga0495686_0000074 3300047472 Bacteria 208094
524 Ga0495686_0001197 3300047472 Bacteria 29986
525 Ga0495686_0002903 3300047472 Bacteria 15390
526 Ga0495686_0019755 3300047472 Bacteria 4498
527 Ga0495686_0125718 3300047472 Bacteria 1524
528 Ga0495686_0144981 3300047472 Bacteria 1398
529 Ga0495593_0010025 3300047673 Bacteria 5491
530 Ga0496100_0066328 3300048903 Bacteria 2394
531 Ga0496100_0966649 3300048903 Bacteria 670
532 Ga0496102_0135975 3300048905 Bacteria 2303
533 Ga0496103_0363731 3300048906 Bacteria 930
534 Ga0496105_0056885 3300048908 Bacteria 3229
535 Ga0496106_0071453 3300048909 Bacteria 2653
536 Ga0496106_0521464 3300048909 Bacteria 954
537 Ga0496106_0848375 3300048909 Bacteria 723
538 Ga0496107_0132578 3300048910 Bacteria 1840
539 Ga0496112_0033967 3300048915 Bacteria 4962
540 Ga0496112_0108728 3300048915 Bacteria 2743
541 Ga0496112_0393395 3300048915 Bacteria 1326
542 Ga0496112_0454480 3300048915 Bacteria 1218
543 Ga0496113_0305489 3300048916 Bacteria 1274
544 Ga0496113_0574058 3300048916 Bacteria 904
545 Ga0496114_0929386 3300048917 Bacteria 752
546 Ga0496115_0009445 3300048918 Bacteria 7246
547 Ga0496115_0012341 3300048918 Bacteria 6425
548 Ga0496115_0020970 3300048918 Bacteria 5042
549 Ga0496115_0034833 3300048918 Bacteria 3979
550 Ga0496115_0401667 3300048918 Bacteria 1112
551 Ga0496116_0012484 3300048919 Bacteria 6938
552 Ga0496116_0104743 3300048919 Bacteria 1680
553 Ga0496117_0040108 3300048920 Bacteria 3449
554 Ga0496117_0091795 3300048920 Bacteria 1952
555 Ga0496118_0012352 3300048921 Bacteria 8211
556 Ga0496118_0014192 3300048921 Bacteria 7471
557 Ga0496119_0148870 3300048922 Bacteria 1256
558 Ga0496119_0364311 3300048922 Bacteria 697
559 Ga0496120_0071132 3300048923 Bacteria 1911
560 Ga0496121_0000035 3300048924 Bacteria 374316
561 Ga0496121_0013712 3300048924 Bacteria 8686
562 Ga0496121_0064604 3300048924 Bacteria 2983
563 Ga0496121_0158478 3300048924 Bacteria 1658
564 Ga0496122_0002994 3300048925 Bacteria 22994
565 Ga0496123_0004303 3300048926 Bacteria 15121
566 Ga0496124_0063597 3300048927 Bacteria 3082
567 Ga0496124_0274749 3300048927 Bacteria 1232
568 Ga0496124_0316445 3300048927 Bacteria 1120
569 Ga0496125_0001013 3300048928 Bacteria 43693
570 Ga0496125_0016889 3300048928 Bacteria 6987
571 Ga0496125_0329196 3300048928 Bacteria 922
572 Ga0496126_0149172 3300048929 Bacteria 2005
573 Ga0496126_0358509 3300048929 Bacteria 1191
574 Ga0495678_000773 3300049459 Bacteria 28865
575 Ga0501033_0002538 3300049570 Bacteria 15455
576 Ga0501033_0134799 3300049570 Bacteria 1787
577 Ga0501033_0149123 3300049570 Bacteria 1688
578 Ga0501034_0034395 3300049571 Bacteria 5137
579 Ga0501034_0405909 3300049571 Bacteria 1285
580 Ga0501034_0804813 3300049571 Bacteria 832
581 Ga0501034_1309958 3300049571 Bacteria 601
582 Ga0501036_0069717 3300049572 Bacteria 2974
583 Ga0501036_0288634 3300049572 Bacteria 1373
584 Ga0501037_0008727 3300049573 Bacteria 7431
585 Ga0501037_0014126 3300049573 Bacteria 5883
586 Ga0501037_0061325 3300049573 Bacteria 2742
587 Ga0501037_0780570 3300049573 Bacteria 632
588 Ga0501038_0249883 3300049574 Bacteria 1405
589 Ga0501038_0281287 3300049574 Bacteria 1310
590 Ga0501043_0047212 3300049579 Bacteria 3385
591 Ga0501043_0081076 3300049579 Bacteria 2549
592 Ga0501043_0102371 3300049579 Bacteria 2251
593 Ga0501046_0241749 3300049580 Bacteria 1331
594 Ga0501046_0726547 3300049580 Bacteria 698
595 Ga0501047_0043548 3300049581 Bacteria 4336
596 Ga0501047_0054044 3300049581 Bacteria 3885
597 Ga0501047_0096003 3300049581 Bacteria 2843
598 Ga0501047_0224249 3300049581 Bacteria 1735
599 Ga0501047_0294087 3300049581 Bacteria 1467
