F478972

General Info

Members Datasets Scaffolds Average Seq Length
748 320 1496 205

Family's Representative Sequence

Representative Sequence 3300047318|Ga0495636_0001714|Ga0495636_0001714_142_717
Length 191
Sequence MQRLLLGIDWFSTFIGQAASWLIIALTLMISYEVFSRYALGAPHAWVFDASDIVYGFLPPRMQAGIDLVLYLAFFFPGVIALAWAGIDFFEVSLAQNEHSSIAADGPPIYPFKAVIPVAGALLLLQGVAETIRCLLCLRSGRWPPRAGDVEEVDVEKLKELVQGTPTVELAESPPPRDDKIDQNDQPGAGR

Samples

Sample ID Description Type Environment
1 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
174 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
289 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
290 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
291 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
292 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
293 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
294 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
316 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
317 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
318 2773857925 Microvirga vignae BR3299 Isolate Unclassified
319 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
320 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 0.67
Rhizoplane 1.47
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495636_0001714 3300047318 Bacteria 8358
2 JGI25151J46595_10004933 3300003187 Bacteria 6965
3 JGI25151J46595_10013212 3300003187 Bacteria 3724
4 rootH1_10016408 3300003323 Bacteria 1264
5 Ga0055526_1004904 3300003771 Bacteria 7871
6 Ga0055537_1007396 3300003773 Bacteria 2653
7 Ga0055524_1000488 3300003775 Bacteria 31194
8 Ga0055524_1014861 3300003775 Bacteria 2865
9 Ga0055534_1009779 3300003784 Bacteria 2055
10 Ga0055543_1003034 3300004625 Bacteria 5181
11 Ga0065165_1001096 3300005262 Bacteria 32206
12 Ga0065707_10230083 3300005295 Bacteria 1192
13 Ga0065707_10411900 3300005295 Bacteria 840
14 Ga0070676_10020325 3300005328 Bacteria 3705
15 Ga0070676_10042854 3300005328 Bacteria 2630
16 Ga0070676_10104803 3300005328 Bacteria 1753
17 Ga0070676_10178454 3300005328 Bacteria 1379
18 Ga0070676_10211716 3300005328 Bacteria 1276
19 Ga0070670_100008333 3300005331 Bacteria 8836
20 Ga0070670_100011888 3300005331 Bacteria 7443
21 Ga0070670_100020150 3300005331 Bacteria 5729
22 Ga0070670_100030872 3300005331 Bacteria 4615
23 Ga0070670_100051779 3300005331 Bacteria 3525
24 Ga0070670_100060827 3300005331 Bacteria 3243
25 Ga0070670_100067263 3300005331 Bacteria 3075
26 Ga0070670_100075371 3300005331 Bacteria 2898
27 Ga0070670_100083190 3300005331 Bacteria 2750
28 Ga0070670_100108801 3300005331 Bacteria 2388
29 Ga0070670_100448899 3300005331 Bacteria 1142
30 Ga0070670_100681416 3300005331 Bacteria 923
31 Ga0070677_10006991 3300005333 Bacteria 3753
32 Ga0070677_10007083 3300005333 Bacteria 3734
33 Ga0070677_10040077 3300005333 Bacteria 1841
34 Ga0070677_10247619 3300005333 Bacteria 883
35 Ga0068869_100002178 3300005334 Bacteria 11779
36 Ga0068869_100058393 3300005334 Bacteria 2821
37 Ga0068869_100076113 3300005334 Bacteria 2494
38 Ga0068869_100700067 3300005334 Bacteria 864
39 Ga0070666_10065541 3300005335 Bacteria 2464
40 Ga0070666_10085796 3300005335 Bacteria 2157
41 Ga0068868_100272653 3300005338 Bacteria 1430
42 Ga0068868_100950954 3300005338 Bacteria 783
43 Ga0070689_100138373 3300005340 Bacteria 1956
44 Ga0070689_100242503 3300005340 Bacteria 1485
45 Ga0070687_100049051 3300005343 Bacteria 2174
46 Ga0070661_100380215 3300005344 Bacteria 1113
47 Ga0070668_100026162 3300005347 Bacteria 4426
48 Ga0070668_100035627 3300005347 Bacteria 3795
49 Ga0070668_100077943 3300005347 Bacteria 2591
50 Ga0070668_100099331 3300005347 Bacteria 2304
51 Ga0070669_100014820 3300005353 Bacteria 5552
52 Ga0070669_100023295 3300005353 Bacteria 4434
53 Ga0070669_100189103 3300005353 Bacteria 1614
54 Ga0070669_100227505 3300005353 Bacteria 1477
55 Ga0070669_100345378 3300005353 Bacteria 1207
56 Ga0070669_100540450 3300005353 Bacteria 971
57 Ga0070669_100721800 3300005353 Bacteria 843
58 Ga0070675_100012879 3300005354 Bacteria 6564
59 Ga0070675_100018673 3300005354 Bacteria 5520
60 Ga0070675_100032393 3300005354 Bacteria 4230
61 Ga0070675_100065528 3300005354 Bacteria 3004
62 Ga0070675_100090876 3300005354 Bacteria 2557
63 Ga0070675_100114413 3300005354 Bacteria 2286
64 Ga0070675_100231596 3300005354 Bacteria 1612
65 Ga0070671_100012717 3300005355 Bacteria 6784
66 Ga0070671_100034996 3300005355 Bacteria 4159
67 Ga0070671_100064759 3300005355 Bacteria 3044
68 Ga0070671_100326416 3300005355 Bacteria 1308
69 Ga0070674_100064171 3300005356 Bacteria 2572
70 Ga0070674_100068103 3300005356 Bacteria 2506
71 Ga0070674_100140238 3300005356 Bacteria 1813
72 Ga0070674_100226308 3300005356 Bacteria 1457
73 Ga0070673_100032411 3300005364 Bacteria 3935
74 Ga0070673_100043445 3300005364 Bacteria 3473
75 Ga0070673_100044999 3300005364 Bacteria 3420
76 Ga0070673_100302036 3300005364 Bacteria 1409
77 Ga0070673_100329521 3300005364 Bacteria 1350
78 Ga0070673_100357978 3300005364 Bacteria 1297
79 Ga0070673_100929637 3300005364 Bacteria 807
80 Ga0070688_100078715 3300005365 Bacteria 2127
81 Ga0070667_100020199 3300005367 Bacteria 5530
82 Ga0070667_100081069 3300005367 Bacteria 2776
83 Ga0070667_100218705 3300005367 Bacteria 1695
84 Ga0070705_100144518 3300005440 Bacteria 1570
85 Ga0070705_100445456 3300005440 Bacteria 970
86 Ga0070705_100632121 3300005440 Bacteria 832
87 Ga0070700_100064397 3300005441 Bacteria 2321
88 Ga0070700_100365516 3300005441 Bacteria 1074
89 Ga0070700_100591378 3300005441 Bacteria 868
90 Ga0070700_100637498 3300005441 Bacteria 840
91 Ga0070694_100130752 3300005444 Bacteria 1813
92 Ga0070694_100466119 3300005444 Bacteria 1000
93 Ga0070694_100596650 3300005444 Bacteria 889
94 Ga0070663_100010275 3300005455 Bacteria 5831
95 Ga0070678_100090119 3300005456 Bacteria 2349
96 Ga0070678_100279510 3300005456 Bacteria 1411
97 Ga0070662_100040717 3300005457 Bacteria 3310
98 Ga0070662_100388999 3300005457 Bacteria 1149
99 Ga0070662_100489686 3300005457 Bacteria 1025
100 Ga0070662_100796850 3300005457 Bacteria 803