600 Ga0501047_0326879 3300049581 Bacteria 1372
601 Ga0501047_0760063 3300049581 Bacteria 785
602 Ga0501048_0238662 3300049582 Bacteria 1290
603 Ga0501067_0000210 3300049583 Bacteria 32414
604 Ga0501067_0038780 3300049583 Bacteria 2645
605 Ga0501068_0000231 3300049584 Bacteria 27187
606 Ga0501070_0540562 3300049586 Bacteria 933
607 Ga0501072_0015337 3300049588 Bacteria 5878
608 Ga0501073_0000002 3300049589 Bacteria 323865
609 Ga0501073_0011697 3300049589 Bacteria 6407
610 Ga0501073_0045456 3300049589 Bacteria 3092
611 Ga0501074_0186235 3300049590 Bacteria 1480
612 Ga0501077_0000003 3300049593 Bacteria 143061
613 Ga0501077_0060131 3300049593 Bacteria 2412
614 Ga0501238_001246 3300049671 Bacteria 2922
615 Ga0501080_0009896 3300049742 Bacteria 8710
616 Ga0501080_0010816 3300049742 Bacteria 8348
617 Ga0501080_0022086 3300049742 Bacteria 5895
618 Ga0501080_0181923 3300049742 Bacteria 1934
619 Ga0501080_0196936 3300049742 Bacteria 1850
620 Ga0501083_0002845 3300049744 Bacteria 11967
621 Ga0501083_0007673 3300049744 Bacteria 7650
622 Ga0501083_0049533 3300049744 Bacteria 2831
623 Ga0501083_0129652 3300049744 Bacteria 1653
624 Ga0501035_0280449 3300049822 Bacteria 1408
625 Ga0501044_0002455 3300049823 Bacteria 21138
626 Ga0501044_0004301 3300049823 Bacteria 15971
627 Ga0501044_0005226 3300049823 Bacteria 14444
628 Ga0501044_0070117 3300049823 Bacteria 3567
629 Ga0501044_0207648 3300049823 Bacteria 1914
630 nmdc:mga03683_467496_c1 3300050489 Bacteria 608
631 nmdc:mga03n38_44855_c1 3300050490 Bacteria 1944
632 nmdc:mga00v17_344_c1 3300050491 Bacteria 26181
633 nmdc:mga00v17_3983_c1 3300050491 Bacteria 7623
634 nmdc:mga0k408_259835_c1 3300050493 Bacteria 1037
635 nmdc:mga0k408_82415_c1 3300050493 Bacteria 1885
636 nmdc:mga04h51_3658_c1 3300050495 Bacteria 3760
637 nmdc:mga07m45_1519_c1 3300050496 Bacteria 10643
638 nmdc:mga07m45_164686_c1 3300050496 Bacteria 1288
639 nmdc:mga07m45_271914_c1 3300050496 Bacteria 986
640 Ga0500635_0000252 3300053080 Bacteria 22210
641 Ga0500635_0000381 3300053080 Bacteria 13714
642 Ga0500635_0036245 3300053080 Bacteria 1625
643 Ga0495619_0104544 3300053085 Bacteria 1930
644 Ga0500578_0001117 3300053086 Bacteria 28820
645 Ga0500578_0205274 3300053086 Bacteria 1204
646 Ga0500643_004997 3300053087 Bacteria 5819
647 Ga0500643_007800 3300053087 Bacteria 4269
648 Ga0500643_009670 3300053087 Bacteria 3661
649 Ga0500644_0000903 3300053088 Bacteria 9484
650 Ga0500646_0007024 3300053090 Bacteria 2871
651 Ga0500647_0001015 3300053091 Bacteria 8948
652 Ga0500647_0021841 3300053091 Bacteria 2989
653 Ga0500583_0388516 3300053092 Bacteria 671
654 Ga0500651_0001298 3300053093 Bacteria 12461
655 Ga0500651_0030734 3300053093 Bacteria 3381
656 Ga0500566_0030594 3300053094 Bacteria 3139
657 Ga0500641_0000471 3300053096 Bacteria 14669
658 Ga0500641_0021092 3300053096 Bacteria 2478
659 Ga0500650_0390451 3300053098 Bacteria 603
660 Ga0500555_004945 3300053103 Bacteria 3781
661 Ga0500556_0001676 3300053104 Bacteria 8570
662 Ga0500562_001028 3300053108 Bacteria 6833
663 Ga0500562_001576 3300053108 Bacteria 5663
664 Ga0500562_005914 3300053108 Bacteria 3080
665 Ga0500569_000507 3300053109 Bacteria 6488
666 Ga0500572_000158 3300053111 Bacteria 23700
667 Ga0500595_023625 3300053119 Bacteria 2157
668 Ga0500595_027809 3300053119 Bacteria 1933
669 Ga0500597_104715 3300053120 Bacteria 1230
670 Ga0500608_000127 3300053122 Bacteria 31011
671 Ga0500608_002789 3300053122 Bacteria 6443
672 Ga0500608_178394 3300053122 Bacteria 902
673 Ga0500614_020946 3300053123 Bacteria 1513
674 Ga0500618_000152 3300053125 Bacteria 57055
675 Ga0500658_0003919 3300053134 Bacteria 5594
676 Ga0500559_0000048 3300053136 Bacteria 93755