101 Ga0068867_100006012 3300005459 Bacteria 8604
102 Ga0068867_100013553 3300005459 Bacteria 5773
103 Ga0068867_100041198 3300005459 Bacteria 3374
104 Ga0068867_100232271 3300005459 Bacteria 1492
105 Ga0068867_100263548 3300005459 Bacteria 1406
106 Ga0068867_100439450 3300005459 Bacteria 1109
107 Ga0070707_100225709 3300005468 Bacteria 1824
108 Ga0070707_100743624 3300005468 Bacteria 944
109 Ga0070698_100181174 3300005471 Bacteria 2045
110 Ga0070698_100931184 3300005471 Bacteria 815
111 Ga0070699_100110418 3300005518 Bacteria 2414
112 Ga0070699_100183749 3300005518 Bacteria 1856
113 Ga0070699_100882601 3300005518 Bacteria 819
114 Ga0068853_100507624 3300005539 Bacteria 1139
115 Ga0070672_100000540 3300005543 Bacteria 22218
116 Ga0070672_100009288 3300005543 Bacteria 6774
117 Ga0070672_100043145 3300005543 Bacteria 3476
118 Ga0070672_100174032 3300005543 Bacteria 1791
119 Ga0070672_100205009 3300005543 Bacteria 1650
120 Ga0070672_100334593 3300005543 Bacteria 1289
121 Ga0070672_100368719 3300005543 Bacteria 1226
122 Ga0070672_100414047 3300005543 Bacteria 1157
123 Ga0070672_100423001 3300005543 Bacteria 1144
124 Ga0070672_101024612 3300005543 Bacteria 732
125 Ga0070695_100240407 3300005545 Bacteria 1313
126 Ga0070695_100304901 3300005545 Bacteria 1178
127 Ga0070695_100556062 3300005545 Bacteria 895
128 Ga0070695_100852803 3300005545 Bacteria 733
129 Ga0070696_100001044 3300005546 Bacteria 17902
130 Ga0070696_100056737 3300005546 Bacteria 2732
131 Ga0070665_100091732 3300005548 Bacteria 3043
132 Ga0070665_100594053 3300005548 Bacteria 1120
133 Ga0070665_101532430 3300005548 Bacteria 675
134 Ga0070704_100147600 3300005549 Bacteria 1845
135 Ga0068855_100537158 3300005563 Bacteria 1267
136 Ga0070664_100055125 3300005564 Bacteria 3374
137 Ga0070664_100368724 3300005564 Bacteria 1309
138 Ga0068857_100240640 3300005577 Bacteria 1657
139 Ga0068857_100381019 3300005577 Bacteria 1310
140 Ga0068854_100607739 3300005578 Bacteria 934
141 Ga0068854_100824828 3300005578 Bacteria 810
142 Ga0068856_100718588 3300005614 Bacteria 1019
143 Ga0070702_100028514 3300005615 Bacteria 3026
144 Ga0070702_100128547 3300005615 Bacteria 1597
145 Ga0068852_100132030 3300005616 Bacteria 2301
146 Ga0068852_100425084 3300005616 Bacteria 1311
147 Ga0068852_101019153 3300005616 Bacteria 847
148 Ga0068859_100020560 3300005617 Bacteria 6623
149 Ga0068859_100131151 3300005617 Bacteria 2578
150 Ga0068859_100163970 3300005617 Bacteria 2301
151 Ga0068859_100205804 3300005617 Bacteria 2053
152 Ga0068864_100028449 3300005618 Bacteria 4725
153 Ga0068864_100040549 3300005618 Bacteria 3983
154 Ga0068864_100068050 3300005618 Bacteria 3093
155 Ga0068864_100116049 3300005618 Bacteria 2388
156 Ga0068864_100275349 3300005618 Bacteria 1569
157 Ga0068861_100004064 3300005719 Bacteria 9801
158 Ga0068861_100057970 3300005719 Bacteria 2959
159 Ga0068861_100124110 3300005719 Bacteria 2087
160 Ga0068861_100132912 3300005719 Bacteria 2022
161 Ga0068851_10043711 3300005834 Bacteria 2259
162 Ga0068870_10009061 3300005840 Bacteria 4506
163 Ga0068870_10009625 3300005840 Bacteria 4403
164 Ga0068870_10460453 3300005840 Bacteria 840
165 Ga0068863_100038956 3300005841 Bacteria 4523
166 Ga0068863_100049917 3300005841 Bacteria 3967
167 Ga0068863_100088615 3300005841 Bacteria 2933
168 Ga0068863_100150551 3300005841 Bacteria 2226
169 Ga0068863_100543565 3300005841 Bacteria 1147
170 Ga0068858_100009653 3300005842 Bacteria 9194
171 Ga0068858_100022446 3300005842 Bacteria 5890
172 Ga0068858_100172697 3300005842 Bacteria 2039
173 Ga0068858_100889369 3300005842 Bacteria 871
174 Ga0068860_100004324 3300005843 Bacteria 14519
175 Ga0068860_100011784 3300005843 Bacteria 8615
176 Ga0068860_100065290 3300005843 Bacteria 3456
177 Ga0068862_100059983 3300005844 Bacteria 3267
178 Ga0068862_100185833 3300005844 Bacteria 1867
179 Ga0068862_100239407 3300005844 Bacteria 1649
180 Ga0068862_100324130 3300005844 Bacteria 1423
181 Ga0068862_100488336 3300005844 Bacteria 1167
182 Ga0081455_10297775 3300005937 Bacteria 1159
183 Ga0081539_10000276 3300005985 Bacteria 117151
184 Ga0075366_10227744 3300006195 Bacteria 1136
185 Ga0097621_100021030 3300006237 Bacteria 5037
186 Ga0097621_100055006 3300006237 Bacteria 3249
187 Ga0097621_100554892 3300006237 Bacteria 1046
188 Ga0097621_100643896 3300006237 Bacteria 972
189 Ga0068871_100039121 3300006358 Bacteria 3793
190 Ga0068871_100156031 3300006358 Bacteria 1949
191 Ga0068871_101008107 3300006358 Bacteria 776
192 Ga0075428_100008443 3300006844 Bacteria 11428
193 Ga0075428_100010917 3300006844 Bacteria 10104
194 Ga0075430_100023225 3300006846 Bacteria 5276
195 Ga0075430_100098403 3300006846 Bacteria 2444
196 Ga0075431_100001643 3300006847 Bacteria 20931
197 Ga0075431_100016863 3300006847 Bacteria 7418
198 Ga0075431_100017676 3300006847 Bacteria 7250
199 Ga0075431_100023311 3300006847 Bacteria 6332
200 Ga0075433_10369878 3300006852 Bacteria 1266
201 Ga0075434_100409716 3300006871 Bacteria 1377
202 Ga0075434_100574453 3300006871 Bacteria 1147
203 Ga0075429_100000575 3300006880 Bacteria 28243
204 Ga0075429_100027446 3300006880 Bacteria 4942
205 Ga0075429_100110261 3300006880 Bacteria 2406
206 Ga0068865_100109169 3300006881 Bacteria 2038
207 Ga0068865_100124414 3300006881 Bacteria 1922
208 Ga0068865_100226846 3300006881 Bacteria 1463
209 Ga0068865_100249651 3300006881 Bacteria 1400
210 Ga0097620_100020560 3300006931 Bacteria 6623
211 Ga0097620_100131151 3300006931 Bacteria 2578
212 Ga0097620_100163971 3300006931 Bacteria 2301
213 Ga0097620_100205793 3300006931 Bacteria 2053
214 Ga0099826_10000050 3300006948 Bacteria 74241
215 Ga0075435_100150556 3300007076 Bacteria 1956
216 Ga0075435_100318525 3300007076 Bacteria 1331
217 Ga0099794_10045144 3300007265 Bacteria 2108
218 Ga0099795_10209901 3300007788 Bacteria 825
219 Ga0105251_10024034 3300009011 Bacteria 3135
220 Ga0105251_10035967 3300009011 Bacteria 2440
221 Ga0111539_10029178 3300009094 Bacteria 6725
222 Ga0111539_10128893 3300009094 Bacteria 2963
223 Ga0111539_10284029 3300009094 Bacteria 1926
224 Ga0111539_10423801 3300009094 Bacteria 1550
225 Ga0111539_10892966 3300009094 Bacteria 1034
226 Ga0111539_11015232 3300009094 Bacteria 964
227 Ga0114129_10004402 3300009147 Bacteria 19867
228 Ga0114129_10201479 3300009147 Bacteria 2695
229 Ga0114129_10381050 3300009147 Bacteria 1863
230 Ga0114129_10457371 3300009147 Bacteria 1673
231 Ga0114129_11468809 3300009147 Bacteria 839
232 Ga0105243_10016451 3300009148 Bacteria 5593
233 Ga0105243_10160742 3300009148 Bacteria 1936
234 Ga0105243_10456721 3300009148 Bacteria 1200
235 Ga0105242_10451265 3300009176 Bacteria 1212
236 Ga0105242_10480889 3300009176 Bacteria 1177
237 Ga0105248_10063156 3300009177 Bacteria 4156
238 Ga0105248_10084315 3300009177 Bacteria 3574
239 Ga0105248_10421304 3300009177 Bacteria 1504
240 Ga0105249_10180227 3300009553 Bacteria 2055
241 Ga0099796_10018851 3300010159 Bacteria 2081
242 Ga0105246_10623737 3300011119 Bacteria 935
243 Ga0163162_10002702 3300013306 Bacteria 16820
244 Ga0163162_10036530 3300013306 Bacteria 4897
245 Ga0163162_10154913 3300013306 Bacteria 2411
246 Ga0163162_10296411 3300013306 Bacteria 1749
247 Ga0163162_10327554 3300013306 Bacteria 1664
248 Ga0163162_10402744 3300013306 Bacteria 1501
249 Ga0163162_11215952 3300013306 Bacteria 855
250 Ga0163162_11352732 3300013306 Bacteria 810
251 Ga0163162_11371647 3300013306 Bacteria 804
252 Ga0157375_10018857 3300013308 Bacteria 6263
253 Ga0157375_10026378 3300013308 Bacteria 5413
254 Ga0157375_10037174 3300013308 Bacteria 4663
255 Ga0157375_10118883 3300013308 Bacteria 2750
256 Ga0157375_10123580 3300013308 Bacteria 2701
257 Ga0157375_10240890 3300013308 Bacteria 1968
258 Ga0157375_10461358 3300013308 Bacteria 1436
259 Ga0157375_10594763 3300013308 Bacteria 1266
260 Ga0157375_10902058 3300013308 Bacteria 1028
261 Ga0163163_10044184 3300014325 Bacteria 4370
262 Ga0163163_10126550 3300014325 Bacteria 2593
263 Ga0163163_10768296 3300014325 Bacteria 1027
264 Ga0157380_10169750 3300014326 Bacteria 1905
265 Ga0157380_10306596 3300014326 Bacteria 1465
266 Ga0157380_10445338 3300014326 Bacteria 1242
267 Ga0157380_10490904 3300014326 Bacteria 1190
268 Ga0157380_10685403 3300014326 Bacteria 1027
269 Ga0157380_11268171 3300014326 Bacteria 783
270 Ga0157377_10039000 3300014745 Bacteria 2626
271 Ga0157377_10120827 3300014745 Bacteria 1587
272 Ga0157379_10003195 3300014968 Bacteria 13882
273 Ga0157379_10017688 3300014968 Bacteria 6279
274 Ga0157379_10156126 3300014968 Bacteria 2059
275 Ga0157376_10022178 3300014969 Bacteria 4944
276 Ga0157376_10347335 3300014969 Bacteria 1419
277 Ga0157376_10669709 3300014969 Bacteria 1040
278 Ga0157376_10672134 3300014969 Bacteria 1038
279 Ga0163161_10010755 3300017792 Bacteria 6340
280 Ga0163161_10020802 3300017792 Bacteria 4607
281 Ga0209565_1000346 3300025263 Bacteria 40736
282 Ga0209565_1002907 3300025263 Bacteria 5853
283 Ga0209130_1000296 3300025284 Bacteria 60641
284 Ga0209675_1001409 3300025291 Bacteria 13900
285 Ga0209675_1003382 3300025291 Bacteria 7609
286 Ga0209025_1001396 3300025294 Bacteria 32114
287 Ga0209025_1008607 3300025294 Bacteria 7305
288 Ga0209564_1000932 3300025295 Bacteria 37913
289 Ga0209758_1007019 3300025297 Bacteria 7826
290 Ga0209256_1000196 3300025299 Bacteria 115576
291 Ga0209256_1003058 3300025299 Bacteria 12319
292 Ga0207426_1029673 3300025302 Bacteria 1801
293 Ga0209051_1014927 3300025303 Bacteria 3602
294 Ga0207697_10007789 3300025315 Bacteria 4745
295 Ga0207697_10146443 3300025315 Bacteria 1026
296 Ga0207697_10335457 3300025315 Bacteria 671
297 Ga0207682_10006377 3300025893 Bacteria 4757
298 Ga0207682_10007431 3300025893 Bacteria 4366
299 Ga0207682_10008718 3300025893 Bacteria 4011
300 Ga0207682_10120355 3300025893 Bacteria 1164
301 Ga0207682_10189973 3300025893 Bacteria 941
302 Ga0207688_10130453 3300025901 Bacteria 1473
303 Ga0207680_10225172 3300025903 Bacteria 1287
304 Ga0207680_10257964 3300025903 Bacteria 1206
305 Ga0207647_10357885 3300025904 Bacteria 826
306 Ga0207645_10009976 3300025907 Bacteria 6542
307 Ga0207645_10089989 3300025907 Bacteria 1974
308 Ga0207645_10099646 3300025907 Bacteria 1874
309 Ga0207643_10012795 3300025908 Bacteria 4536
310 Ga0207643_10028466 3300025908 Bacteria 3103
311 Ga0207643_10035482 3300025908 Bacteria 2796
312 Ga0207643_10051561 3300025908 Bacteria 2336
313 Ga0207684_10033701 3300025910 Bacteria 4356
314 Ga0207662_10029538 3300025918 Bacteria 3177
315 Ga0207662_10103907 3300025918 Bacteria 1764
316 Ga0207662_10105692 3300025918 Bacteria 1750
317 Ga0207662_10193022 3300025918 Bacteria 1315
318 Ga0207657_10211128 3300025919 Bacteria 1558
319 Ga0207649_10252884 3300025920 Bacteria 1270
320 Ga0207646_10278809 3300025922 Bacteria 1511
321 Ga0207681_10028026 3300025923 Bacteria 3646
322 Ga0207681_10078285 3300025923 Bacteria 2326
323 Ga0207681_10157941 3300025923 Bacteria 1706
324 Ga0207681_10273110 3300025923 Bacteria 1328
325 Ga0207681_10417915 3300025923 Bacteria 1086
326 Ga0207681_10457120 3300025923 Bacteria 1039
327 Ga0207650_10005914 3300025925 Bacteria 8347
328 Ga0207650_10006033 3300025925 Bacteria 8267
329 Ga0207650_10014339 3300025925 Bacteria 5509
330 Ga0207650_10030086 3300025925 Bacteria 3909
331 Ga0207650_10031986 3300025925 Bacteria 3804
332 Ga0207650_10040549 3300025925 Bacteria 3408
333 Ga0207650_10057007 3300025925 Bacteria 2904
334 Ga0207650_10067159 3300025925 Bacteria 2690
335 Ga0207650_10139808 3300025925 Bacteria 1902
336 Ga0207650_10188574 3300025925 Bacteria 1647
337 Ga0207650_10205624 3300025925 Bacteria 1579
338 Ga0207659_10028214 3300025926 Bacteria 3812
339 Ga0207659_10064705 3300025926 Bacteria 2647
340 Ga0207659_10084841 3300025926 Bacteria 2351
341 Ga0207659_10106422 3300025926 Bacteria 2124
342 Ga0207659_10202774 3300025926 Bacteria 1585
343 Ga0207659_10763926 3300025926 Bacteria 829
344 Ga0207644_10016531 3300025931 Bacteria 4963
345 Ga0207644_10063708 3300025931 Bacteria 2677
346 Ga0207644_10152341 3300025931 Bacteria 1790
347 Ga0207644_10173770 3300025931 Bacteria 1684
348 Ga0207644_10299924 3300025931 Bacteria 1294
349 Ga0207706_10029837 3300025933 Bacteria 4867
350 Ga0207706_10061685 3300025933 Bacteria 3302
351 Ga0207706_10076866 3300025933 Bacteria 2936