677 Ga0500559_0000054 3300053136 Bacteria 90695
678 Ga0500559_0005611 3300053136 Bacteria 5751
679 Ga0500559_0034704 3300053136 Bacteria 2176
680 Ga0500559_0095559 3300053136 Bacteria 1364
681 Ga0500564_005035 3300053138 Bacteria 5363
682 Ga0500568_0111226 3300053139 Bacteria 1024
683 Ga0500573_0194425 3300053140 Bacteria 1081
684 Ga0500573_0240470 3300053140 Bacteria 939
685 Ga0500577_0002187 3300053142 Bacteria 4994
686 Ga0500590_008271 3300053148 Bacteria 5185
687 Ga0500604_0128126 3300053151 Bacteria 852
688 Ga0500616_0044371 3300053153 Bacteria 2372
689 Ga0500619_025885 3300053154 Bacteria 1742
690 Ga0500622_0005017 3300053156 Bacteria 8065
691 Ga0500622_0009953 3300053156 Bacteria 5245
692 Ga0500622_0014793 3300053156 Bacteria 4183
693 Ga0500627_0006052 3300053158 Bacteria 4080
694 Ga0500633_0080684 3300053160 Bacteria 1177
695 Ga0500638_094956 3300053162 Bacteria 1399
696 Ga0500636_0015413 3300053177 Bacteria 4504
697 Ga0500637_0002566 3300053178 Bacteria 8114
698 Ga0500611_007453 3300053727 Bacteria 1645
699 Ga0500625_007542 3300053729 Bacteria 4737
700 Ga0500645_001218 3300053730 Bacteria 13594
701 Ga0500645_002274 3300053730 Bacteria 8720
702 Ga0500645_039525 3300053730 Bacteria 1397
703 Ga0500645_074201 3300053730 Bacteria 974
704 Ga0500609_001688 3300053731 Bacteria 3215
705 Ga0500596_007463 3300053735 Bacteria 1791
706 Ga0501084_0105102 3300054114 Bacteria 2371
707 Ga0501082_0010360 3300060353 Bacteria 8028
708 Ga0501082_0564256 3300060353 Bacteria 996
709 Ga0501082_0878883 3300060353 Bacteria 784
710 Ga0466962_0002337 3300061719 Bacteria 8988
711 Ga0466962_0060442 3300061719 Bacteria 1809
712 2511123838 2510917020 Bacteria 5657507
713 2585148289 2582581279 Bacteria 4980720
714 2585150977 2582581280 Bacteria 5994497
715 2585196362 2582581293 Bacteria 5907401
716 2587919161 2585428106 Bacteria 5179711
717 2603861884 2602042107 Bacteria 6226103
718 2643750332 2643221545 Bacteria 5083237
719 2643780397 2643221552 Bacteria 5708754
720 2643882366 2643221574 Bacteria 2789653
721 2643926880 2643221583 Bacteria 5218014
722 2643929724 2643221584 Bacteria 5511711
723 2643998733 2643221598 Bacteria 4578346
724 2644087316 2643221614 Bacteria 4260023
725 2644237048 2643221642 Bacteria 5357871
726 2644344640 2643221661 Bacteria 4267604
727 2644353546 2643221663 Bacteria 3425771
728 2644366676 2643221666 Bacteria 4265935
729 2644507221 2643221691 Bacteria 5093099
730 2644548642 2643221699 Bacteria 5731501
731 2739792681 2739367756 Bacteria 4553612
732 2792461287 2791355048 Bacteria 5832535
733 2819538370 2818991435 Bacteria 5433759
734 2819648185 2818991454 Bacteria 5563326
735 2843745357 2843744320 Bacteria 5659202
736 2849564637 2849560528 Bacteria 5393480
737 2849577743 2849573788 Bacteria 5421256
738 2851155630 2851153111 Bacteria 5542585
739 2857508435 2857504554 Bacteria 5369913
740 2857526051 2857524615 Bacteria 6615449
741 2884961237 2884960567 Bacteria 5437054
742 2893067674 2893066018 Bacteria 6158120
743 2898331111 2898329390 Bacteria 5168154
744 2919074097 2919073203 Bacteria 6531949
745 2928534569 2928531327 Bacteria 5101314
746 2928973369 2928972540 Bacteria 3058286
747 2941489406 2941485952 Bacteria 3591484
748 2977240656 2977240413 Bacteria 3191065
749 Ga0501032_0499693
750 JGI25153J46596_10054105
751 JGI25153J46596_10059833
752 Ga0006562J51391_1100661
753 Ga0006562J51391_1100662
754 Ga0055526_1036975
755 Ga0055537_1004057
756 Ga0055524_1004330
757 Ga0055536_1000922
758 Ga0055536_1001003
759 Ga0055536_1001808
760 Ga0055528_1011938
761 Ga0055530_10004136
762 Ga0055530_10013311
763 Ga0055531_10000820
764 Ga0055531_10003394
765 Ga0055531_10004973
766 Ga0055531_10052231
767 Ga0065165_1000561
768 Ga0065165_1000896
769 Ga0065165_1059625
770 Ga0070658_10034828
771 Ga0070658_10138442
772 Ga0070658_10149859
773 Ga0070670_100000022
774 Ga0070670_100012197
775 Ga0070670_101109573
776 Ga0070666_10341744
777 Ga0070680_100013150
778 Ga0070680_100040088
779 Ga0070680_100177258
780 Ga0070660_100004808
781 Ga0070660_100024618
782 Ga0070660_100184598
783 Ga0070660_100528800
784 Ga0070689_100173885
785 Ga0070691_10035767
786 Ga0070661_100887144
787 Ga0070668_100000960
788 Ga0070668_100002198
789 Ga0070668_100292843
790 Ga0070669_100027883
791 Ga0070669_100659540
792 Ga0070671_100003754
793 Ga0070673_100008560
794 Ga0070659_100000399
795 Ga0070659_100017079
796 Ga0070659_100052331
797 Ga0070667_100000369
798 Ga0070667_100003519
799 Ga0070667_100009968
800 Ga0070678_100397111
801 Ga0070662_100014973
802 Ga0070681_10002223
803 Ga0070681_10007028
804 Ga0070681_10043540
805 Ga0070698_100380044
806 Ga0070679_100004560
807 Ga0068853_100005703
808 Ga0068853_100006784
809 Ga0068853_100069411
810 Ga0068853_100519190
811 Ga0068853_100858787
812 Ga0070665_100000418
813 Ga0070665_100002841
814 Ga0070665_100005108
815 Ga0070665_100026201
816 Ga0070665_100158332
817 Ga0068855_100013908
818 Ga0068855_100015063
819 Ga0068855_100020847
820 Ga0068855_100067092
821 Ga0068855_100090730
822 Ga0068855_100222524
823 Ga0068855_100740579
824 Ga0070664_100165888
825 Ga0068857_100377626
826 Ga0068854_100106189
827 Ga0068854_101053095
828 Ga0068856_100063027
829 Ga0068856_100252492
830 Ga0068856_100304772
831 Ga0068856_100570421
832 Ga0068852_100005865
833 Ga0068859_100002621
834 Ga0068859_100184191
835 Ga0068859_100374304
836 Ga0068864_100000839
837 Ga0068864_100011984
838 Ga0068864_100023880
839 Ga0068864_100659204
840 Ga0068864_100815692
841 Ga0068863_100000119
842 Ga0068863_100009241
843 Ga0068858_100003066
844 Ga0068858_100065787
845 Ga0068860_100000507
846 Ga0068860_100071705
847 Ga0068860_100468985
848 Ga0068862_100000551
849 Ga0068862_100110830
850 Ga0068862_100405932
851 Ga0068862_100638687
852 Ga0081455_10009422
853 Ga0081539_10000129
854 Ga0075368_10001395
855 Ga0075363_100023948
856 Ga0075364_10000245
857 Ga0075364_10039975
858 Ga0075364_10071432
859 Ga0075362_10107531
860 Ga0075367_10000631
861 Ga0075369_10090421
862 Ga0075366_10007087
863 Ga0075366_10052025
864 Ga0075366_10056240
865 Ga0075366_10171437
866 Ga0097621_100544337
867 Ga0075370_10105600
868 Ga0075370_10115318
869 Ga0075370_10334697
870 Ga0075431_100582693
871 Ga0068865_100014233
872 Ga0097620_100002621
873 Ga0097620_100184187
874 Ga0097620_100374338
875 Ga0079104_1040601
876 Ga0105240_10035893
877 Ga0105240_10067391
878 Ga0105240_10266505
879 Ga0105245_10183200
880 Ga0105243_11709312
881 Ga0105241_10496106
882 Ga0105241_10754949
883 Ga0105242_10585791
884 Ga0105248_10004095
885 Ga0105248_10008698
886 Ga0105248_10011018
887 Ga0105248_10529584
888 Ga0105248_10757564
889 Ga0105237_10003533
890 Ga0105237_10479121
891 Ga0105238_10023580
892 Ga0105238_10027667
893 Ga0105238_10299503
894 Ga0105249_10000729
895 Ga0105249_10394581
896 Ga0105249_10466072
897 Ga0105239_10137186
898 Ga0105246_10435597
899 Ga0157373_10000445
900 Ga0157373_10000769
901 Ga0157371_10011051
902 Ga0157370_10012691
903 Ga0157370_10027913
904 Ga0157369_10152171
905 Ga0157369_10710989
906 Ga0157369_10727236
907 Ga0157369_10919950
908 Ga0163162_10094055
909 Ga0163162_10195308
910 Ga0157372_10670550
911 Ga0163163_10002724
912 Ga0163163_10111417
913 Ga0163163_10437199
914 Ga0163163_10455557
915 Ga0163163_11656718
916 Ga0182008_10266229
917 Ga0157377_10539814
918 Ga0157379_10002078