352 Ga0207706_10300239 3300025933 Bacteria 1399
353 Ga0207706_10441902 3300025933 Bacteria 1126
354 Ga0207686_10627514 3300025934 Bacteria 848
355 Ga0207686_10635209 3300025934 Bacteria 843
356 Ga0207709_10149388 3300025935 Bacteria 1616
357 Ga0207709_10335987 3300025935 Bacteria 1135
358 Ga0207670_10040562 3300025936 Bacteria 3056
359 Ga0207670_10052317 3300025936 Bacteria 2745
360 Ga0207670_10140113 3300025936 Bacteria 1783
361 Ga0207670_10182476 3300025936 Bacteria 1582
362 Ga0207669_10002726 3300025937 Bacteria 7565
363 Ga0207669_10070860 3300025937 Bacteria 2187
364 Ga0207669_10356238 3300025937 Bacteria 1132
365 Ga0207669_10501184 3300025937 Bacteria 971
366 Ga0207704_10066489 3300025938 Bacteria 2263
367 Ga0207704_10161928 3300025938 Bacteria 1593
368 Ga0207704_10252002 3300025938 Bacteria 1326
369 Ga0207691_10004330 3300025940 Bacteria 13784
370 Ga0207691_10006532 3300025940 Bacteria 11257
371 Ga0207691_10009304 3300025940 Bacteria 9430
372 Ga0207691_10019936 3300025940 Bacteria 6344
373 Ga0207691_10022261 3300025940 Bacteria 5979
374 Ga0207691_10062371 3300025940 Bacteria 3383
375 Ga0207691_10072710 3300025940 Bacteria 3102
376 Ga0207691_10075210 3300025940 Bacteria 3045
377 Ga0207691_10076896 3300025940 Bacteria 3008
378 Ga0207691_10098574 3300025940 Bacteria 2610
379 Ga0207691_10157528 3300025940 Bacteria 1993
380 Ga0207691_10234775 3300025940 Bacteria 1587
381 Ga0207691_10775420 3300025940 Bacteria 806
382 Ga0207711_10043561 3300025941 Bacteria 3829
383 Ga0207711_10053837 3300025941 Bacteria 3452
384 Ga0207711_10224892 3300025941 Bacteria 1717
385 Ga0207711_10305580 3300025941 Bacteria 1468
386 Ga0207689_10001032 3300025942 Bacteria 26745
387 Ga0207689_10006194 3300025942 Bacteria 10596
388 Ga0207689_10051329 3300025942 Bacteria 3400
389 Ga0207689_10336646 3300025942 Bacteria 1253
390 Ga0207679_10317531 3300025945 Bacteria 1348
391 Ga0207679_10356459 3300025945 Bacteria 1276
392 Ga0207651_10025568 3300025960 Bacteria 3672
393 Ga0207651_10045463 3300025960 Bacteria 2945
394 Ga0207651_10106950 3300025960 Bacteria 2090
395 Ga0207651_10163552 3300025960 Bacteria 1747
396 Ga0207651_10285070 3300025960 Bacteria 1367
397 Ga0207651_10447997 3300025960 Bacteria 1107
398 Ga0207651_10529346 3300025960 Bacteria 1022
399 Ga0207712_10031387 3300025961 Bacteria 3578
400 Ga0207712_10397476 3300025961 Bacteria 1157
401 Ga0207668_10011971 3300025972 Bacteria 5294
402 Ga0207668_10056935 3300025972 Bacteria 2725
403 Ga0207668_10106079 3300025972 Bacteria 2098
404 Ga0207668_10132909 3300025972 Bacteria 1902
405 Ga0207640_10795152 3300025981 Bacteria 819
406 Ga0207658_10010800 3300025986 Bacteria 6213
407 Ga0207658_10049443 3300025986 Bacteria 3090
408 Ga0207658_10104962 3300025986 Bacteria 2221
409 Ga0207658_10335682 3300025986 Bacteria 1312
410 Ga0207677_10213585 3300026023 Bacteria 1542
411 Ga0207677_10621764 3300026023 Bacteria 950
412 Ga0207703_10003070 3300026035 Bacteria 14122
413 Ga0207703_10015618 3300026035 Bacteria 5922
414 Ga0207703_10125416 3300026035 Bacteria 2210
415 Ga0207678_10119540 3300026067 Bacteria 2248
416 Ga0207708_10078024 3300026075 Bacteria 2543
417 Ga0207708_10287563 3300026075 Bacteria 1334
418 Ga0207708_10309265 3300026075 Bacteria 1287
419 Ga0207708_10422563 3300026075 Bacteria 1105
420 Ga0207702_10997458 3300026078 Bacteria 831
421 Ga0207641_10031198 3300026088 Bacteria 4419
422 Ga0207641_10039914 3300026088 Bacteria 3927
423 Ga0207641_10042452 3300026088 Bacteria 3815
424 Ga0207641_10178268 3300026088 Bacteria 1944
425 Ga0207641_10189176 3300026088 Bacteria 1891
426 Ga0207648_10026765 3300026089 Bacteria 5123
427 Ga0207648_10041339 3300026089 Bacteria 4048
428 Ga0207648_10041579 3300026089 Bacteria 4036
429 Ga0207648_10071563 3300026089 Bacteria 3022
430 Ga0207648_10188873 3300026089 Bacteria 1825
431 Ga0207648_10247497 3300026089 Bacteria 1589
432 Ga0207648_10354254 3300026089 Bacteria 1323
433 Ga0207648_10646788 3300026089 Bacteria 977
434 Ga0207648_10755684 3300026089 Bacteria 903
435 Ga0207676_10006515 3300026095 Bacteria 8254
436 Ga0207676_10027646 3300026095 Bacteria 4227
437 Ga0207676_10044168 3300026095 Bacteria 3436
438 Ga0207676_10057541 3300026095 Bacteria 3062
439 Ga0207676_10103998 3300026095 Bacteria 2361
440 Ga0207676_10485487 3300026095 Bacteria 1171
441 Ga0207676_11252479 3300026095 Bacteria 736
442 Ga0207674_10042229 3300026116 Bacteria 4712
443 Ga0207674_10156505 3300026116 Bacteria 2234
444 Ga0207674_10893035 3300026116 Bacteria 857
445 Ga0207675_100001734 3300026118 Bacteria 21824
446 Ga0207675_100026924 3300026118 Bacteria 5353
447 Ga0207675_100070121 3300026118 Bacteria 3276
448 Ga0207675_100089239 3300026118 Bacteria 2897
449 Ga0207675_100298544 3300026118 Bacteria 1568
450 Ga0207683_10079952 3300026121 Bacteria 2899
451 Ga0207683_10115855 3300026121 Bacteria 2402
452 Ga0207683_10181247 3300026121 Bacteria 1910
453 Ga0207683_10692254 3300026121 Bacteria 945
454 Ga0207683_10736715 3300026121 Bacteria 914
455 Ga0207683_10931201 3300026121 Bacteria 807
456 Ga0207698_10148571 3300026142 Bacteria 2030
457 Ga0207698_10376696 3300026142 Bacteria 1349
458 Ga0209179_1000830 3300027512 Bacteria 3411
459 Ga0209282_1000079 3300027666 Bacteria 74206
460 Ga0209974_10029203 3300027876 Bacteria 1827
461 Ga0207428_10005129 3300027907 Bacteria 12274
462 Ga0207428_10449289 3300027907 Bacteria 940
463 Ga0268266_10078676 3300028379 Bacteria 2870
464 Ga0268266_10509871 3300028379 Bacteria 1149
465 Ga0268266_10713190 3300028379 Bacteria 967
466 Ga0268266_11227826 3300028379 Bacteria 725
467 Ga0268266_11386570 3300028379 Bacteria 678
468 Ga0268265_10105987 3300028380 Bacteria 2282
469 Ga0268265_10149309 3300028380 Bacteria 1969
470 Ga0268265_10278290 3300028380 Bacteria 1496
471 Ga0268265_10421343 3300028380 Bacteria 1239
472 Ga0268265_10873500 3300028380 Bacteria 881
473 Ga0268264_10003336 3300028381 Bacteria 13872
474 Ga0268264_10005452 3300028381 Bacteria 10779
475 Ga0268264_10195688 3300028381 Bacteria 1846
476 Ga0307513_10096663 3300031456 Bacteria 2991
477 Ga0307408_100047542 3300031548 Bacteria 3073
478 Ga0307408_100425807 3300031548 Bacteria 1146
479 Ga0307408_100644482 3300031548 Unclassified 946
480 Ga0307405_10010014 3300031731 Bacteria 4889
481 Ga0307405_10050433 3300031731 Bacteria 2577
482 Ga0307405_10097278 3300031731 Bacteria 1965
483 Ga0307413_10120685 3300031824 Bacteria 1775
484 Ga0307410_10197448 3300031852 Bacteria 1534
485 Ga0307406_10001223 3300031901 Bacteria 14376
486 Ga0307406_10158551 3300031901 Bacteria 1624
487 Ga0307412_10071126 3300031911 Bacteria 2374
488 Ga0307409_100000872 3300031995 Bacteria 13959
489 Ga0307409_100014209 3300031995 Bacteria 5164
490 Ga0307409_100319463 3300031995 Bacteria 1452
491 Ga0307409_100690332 3300031995 Bacteria 1019
492 Ga0307416_100001672 3300032002 Bacteria 12253
493 Ga0307416_100160629 3300032002 Bacteria 2076
494 Ga0307416_101222943 3300032002 Bacteria 857
495 Ga0307414_10040016 3300032004 Bacteria 3163
496 Ga0307411_10002288 3300032005 Bacteria 8388
497 Ga0307411_10175715 3300032005 Bacteria 1620
498 Ga0307411_10311042 3300032005 Bacteria 1268
499 Ga0307415_100001472 3300032126 Bacteria 11268
500 Ga0307415_100003873 3300032126 Bacteria 7681
501 Ga0373948_0012952 3300034817 Bacteria 1498
502 Ga0373958_0011873 3300034819 Bacteria 1481
503 Ga0373926_0069754 3300035083 Bacteria 1290
504 Ga0373934_0015476 3300035086 Bacteria 2894
505 Ga0373940_0015661 3300035088 Bacteria 1868
506 Ga0373944_0003090 3300035089 Bacteria 4282
507 Ga0373944_0104847 3300035089 Bacteria 959
508 Ga0373923_0006243 3300035111 Bacteria 4103
509 Ga0373936_0005213 3300035113 Bacteria 4890
510 Ga0373953_0099438 3300035117 Bacteria 1223
511 Ga0373954_0004632 3300035118 Bacteria 5929
512 Ga0373956_0006596 3300035119 Bacteria 4653
513 Ga0373956_0016923 3300035119 Bacteria 3066
514 Ga0373957_0109263 3300035120 Bacteria 1112
515 Ga0373957_0189684 3300035120 Bacteria 854
516 Ga0373943_0002310 3300035170 Bacteria 8662
517 Ga0373943_0175020 3300035170 Bacteria 1176
518 Ga0373946_0428040 3300035171 Bacteria 671
519 Ga0373955_0027102 3300035172 Bacteria 2958
520 Ga0373942_0022695 3300035207 Bacteria 1595
521 Ga0373931_0002786 3300035691 Bacteria 7782
522 Ga0373935_0021868 3300035692 Bacteria 3916
523 Ga0373927_0288240 3300035695 Bacteria 1080
524 Ga0373933_0014538 3300035724 Bacteria 4379
525 Ga0373933_0019319 3300035724 Bacteria 3846
526 Ga0373933_0350813 3300035724 Bacteria 958
527 Ga0373947_0011211 3300035725 Bacteria 5146
528 Ga0373937_0013947 3300036401 Bacteria 7085
529 Ga0373937_0022454 3300036401 Bacteria 5673
530 Ga0373937_0037623 3300036401 Bacteria 4409
531 Ga0373937_0124023 3300036401 Bacteria 2409
532 Ga0373925_0015904 3300037068 Bacteria 5444
533 Ga0373925_0020435 3300037068 Bacteria 4819
534 Ga0373925_0691236 3300037068 Bacteria 841
535 Ga0451807_2741024 3300041486 Bacteria 904
536 Ga0439452_017049 3300042010 Bacteria 1962
537 Ga0451577_0048471 3300042876 Bacteria 3795
538 Ga0451577_0170523 3300042876 Bacteria 1961
539 Ga0451577_0460418 3300042876 Bacteria 1155
540 Ga0451577_0490983 3300042876 Bacteria 1115
541 Ga0453683_0032126 3300044673 Bacteria 3314
542 Ga0453684_0171134 3300044712 Bacteria 2560
543 Ga0453684_0869798 3300044712 Bacteria 967
544 Ga0453684_1419961 3300044712 Bacteria 719
545 Ga0451576_0000239 3300045051 Bacteria 134323
546 Ga0451576_0019510 3300045051 Bacteria 7399
547 Ga0451576_0157899 3300045051 Bacteria 2366
548 Ga0451576_0680273 3300045051 Bacteria 1081
549 Ga0495592_0005206 3300046454 Bacteria 9590
550 Ga0495629_0474735 3300046459 Bacteria 845
551 Ga0495638_0004071 3300046460 Bacteria 11206
552 Ga0495641_0026460 3300046461 Bacteria 2830
553 Ga0495641_0055967 3300046461 Bacteria 1789
554 Ga0495653_0004510 3300046463 Bacteria 11246
555 Ga0495653_0267541 3300046463 Bacteria 1127
556 Ga0495650_0065331 3300046471 Bacteria 1444
557 Ga0495580_0158248 3300046472 Bacteria 1568
558 Ga0495580_0178510 3300046472 Bacteria 1466
559 Ga0495580_0322692 3300046472 Bacteria 1049
560 Ga0495582_0040901 3300046473 Bacteria 2554
561 Ga0495605_0000921 3300046474 Bacteria 20179
562 Ga0495605_0005211 3300046474 Bacteria 7579
563 Ga0495639_0010559 3300046475 Bacteria 3977
564 Ga0495664_0002776 3300046477 Bacteria 9425
565 Ga0495664_0270408 3300046477 Bacteria 1027
566 Ga0495584_0139931 3300046491 Bacteria 1229
567 Ga0495594_0062725 3300046499 Bacteria 2058
568 Ga0495594_0202661 3300046499 Bacteria 1131
569 Ga0495596_0004018 3300046500 Bacteria 7252
570 Ga0495607_0052692 3300046501 Bacteria 2355
571 Ga0495583_0063207 3300046506 Bacteria 1646
572 Ga0495606_0185122 3300046507 Bacteria 1198
573 Ga0495608_0000582 3300046511 Bacteria 25075
574 Ga0495608_0019213 3300046511 Bacteria 4705
575 Ga0495608_0108931 3300046511 Bacteria 1781
576 Ga0495610_0022214 3300046512 Bacteria 3475
577 Ga0495610_0231655 3300046512 Bacteria 741
578 Ga0495618_0032348 3300046514 Bacteria 3275
579 Ga0495618_0046498 3300046514 Bacteria 2739
580 Ga0495628_0001020 3300046516 Bacteria 25585
581 Ga0495630_0010808 3300046517 Bacteria 6591
582 Ga0495630_0033128 3300046517 Bacteria 3852
583 Ga0495630_0044319 3300046517 Bacteria 3324
584 Ga0495631_0137930 3300046518 Bacteria 1047
585 Ga0495644_0037345 3300046523 Bacteria 1833
586 Ga0495648_0061052 3300046524 Bacteria 2240
587 Ga0495648_0118492 3300046524 Bacteria 1427
588 Ga0495666_0007331 3300046526 Bacteria 5529
589 Ga0495642_0044153 3300046528 Bacteria 1819
590 Ga0495652_0014404 3300046529 Bacteria 7100
591 Ga0495640_0013142 3300046533 Bacteria 6300
592 Ga0495640_0073677 3300046533 Bacteria 2285
593 Ga0495586_0001549 3300046535 Bacteria 12688
594 Ga0495586_0026322 3300046535 Bacteria 3112
595 Ga0495586_0040026 3300046535 Bacteria 2521
596 Ga0495586_0048246 3300046535 Bacteria 2300
597 Ga0495587_0026809 3300046536 Bacteria 3510
598 Ga0495598_0162315 3300046537 Bacteria 787
599 Ga0495609_0023481 3300046538 Bacteria 2834
600 Ga0495597_0087768 3300046542 Bacteria 1323
601 Ga0495597_0121168 3300046542 Bacteria 1090
602 Ga0495645_0112012 3300046543 Bacteria 1930
603 Ga0495667_0005737 3300046559 Bacteria 8406
604 Ga0495667_0072056 3300046559 Bacteria 2252
605 Ga0495667_0348588 3300046559 Bacteria 935