919 Ga0157379_10122544
920 Ga0182006_1062523
921 Ga0182005_1003061
922 Ga0183365_10001
923 Ga0163161_10599635
924 Ga0213874_10012812
925 Ga0213876_10000571
926 Ga0213876_10011133
927 Ga0209026_1009261
928 Ga0209026_1014848
929 Ga0209148_1006423
930 Ga0209565_1004647
931 Ga0209673_1001534
932 Ga0209675_1004417
933 Ga0209676_1000283
934 Ga0209676_1000319
935 Ga0209676_1000401
936 Ga0209676_1001427
937 Ga0209564_1007906
938 Ga0209564_1015664
939 Ga0209758_1000936
940 Ga0209758_1001446
941 Ga0209758_1005528
942 Ga0209050_1000245
943 Ga0209050_1000584
944 Ga0209050_1001426
945 Ga0209050_1019676
946 Ga0209256_1004881
947 Ga0209256_1005664
948 Ga0209051_1001183
949 Ga0209257_1000184
950 Ga0209257_1000352
951 Ga0209257_1000995
952 Ga0209257_1001133
953 Ga0209257_1001595
954 Ga0209257_1005790
955 Ga0207697_10194531
956 Ga0207680_10105802
957 Ga0207680_10381387
958 Ga0207705_10010302
959 Ga0207705_10057833
960 Ga0207705_10067665
961 Ga0207705_10576507
962 Ga0207707_10013631
963 Ga0207707_10030418
964 Ga0207707_10070584
965 Ga0207695_10000837
966 Ga0207695_10005140
967 Ga0207695_10013898
968 Ga0207695_10048219
969 Ga0207671_10001343
970 Ga0207660_10001046
971 Ga0207660_10033108
972 Ga0207660_10038049
973 Ga0207657_10004700
974 Ga0207657_10010320
975 Ga0207652_10004972
976 Ga0207652_10118615
977 Ga0207681_10027089
978 Ga0207694_10018908
979 Ga0207694_10039683
980 Ga0207694_11176790
981 Ga0207650_10000016
982 Ga0207650_10007596
983 Ga0207644_10005639
984 Ga0207690_10000695
985 Ga0207690_10083286
986 Ga0207690_10099777
987 Ga0207706_10031710
988 Ga0207670_10254092
989 Ga0207669_10907873
990 Ga0207704_10029709
991 Ga0207711_10001468
992 Ga0207711_10007218
993 Ga0207711_10373626
994 Ga0207711_10720479
995 Ga0207711_10988358
996 Ga0207661_10088101
997 Ga0207679_10137765
998 Ga0207679_10145569
999 Ga0207667_10001958
1000 Ga0207667_10021156
1001 Ga0207667_10108241
1002 Ga0207667_10201234
1003 Ga0207667_10348877
1004 Ga0207667_10506781
1005 Ga0207667_10603643
1006 Ga0207651_10038193
1007 Ga0207712_10004155
1008 Ga0207712_10102634
1009 Ga0207668_10000019
1010 Ga0207668_10000241
1011 Ga0207668_10008731
1012 Ga0207668_10233090
1013 Ga0207658_10000295
1014 Ga0207658_10004237
1015 Ga0207677_10096546
1016 Ga0207677_10764608
1017 Ga0207703_10003003
1018 Ga0207703_10003368
1019 Ga0207639_10017371
1020 Ga0207639_10079810
1021 Ga0207678_11090360
1022 Ga0207702_10386514
1023 Ga0207641_10002594
1024 Ga0207641_10014411
1025 Ga0207641_10768328
1026 Ga0207676_10000408
1027 Ga0207676_10016500
1028 Ga0207676_10477413
1029 Ga0207675_100196638
1030 Ga0207683_10285280
1031 Ga0209281_1027887
1032 Ga0209981_1000192
1033 Ga0209983_1003863
1034 Ga0209813_10001034
1035 Ga0268266_10000003
1036 Ga0268266_10000481
1037 Ga0268266_10001814
1038 Ga0268266_10005619
1039 Ga0268266_10030422
1040 Ga0268266_10134524
1041 Ga0268266_10171512
1042 Ga0268266_10631626
1043 Ga0268265_10017989
1044 Ga0268265_10072266
1045 Ga0268265_10613165
1046 Ga0268264_10000207
1047 Ga0268264_10019198
1048 Ga0268264_10097566
1049 Ga0265337_1010913
1050 Ga0265334_10013950
1051 Ga0307517_10000835
1052 Ga0307515_10141502
1053 Ga0307515_10176794
1054 Ga0307515_10341904
1055 Ga0265338_10014807
1056 Ga0265338_10017120
1057 Ga0265338_10023871
1058 Ga0265338_10059145
1059 Ga0265338_10115360
1060 Ga0265338_10806293
1061 Ga0307511_10009787
1062 Ga0265332_10192499
1063 Ga0265325_10003959
1064 Ga0265339_10019644
1065 Ga0265327_10000442
1066 Ga0265327_10004607
1067 Ga0265327_10006001
1068 Ga0265316_10354738
1069 Ga0307513_10000873
1070 Ga0307513_10013077
1071 Ga0307513_10023666
1072 Ga0307513_10044795
1073 Ga0307513_10539250
1074 Ga0307408_100168680
1075 Ga0307408_100578557
1076 Ga0265313_10000062
1077 Ga0265313_10006275
1078 Ga0265314_10029233
1079 Ga0265314_10082875
1080 Ga0307516_10000030
1081 Ga0307516_10261999
1082 Ga0307405_10940581
1083 Ga0307413_10364092
1084 Ga0307413_10955520
1085 Ga0307406_10000448
1086 Ga0307406_10419836
1087 Ga0307412_10003082
1088 Ga0307412_10434990
1089 Ga0307412_10729119
1090 Ga0307414_10021392
1091 Ga0307414_10031686
1092 Ga0307414_10035550
1093 Ga0307414_10062866
1094 Ga0307414_10299184
1095 Ga0307414_10303875
1096 Ga0307414_10341403
1097 Ga0307414_10401487
1098 Ga0307414_10406222
1099 Ga0307411_10204690
1100 Ga0307510_10055823
1101 Ga0373944_0006252
1102 Ga0373960_0103400
1103 Ga0373943_0019233
1104 Ga0373931_0091036
1105 Ga0373931_0126924
1106 Ga0373935_0018852
1107 Ga0373927_0001188
1108 Ga0373933_0289069
1109 Ga0373937_0540524
1110 Ga0373937_0749643
1111 Ga0373925_0000089
1112 Ga0373925_0714430
1113 Ga0395899_0000003
1114 Ga0395899_0000790
1115 Ga0395899_0114223
1116 Ga0395899_0179821
1117 Ga0395900_0000844
1118 Ga0395900_0010379
1119 Ga0395900_0753155
1120 Ga0395900_1019874
1121 Ga0395898_0006267
1122 Ga0395898_0048541
1123 Ga0395898_0436481
1124 Ga0395898_0856108
1125 Ga0395905_0047804
1126 Ga0395905_0073027
1127 Ga0395905_0086332
1128 Ga0395905_0152211
1129 Ga0395905_0282901
1130 Ga0395905_0364318
1131 Ga0395905_0374535
1132 Ga0395905_0400318
1133 Ga0395905_0426155
1134 Ga0436364_0305192
1135 Ga0436364_0505125
1136 Ga0395901_0000052
1137 Ga0395901_0055218
1138 Ga0395901_0108202
1139 Ga0395901_0417902
1140 Ga0395901_0813505
1141 Ga0400483_090428
1142 Ga0400483_230835
1143 Ga0436365_1465717
1144 Ga0436365_1586327
1145 Ga0436360_0954883
1146 Ga0436361_0030985
1147 Ga0436361_0583434
1148 Ga0436361_0914864
1149 Ga0436361_0916358
1150 Ga0436363_0512795
1151 Ga0436363_1260763
1152 Ga0451789_1067160
1153 Ga0439431_0060500
1154 Ga0439435_0022485
1155 Ga0439459_0010297
1156 Ga0450901_002469
1157 Ga0451577_0191866
1158 Ga0466969_0004404
1159 Ga0466969_0078330
1160 Ga0466965_0351851
1161 Ga0466966_0003880
1162 Ga0466961_0003730
1163 Ga0466963_0011309
1164 Ga0466964_0376996
1165 Ga0466971_0002511
1166 Ga0466968_0059582
1167 Ga0466970_0003930
1168 Ga0466957_0003256
1169 Ga0466959_0000163
1170 Ga0466959_0090707
1171 Ga0466958_0001982
1172 Ga0495627_000233
1173 Ga0495590_0000309
1174 Ga0495629_0019750
1175 Ga0495638_0000782
1176 Ga0495638_0000972
1177 Ga0495638_0001365
1178 Ga0495638_0002372
1179 Ga0495638_0002789
1180 Ga0495638_0043914
1181 Ga0495638_0336506
1182 Ga0495653_0520051
1183 Ga0495650_0005658
1184 Ga0495650_0059179
1185 Ga0495650_0234581
1186 Ga0495585_0149832
1187 Ga0495585_0409871
1188 Ga0495583_0000399
1189 Ga0495583_0003991
1190 Ga0495583_0068888
1191 Ga0495606_0120126
1192 Ga0495606_0156077
1193 Ga0495606_0182496
1194 Ga0495606_0219822
1195 Ga0495610_0001275
1196 Ga0495610_0001981
1197 Ga0495610_0002726
1198 Ga0495610_0144869
1199 Ga0495616_0006268
1200 Ga0495620_0033148
1201 Ga0495620_0039036
1202 Ga0495628_0181256
1203 Ga0495628_0302073
1204 Ga0495628_0321870
1205 Ga0495630_0071860
1206 Ga0495631_0036900
1207 Ga0495632_0000665
1208 Ga0495632_0228225
1209 Ga0495632_0325011
1210 Ga0495637_0011651
1211 Ga0495637_0046265
1212 Ga0495637_0073941
1213 Ga0495643_0054338
1214 Ga0495643_0305903
1215 Ga0495648_0000039
1216 Ga0495648_0094775
1217 Ga0495648_0175733
1218 Ga0495642_0085553
1219 Ga0495652_0413896
1220 Ga0495654_0000016
1221 Ga0495654_0106876
1222 Ga0495665_0186088
1223 Ga0495597_0004569
1224 Ga0495597_0030588
1225 Ga0495597_0106226
1226 Ga0495597_0135459
1227 Ga0495645_0143970
1228 Ga0495645_0214804
1229 Ga0495645_0347208
1230 Ga0495645_0508019
1231 Ga0495622_0002431