606 Ga0495667_0351816 3300046559 Bacteria 930
607 Ga0495668_0000120 3300046616 Bacteria 117076
608 Ga0495634_0003915 3300046642 Bacteria 11820
609 Ga0495634_0290850 3300046642 Bacteria 990
610 Ga0495634_0329610 3300046642 Bacteria 917
611 Ga0495634_0399640 3300046642 Bacteria 816
612 Ga0495635_0016219 3300046663 Bacteria 5200
613 Ga0495661_0010743 3300046665 Bacteria 6234
614 Ga0495588_0295780 3300046674 Bacteria 853
615 Ga0495599_0018862 3300046678 Bacteria 4300
616 Ga0495646_0064031 3300046680 Bacteria 2181
617 Ga0495658_0025628 3300046683 Bacteria 3153
618 Ga0495658_0031129 3300046683 Bacteria 2903
619 Ga0495669_0061034 3300046684 Bacteria 1705
620 Ga0495669_0194318 3300046684 Bacteria 969
621 Ga0495669_0311045 3300046684 Bacteria 760
622 Ga0495613_0007761 3300046689 Bacteria 7987
623 Ga0495624_0127462 3300046690 Bacteria 1561
624 Ga0495624_0154582 3300046690 Bacteria 1402
625 Ga0495670_0109296 3300046691 Bacteria 1430
626 Ga0495671_0028319 3300046692 Bacteria 2888
627 Ga0495671_0029039 3300046692 Bacteria 2844
628 Ga0495649_0020198 3300046694 Bacteria 3737
629 Ga0495589_0000657 3300046794 Bacteria 22640
630 Ga0495600_0002875 3300046809 Bacteria 10030
631 Ga0495600_0012270 3300046809 Bacteria 5353
632 Ga0495581_0038561 3300047315 Bacteria 2765
633 Ga0495604_0009170 3300047317 Bacteria 7830
634 Ga0495604_0055202 3300047317 Bacteria 3062
635 Ga0495636_0061419 3300047318 Bacteria 1589
636 Ga0495636_0204350 3300047318 Bacteria 903
637 Ga0495674_0001667 3300047319 Bacteria 21836
638 Ga0495674_0303906 3300047319 Bacteria 1303
639 Ga0495672_0018295 3300047320 Bacteria 4657
640 Ga0495672_0102947 3300047320 Bacteria 1545
641 Ga0495680_0003120 3300047322 Bacteria 16499
642 Ga0495685_055446 3300047447 Bacteria 1340
643 Ga0495685_073157 3300047447 Bacteria 1146
644 Ga0495684_0011259 3300047471 Bacteria 6910
645 Ga0495684_0055345 3300047471 Bacteria 3025
646 Ga0495686_0003241 3300047472 Bacteria 14282
647 Ga0495686_0216970 3300047472 Bacteria 1090
648 Ga0495593_0097713 3300047673 Bacteria 1508
649 Ga0496100_0426663 3300048903 Bacteria 1013
650 Ga0496102_0115196 3300048905 Bacteria 2508
651 Ga0496102_0221616 3300048905 Bacteria 1783
652 Ga0496104_0318522 3300048907 Bacteria 1468
653 Ga0496106_0000011 3300048909 Bacteria 222845
654 Ga0496106_0131797 3300048909 Bacteria 1961
655 Ga0496107_0120344 3300048910 Bacteria 1934
656 Ga0496109_0641900 3300048912 Bacteria 999
657 Ga0496114_0268547 3300048917 Bacteria 1503
658 Ga0496115_0329812 3300048918 Bacteria 1247
659 Ga0496116_0048230 3300048919 Bacteria 2859
660 Ga0496116_0250783 3300048919 Bacteria 881
661 Ga0496121_0008623 3300048924 Bacteria 11934
662 Ga0496121_0014332 3300048924 Bacteria 8424
663 Ga0496122_0108360 3300048925 Bacteria 1832
664 Ga0496123_0036006 3300048926 Bacteria 3517
665 Ga0496124_0091245 3300048927 Bacteria 2483
666 Ga0501033_0025541 3300049570 Bacteria 4451
667 Ga0501034_0043764 3300049571 Bacteria 4529
668 Ga0501034_0232999 3300049571 Bacteria 1790
669 Ga0501036_0009459 3300049572 Bacteria 8018
670 Ga0501037_0030635 3300049573 Bacteria 3975
671 Ga0501038_0029012 3300049574 Bacteria 4908
672 Ga0501038_0247647 3300049574 Bacteria 1413
673 Ga0501039_0000137 3300049575 Bacteria 50348
674 Ga0501039_0106242 3300049575 Bacteria 2192
675 Ga0501040_0012247 3300049576 Bacteria 5617
676 Ga0501041_0000864 3300049577 Bacteria 16341
677 Ga0501041_0004312 3300049577 Bacteria 8225
678 Ga0501042_0011178 3300049578 Bacteria 6048
679 Ga0501043_0004207 3300049579 Bacteria 11751
680 Ga0501046_0007474 3300049580 Bacteria 9599
681 Ga0501048_0015206 3300049582 Bacteria 5685
682 Ga0501068_0036541 3300049584 Bacteria 2937
683 Ga0501071_0001821 3300049587 Bacteria 12629
684 Ga0501071_0336747 3300049587 Bacteria 1147
685 Ga0501071_0766277 3300049587 Bacteria 744
686 Ga0501072_0008308 3300049588 Bacteria 7884
687 Ga0501072_0149124 3300049588 Bacteria 1865
688 Ga0501072_0273748 3300049588 Bacteria 1343
689 Ga0501073_0054345 3300049589 Bacteria 2804
690 Ga0501074_0008222 3300049590 Bacteria 7563
691 Ga0501075_0001079 3300049591 Bacteria 17539
692 Ga0501075_0167570 3300049591 Bacteria 1676
693 Ga0501076_0002377 3300049592 Bacteria 12882
694 Ga0501077_0002690 3300049593 Bacteria 10658
695 Ga0501202_009848 3300049652 Bacteria 1765
696 Ga0501216_028128 3300049660 Bacteria 1024
697 Ga0501222_042516 3300049662 Unclassified 649
698 Ga0501224_040714 3300049664 Bacteria 703
699 Ga0501257_042342 3300049686 Bacteria 1120
700 Ga0501261_008120 3300049690 Bacteria 1353
701 Ga0501225_0061400 3300049705 Bacteria 1058
702 Ga0501079_0000543 3300049741 Bacteria 24597
703 Ga0501080_0032950 3300049742 Bacteria 4834
704 Ga0501080_0265243 3300049742 Bacteria 1564
705 Ga0501081_0008524 3300049743 Bacteria 6662
706 Ga0501081_0194603 3300049743 Bacteria 1469
707 Ga0501083_0024960 3300049744 Bacteria 4140
708 Ga0501035_0028358 3300049822 Bacteria 5111
709 Ga0501045_0005220 3300049824 Bacteria 8984
710 nmdc:mga0k408_3583_c1 3300050493 Bacteria 8212
711 nmdc:mga05p37_33797_c1 3300050507 Bacteria 6263
712 nmdc:mga05p37_421163_c1 3300050507 Bacteria 1554
713 nmdc:mga05p37_58990_c1 3300050507 Bacteria 1734
714 nmdc:mga05p37_943_c1 3300050507 Bacteria 32776
715 nmdc:mga09592_15239_c1 3300050508 Bacteria 6281
716 nmdc:mga09592_155345_c1 3300050508 Bacteria 1975
717 nmdc:mga09592_3210_c1 3300050508 Bacteria 13237
718 nmdc:mga0qj67_18756_c1 3300050509 Bacteria 5275
719 nmdc:mga0qj67_3128_c1 3300050509 Bacteria 11912
720 nmdc:mga0qj67_75011_c1 3300050509 Bacteria 2703
721 nmdc:mga0qj67_82921_c1 3300050509 Bacteria 2570
722 nmdc:mga06r32_11414_c1 3300050510 Bacteria 8003
723 nmdc:mga06r32_57440_c1 3300050510 Bacteria 3738
724 nmdc:mga06r32_99738_c1 3300050510 Bacteria 2849
725 nmdc:mga08y16_122333_c1 3300050511 Bacteria 2708
726 nmdc:mga08y16_171982_c1 3300050511 Bacteria 2250
727 nmdc:mga08y16_3900_c1 3300050511 Bacteria 15534
728 nmdc:mga08y16_536824_c1 3300050511 Bacteria 1185
729 nmdc:mga08y16_76746_c1 3300050511 Bacteria 3483
730 nmdc:mga0n895_205218_c1 3300050512 Bacteria 2001
731 nmdc:mga0n895_67555_c1 3300050512 Bacteria 3540
732 nmdc:mga0rr50_135883_c1 3300050513 Bacteria 1973