1232 Ga0495633_0000423
1233 Ga0495667_0374545
1234 Ga0495668_0000221
1235 Ga0495668_0004400
1236 Ga0495668_0008124
1237 Ga0495668_0035031
1238 Ga0495668_0103514
1239 Ga0495668_0141456
1240 Ga0495611_0010563
1241 Ga0495625_0000034
1242 Ga0495625_0003961
1243 Ga0495625_0013206
1244 Ga0495625_0053383
1245 Ga0495625_0214016
1246 Ga0495625_0570701
1247 Ga0495657_0060854
1248 Ga0495669_0000014
1249 Ga0495669_0000081
1250 Ga0495669_0042118
1251 Ga0495613_0008104
1252 Ga0495613_0198589
1253 Ga0495670_0116522
1254 Ga0495671_0137501
1255 Ga0495671_0164492
1256 Ga0495649_0000803
1257 Ga0495589_0008679
1258 Ga0495660_0015514
1259 Ga0495660_0069672
1260 Ga0495636_0203891
1261 Ga0495672_0000196
1262 Ga0495672_0000986
1263 Ga0495672_0013127
1264 Ga0495672_0074578
1265 Ga0495683_0083101
1266 Ga0495677_0045818
1267 Ga0495679_007810
1268 Ga0495673_0000277
1269 Ga0495673_0001410
1270 Ga0495673_0001949
1271 Ga0495686_0000074
1272 Ga0495686_0001197
1273 Ga0495686_0002903
1274 Ga0495686_0019755
1275 Ga0495686_0125718
1276 Ga0495686_0144981
1277 Ga0495593_0010025
1278 Ga0496100_0066328
1279 Ga0496100_0966649
1280 Ga0496102_0135975
1281 Ga0496103_0363731
1282 Ga0496105_0056885
1283 Ga0496106_0071453
1284 Ga0496106_0521464
1285 Ga0496106_0848375
1286 Ga0496107_0132578
1287 Ga0496112_0033967
1288 Ga0496112_0108728
1289 Ga0496112_0393395
1290 Ga0496112_0454480
1291 Ga0496113_0305489
1292 Ga0496113_0574058
1293 Ga0496114_0929386
1294 Ga0496115_0009445
1295 Ga0496115_0012341
1296 Ga0496115_0020970
1297 Ga0496115_0034833
1298 Ga0496115_0401667
1299 Ga0496116_0012484
1300 Ga0496116_0104743
1301 Ga0496117_0040108
1302 Ga0496117_0091795
1303 Ga0496118_0012352
1304 Ga0496118_0014192
1305 Ga0496119_0148870
1306 Ga0496119_0364311
1307 Ga0496120_0071132
1308 Ga0496121_0000035
1309 Ga0496121_0013712
1310 Ga0496121_0064604
1311 Ga0496121_0158478
1312 Ga0496122_0002994
1313 Ga0496123_0004303
1314 Ga0496124_0063597
1315 Ga0496124_0274749
1316 Ga0496124_0316445
1317 Ga0496125_0001013
1318 Ga0496125_0016889
1319 Ga0496125_0329196
1320 Ga0496126_0149172
1321 Ga0496126_0358509
1322 Ga0495678_000773
1323 Ga0501033_0002538
1324 Ga0501033_0134799
1325 Ga0501033_0149123
1326 Ga0501034_0034395
1327 Ga0501034_0405909
1328 Ga0501034_0804813
1329 Ga0501034_1309958
1330 Ga0501036_0069717
1331 Ga0501036_0288634
1332 Ga0501037_0008727
1333 Ga0501037_0014126
1334 Ga0501037_0061325
1335 Ga0501037_0780570
1336 Ga0501038_0249883
1337 Ga0501038_0281287
1338 Ga0501043_0047212
1339 Ga0501043_0081076
1340 Ga0501043_0102371
1341 Ga0501046_0241749
1342 Ga0501046_0726547
1343 Ga0501047_0043548
1344 Ga0501047_0054044
1345 Ga0501047_0096003
1346 Ga0501047_0224249
1347 Ga0501047_0294087
1348 Ga0501047_0326879
1349 Ga0501047_0760063
1350 Ga0501048_0238662
1351 Ga0501067_0000210
1352 Ga0501067_0038780
1353 Ga0501068_0000231
1354 Ga0501070_0540562
1355 Ga0501072_0015337
1356 Ga0501073_0000002
1357 Ga0501073_0011697
1358 Ga0501073_0045456
1359 Ga0501074_0186235
1360 Ga0501077_0000003
1361 Ga0501077_0060131
1362 Ga0501238_001246
1363 Ga0501080_0009896
1364 Ga0501080_0010816
1365 Ga0501080_0022086
1366 Ga0501080_0181923
1367 Ga0501080_0196936
1368 Ga0501083_0002845
1369 Ga0501083_0007673
1370 Ga0501083_0049533
1371 Ga0501083_0129652
1372 Ga0501035_0280449
1373 Ga0501044_0002455
1374 Ga0501044_0004301
1375 Ga0501044_0005226
1376 Ga0501044_0070117
1377 Ga0501044_0207648
1378 nmdc:mga03683_467496_c1
1379 nmdc:mga03n38_44855_c1
1380 nmdc:mga00v17_344_c1
1381 nmdc:mga00v17_3983_c1
1382 nmdc:mga0k408_259835_c1
1383 nmdc:mga0k408_82415_c1
1384 nmdc:mga04h51_3658_c1
1385 nmdc:mga07m45_1519_c1
1386 nmdc:mga07m45_164686_c1
1387 nmdc:mga07m45_271914_c1
1388 Ga0500635_0000252
1389 Ga0500635_0000381
1390 Ga0500635_0036245
1391 Ga0495619_0104544
1392 Ga0500578_0001117
1393 Ga0500578_0205274
1394 Ga0500643_004997
1395 Ga0500643_007800
1396 Ga0500643_009670
1397 Ga0500644_0000903
1398 Ga0500646_0007024
1399 Ga0500647_0001015
1400 Ga0500647_0021841
1401 Ga0500583_0388516
1402 Ga0500651_0001298
1403 Ga0500651_0030734
1404 Ga0500566_0030594
1405 Ga0500641_0000471
1406 Ga0500641_0021092
1407 Ga0500650_0390451
1408 Ga0500555_004945
1409 Ga0500556_0001676
1410 Ga0500562_001028
1411 Ga0500562_001576
1412 Ga0500562_005914
1413 Ga0500569_000507
1414 Ga0500572_000158
1415 Ga0500595_023625
1416 Ga0500595_027809
1417 Ga0500597_104715
1418 Ga0500608_000127
1419 Ga0500608_002789
1420 Ga0500608_178394
1421 Ga0500614_020946
1422 Ga0500618_000152
1423 Ga0500658_0003919
1424 Ga0500559_0000048
1425 Ga0500559_0000054
1426 Ga0500559_0005611
1427 Ga0500559_0034704
1428 Ga0500559_0095559
1429 Ga0500564_005035
1430 Ga0500568_0111226
1431 Ga0500573_0194425
1432 Ga0500573_0240470
1433 Ga0500577_0002187
1434 Ga0500590_008271
1435 Ga0500604_0128126
1436 Ga0500616_0044371
1437 Ga0500619_025885
1438 Ga0500622_0005017
1439 Ga0500622_0009953
1440 Ga0500622_0014793
1441 Ga0500627_0006052
1442 Ga0500633_0080684
1443 Ga0500638_094956
1444 Ga0500636_0015413
1445 Ga0500637_0002566
1446 Ga0500611_007453
1447 Ga0500625_007542
1448 Ga0500645_001218
1449 Ga0500645_002274
1450 Ga0500645_039525
1451 Ga0500645_074201
1452 Ga0500609_001688
1453 Ga0500596_007463
1454 Ga0501084_0105102
1455 Ga0501082_0010360
1456 Ga0501082_0564256
1457 Ga0501082_0878883
1458 Ga0466962_0002337
1459 Ga0466962_0060442
1460 2511123838
1461 2585148289
1462 2585150977
1463 2585196362
1464 2587919161
1465 2603861884
1466 2643750332
1467 2643780397
1468 2643882366
1469 2643926880
1470 2643929724
1471 2643998733
1472 2644087316
1473 2644237048
1474 2644344640
1475 2644353546
1476 2644366676
1477 2644507221
1478 2644548642
1479 2739792681
1480 2792461287
1481 2819538370
1482 2819648185
1483 2843745357
1484 2849564637
1485 2849577743
1486 2851155630
1487 2857508435
1488 2857526051
1489 2884961237
1490 2893067674
1491 2898331111
1492 2919074097
1493 2928534569
1494 2928973369
1495 2941489406
1496 2977240656

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

48

158

0.98

PF02954

HTH_8

Bacterial regulatory protein, Fis family

180

213

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.9161 14 121
6lgq-assembly1.cif.gz_D the crystal complex structure of histidine kinase and response regulator 0.9126 14 121
7w9h-assembly1.cif.gz_A crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa 0.9099 14 122
3q15-assembly1.cif.gz_C-2 crystal structure of raph complexed with spo0f 0.907 15 124
7lza-assembly1.cif.gz_A activated form of vanr from s. coelicolor 0.9038 14 127
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9449 15 93 3.40.50.2300
af_Q2FVQ9_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9152 15 93 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9121 15 93 3.40.50.2300
af_Q2G2U6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9113 15 93 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9104 15 93 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A537MTC4-F1-model_v4 Response regulator 0.977 11 128 GO:0000160
AF-A0A5R2N4K3-F1-model_v4 Response regulator 0.9665 10 121 GO:0000160
AF-A0A350ACA4-F1-model_v4 Two-component system response regulator 0.9511 6 115 GO:0000160
AF-A0A7V3BLX4-F1-model_v4 Response regulator 0.9393 11 125 GO:0000160
AF-A0A849ZNT2-F1-model_v4 Response regulator 0.931 13 127 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map