733 nmdc:mga0rr50_901320_c1 3300050513 Bacteria 754
734 nmdc:mga0a205_170920_c1 3300050515 Bacteria 2069
735 nmdc:mga0a205_393965_c1 3300050515 Bacteria 1249
736 Ga0495601_0017460 3300053077 Bacteria 4356
737 Ga0495595_0010059 3300053084 Bacteria 3924
738 Ga0500566_0173161 3300053094 Bacteria 1114
739 Ga0501084_0020389 3300054114 Bacteria 5528
740 Ga0501084_0412829 3300054114 Bacteria 1141
741 Ga0501082_0004675 3300060353 Bacteria 11939
742 Ga0530510_0008507 3300061734 Bacteria 7158
743 Ga0530510_0058677 3300061734 Bacteria 2783
744 2509077374 2508501114 Bacteria 7082538
745 2513952723 2513237150 Bacteria 6553639
746 2774870861 2773857925 Bacteria 6472445
747 2882459647 2882456835 Bacteria 6863978
748 2894238236 2894232714 Bacteria 8834183
749 Ga0495636_0001714
750 JGI25151J46595_10004933
751 JGI25151J46595_10013212
752 rootH1_10016408
753 Ga0055526_1004904
754 Ga0055537_1007396
755 Ga0055524_1000488
756 Ga0055524_1014861
757 Ga0055534_1009779
758 Ga0055543_1003034
759 Ga0065165_1001096
760 Ga0065707_10230083
761 Ga0065707_10411900
762 Ga0070676_10020325
763 Ga0070676_10042854
764 Ga0070676_10104803
765 Ga0070676_10178454
766 Ga0070676_10211716
767 Ga0070670_100008333
768 Ga0070670_100011888
769 Ga0070670_100020150
770 Ga0070670_100030872
771 Ga0070670_100051779
772 Ga0070670_100060827
773 Ga0070670_100067263
774 Ga0070670_100075371
775 Ga0070670_100083190
776 Ga0070670_100108801
777 Ga0070670_100448899
778 Ga0070670_100681416
779 Ga0070677_10006991
780 Ga0070677_10007083
781 Ga0070677_10040077
782 Ga0070677_10247619
783 Ga0068869_100002178
784 Ga0068869_100058393
785 Ga0068869_100076113
786 Ga0068869_100700067
787 Ga0070666_10065541
788 Ga0070666_10085796
789 Ga0068868_100272653
790 Ga0068868_100950954
791 Ga0070689_100138373
792 Ga0070689_100242503
793 Ga0070687_100049051
794 Ga0070661_100380215
795 Ga0070668_100026162
796 Ga0070668_100035627
797 Ga0070668_100077943
798 Ga0070668_100099331
799 Ga0070669_100014820
800 Ga0070669_100023295
801 Ga0070669_100189103
802 Ga0070669_100227505
803 Ga0070669_100345378
804 Ga0070669_100540450
805 Ga0070669_100721800
806 Ga0070675_100012879
807 Ga0070675_100018673
808 Ga0070675_100032393
809 Ga0070675_100065528
810 Ga0070675_100090876
811 Ga0070675_100114413
812 Ga0070675_100231596
813 Ga0070671_100012717
814 Ga0070671_100034996
815 Ga0070671_100064759
816 Ga0070671_100326416
817 Ga0070674_100064171
818 Ga0070674_100068103
819 Ga0070674_100140238
820 Ga0070674_100226308
821 Ga0070673_100032411
822 Ga0070673_100043445
823 Ga0070673_100044999
824 Ga0070673_100302036
825 Ga0070673_100329521
826 Ga0070673_100357978
827 Ga0070673_100929637
828 Ga0070688_100078715
829 Ga0070667_100020199
830 Ga0070667_100081069
831 Ga0070667_100218705
832 Ga0070705_100144518
833 Ga0070705_100445456
834 Ga0070705_100632121
835 Ga0070700_100064397
836 Ga0070700_100365516
837 Ga0070700_100591378
838 Ga0070700_100637498
839 Ga0070694_100130752
840 Ga0070694_100466119
841 Ga0070694_100596650
842 Ga0070663_100010275
843 Ga0070678_100090119
844 Ga0070678_100279510
845 Ga0070662_100040717
846 Ga0070662_100388999
847 Ga0070662_100489686
848 Ga0070662_100796850
849 Ga0068867_100006012
850 Ga0068867_100013553
851 Ga0068867_100041198
852 Ga0068867_100232271
853 Ga0068867_100263548
854 Ga0068867_100439450
855 Ga0070707_100225709
856 Ga0070707_100743624
857 Ga0070698_100181174
858 Ga0070698_100931184
859 Ga0070699_100110418
860 Ga0070699_100183749
861 Ga0070699_100882601
862 Ga0068853_100507624
863 Ga0070672_100000540
864 Ga0070672_100009288
865 Ga0070672_100043145
866 Ga0070672_100174032
867 Ga0070672_100205009
868 Ga0070672_100334593
869 Ga0070672_100368719
870 Ga0070672_100414047
871 Ga0070672_100423001
872 Ga0070672_101024612
873 Ga0070695_100240407
874 Ga0070695_100304901
875 Ga0070695_100556062
876 Ga0070695_100852803
877 Ga0070696_100001044
878 Ga0070696_100056737
879 Ga0070665_100091732
880 Ga0070665_100594053
881 Ga0070665_101532430
882 Ga0070704_100147600
883 Ga0068855_100537158
884 Ga0070664_100055125
885 Ga0070664_100368724
886 Ga0068857_100240640
887 Ga0068857_100381019
888 Ga0068854_100607739
889 Ga0068854_100824828
890 Ga0068856_100718588
891 Ga0070702_100028514
892 Ga0070702_100128547
893 Ga0068852_100132030
894 Ga0068852_100425084
895 Ga0068852_101019153
896 Ga0068859_100020560
897 Ga0068859_100131151
898 Ga0068859_100163970
899 Ga0068859_100205804
900 Ga0068864_100028449
901 Ga0068864_100040549
902 Ga0068864_100068050
903 Ga0068864_100116049
904 Ga0068864_100275349
905 Ga0068861_100004064
906 Ga0068861_100057970
907 Ga0068861_100124110
908 Ga0068861_100132912
909 Ga0068851_10043711
910 Ga0068870_10009061
911 Ga0068870_10009625
912 Ga0068870_10460453
913 Ga0068863_100038956
914 Ga0068863_100049917
915 Ga0068863_100088615
916 Ga0068863_100150551
917 Ga0068863_100543565
918 Ga0068858_100009653
919 Ga0068858_100022446
920 Ga0068858_100172697
921 Ga0068858_100889369
922 Ga0068860_100004324
923 Ga0068860_100011784
924 Ga0068860_100065290
925 Ga0068862_100059983
926 Ga0068862_100185833
927 Ga0068862_100239407
928 Ga0068862_100324130
929 Ga0068862_100488336
930 Ga0081455_10297775
931 Ga0081539_10000276
932 Ga0075366_10227744
933 Ga0097621_100021030
934 Ga0097621_100055006
935 Ga0097621_100554892
936 Ga0097621_100643896
937 Ga0068871_100039121
938 Ga0068871_100156031
939 Ga0068871_101008107
940 Ga0075428_100008443
941 Ga0075428_100010917
942 Ga0075430_100023225
943 Ga0075430_100098403
944 Ga0075431_100001643
945 Ga0075431_100016863
946 Ga0075431_100017676
947 Ga0075431_100023311
948 Ga0075433_10369878
949 Ga0075434_100409716
950 Ga0075434_100574453
951 Ga0075429_100000575
952 Ga0075429_100027446
953 Ga0075429_100110261
954 Ga0068865_100109169
955 Ga0068865_100124414
956 Ga0068865_100226846
957 Ga0068865_100249651
958 Ga0097620_100020560
959 Ga0097620_100131151
960 Ga0097620_100163971
961 Ga0097620_100205793
962 Ga0099826_10000050
963 Ga0075435_100150556
964 Ga0075435_100318525
965 Ga0099794_10045144
966 Ga0099795_10209901
967 Ga0105251_10024034
968 Ga0105251_10035967
969 Ga0111539_10029178
970 Ga0111539_10128893
971 Ga0111539_10284029
972 Ga0111539_10423801
973 Ga0111539_10892966
974 Ga0111539_11015232
975 Ga0114129_10004402
976 Ga0114129_10201479
977 Ga0114129_10381050
978 Ga0114129_10457371
979 Ga0114129_11468809
980 Ga0105243_10016451
981 Ga0105243_10160742
982 Ga0105243_10456721
983 Ga0105242_10451265
984 Ga0105242_10480889
985 Ga0105248_10063156
986 Ga0105248_10084315
987 Ga0105248_10421304
988 Ga0105249_10180227
989 Ga0099796_10018851
990 Ga0105246_10623737
991 Ga0163162_10002702
992 Ga0163162_10036530
993 Ga0163162_10154913
994 Ga0163162_10296411
995 Ga0163162_10327554
996 Ga0163162_10402744
997 Ga0163162_11215952
998 Ga0163162_11352732
999 Ga0163162_11371647
1000 Ga0157375_10018857
1001 Ga0157375_10026378
1002 Ga0157375_10037174
1003 Ga0157375_10118883
1004 Ga0157375_10123580
1005 Ga0157375_10240890
1006 Ga0157375_10461358
1007 Ga0157375_10594763
1008 Ga0157375_10902058
1009 Ga0163163_10044184
1010 Ga0163163_10126550
1011 Ga0163163_10768296
1012 Ga0157380_10169750
1013 Ga0157380_10306596
1014 Ga0157380_10445338
1015 Ga0157380_10490904
1016 Ga0157380_10685403
1017 Ga0157380_11268171
1018 Ga0157377_10039000
1019 Ga0157377_10120827
1020 Ga0157379_10003195
1021 Ga0157379_10017688
1022 Ga0157379_10156126
1023 Ga0157376_10022178
1024 Ga0157376_10347335
1025 Ga0157376_10669709
1026 Ga0157376_10672134
1027 Ga0163161_10010755
1028 Ga0163161_10020802
1029 Ga0209565_1000346
1030 Ga0209565_1002907
1031 Ga0209130_1000296
1032 Ga0209675_1001409
1033 Ga0209675_1003382
1034 Ga0209025_1001396
1035 Ga0209025_1008607
1036 Ga0209564_1000932
1037 Ga0209758_1007019
1038 Ga0209256_1000196
1039 Ga0209256_1003058
1040 Ga0207426_1029673
1041 Ga0209051_1014927
1042 Ga0207697_10007789
1043 Ga0207697_10146443
1044 Ga0207697_10335457
1045 Ga0207682_10006377
1046 Ga0207682_10007431
1047 Ga0207682_10008718
1048 Ga0207682_10120355
1049 Ga0207682_10189973
1050 Ga0207688_10130453
1051 Ga0207680_10225172
1052 Ga0207680_10257964
1053 Ga0207647_10357885
1054 Ga0207645_10009976
1055 Ga0207645_10089989
1056 Ga0207645_10099646
1057 Ga0207643_10012795
1058 Ga0207643_10028466
1059 Ga0207643_10035482
1060 Ga0207643_10051561
1061 Ga0207684_10033701
1062 Ga0207662_10029538
1063 Ga0207662_10103907
1064 Ga0207662_10105692
1065 Ga0207662_10193022
1066 Ga0207657_10211128
1067 Ga0207649_10252884
1068 Ga0207646_10278809
1069 Ga0207681_10028026
1070 Ga0207681_10078285
1071 Ga0207681_10157941
1072 Ga0207681_10273110
1073 Ga0207681_10417915
1074 Ga0207681_10457120
1075 Ga0207650_10005914
1076 Ga0207650_10006033
1077 Ga0207650_10014339
1078 Ga0207650_10030086
1079 Ga0207650_10031986
1080 Ga0207650_10040549
1081 Ga0207650_10057007
1082 Ga0207650_10067159
1083 Ga0207650_10139808
1084 Ga0207650_10188574
1085 Ga0207650_10205624
1086 Ga0207659_10028214
1087 Ga0207659_10064705
1088 Ga0207659_10084841
1089 Ga0207659_10106422
1090 Ga0207659_10202774
1091 Ga0207659_10763926
1092 Ga0207644_10016531
1093 Ga0207644_10063708
1094 Ga0207644_10152341
1095 Ga0207644_10173770
1096 Ga0207644_10299924
1097 Ga0207706_10029837
1098 Ga0207706_10061685
1099 Ga0207706_10076866
1100 Ga0207706_10300239
1101 Ga0207706_10441902
1102 Ga0207686_10627514
1103 Ga0207686_10635209
1104 Ga0207709_10149388
1105 Ga0207709_10335987
1106 Ga0207670_10040562
1107 Ga0207670_10052317
1108 Ga0207670_10140113
1109 Ga0207670_10182476
1110 Ga0207669_10002726
1111 Ga0207669_10070860
1112 Ga0207669_10356238
1113 Ga0207669_10501184
1114 Ga0207704_10066489
1115 Ga0207704_10161928
1116 Ga0207704_10252002
1117 Ga0207691_10004330
1118 Ga0207691_10006532
1119 Ga0207691_10009304
1120 Ga0207691_10019936
1121 Ga0207691_10022261
1122 Ga0207691_10062371
1123 Ga0207691_10072710
1124 Ga0207691_10075210
1125 Ga0207691_10076896
1126 Ga0207691_10098574
1127 Ga0207691_10157528
1128 Ga0207691_10234775
1129 Ga0207691_10775420
1130 Ga0207711_10043561
1131 Ga0207711_10053837
1132 Ga0207711_10224892
1133 Ga0207711_10305580
1134 Ga0207689_10001032
1135 Ga0207689_10006194
1136 Ga0207689_10051329
1137 Ga0207689_10336646
1138 Ga0207679_10317531
1139 Ga0207679_10356459
1140 Ga0207651_10025568
1141 Ga0207651_10045463
1142 Ga0207651_10106950
1143 Ga0207651_10163552
1144 Ga0207651_10285070
1145 Ga0207651_10447997
1146 Ga0207651_10529346
1147 Ga0207712_10031387
1148 Ga0207712_10397476
1149 Ga0207668_10011971
1150 Ga0207668_10056935
1151 Ga0207668_10106079
1152 Ga0207668_10132909
1153 Ga0207640_10795152
1154 Ga0207658_10010800
1155 Ga0207658_10049443
1156 Ga0207658_10104962
1157 Ga0207658_10335682
1158 Ga0207677_10213585
1159 Ga0207677_10621764
1160 Ga0207703_10003070
1161 Ga0207703_10015618
1162 Ga0207703_10125416
1163 Ga0207678_10119540
1164 Ga0207708_10078024
1165 Ga0207708_10287563
1166 Ga0207708_10309265
1167 Ga0207708_10422563
1168 Ga0207702_10997458
1169 Ga0207641_10031198
1170 Ga0207641_10039914
1171 Ga0207641_10042452
1172 Ga0207641_10178268
1173 Ga0207641_10189176
1174 Ga0207648_10026765
1175 Ga0207648_10041339
1176 Ga0207648_10041579
1177 Ga0207648_10071563
1178 Ga0207648_10188873
1179 Ga0207648_10247497
1180 Ga0207648_10354254
1181 Ga0207648_10646788
1182 Ga0207648_10755684
1183 Ga0207676_10006515
1184 Ga0207676_10027646
1185 Ga0207676_10044168
1186 Ga0207676_10057541
1187 Ga0207676_10103998
1188 Ga0207676_10485487
1189 Ga0207676_11252479
1190 Ga0207674_10042229
1191 Ga0207674_10156505
1192 Ga0207674_10893035
1193 Ga0207675_100001734
1194 Ga0207675_100026924
1195 Ga0207675_100070121
1196 Ga0207675_100089239
1197 Ga0207675_100298544
1198 Ga0207683_10079952
1199 Ga0207683_10115855
1200 Ga0207683_10181247
1201 Ga0207683_10692254
1202 Ga0207683_10736715
1203 Ga0207683_10931201
1204 Ga0207698_10148571
1205 Ga0207698_10376696
1206 Ga0209179_1000830
1207 Ga0209282_1000079
1208 Ga0209974_10029203
1209 Ga0207428_10005129
1210 Ga0207428_10449289
1211 Ga0268266_10078676
1212 Ga0268266_10509871
1213 Ga0268266_10713190
1214 Ga0268266_11227826
1215 Ga0268266_11386570
1216 Ga0268265_10105987
1217 Ga0268265_10149309
1218 Ga0268265_10278290
1219 Ga0268265_10421343
1220 Ga0268265_10873500
1221 Ga0268264_10003336
1222 Ga0268264_10005452
1223 Ga0268264_10195688
1224 Ga0307513_10096663
1225 Ga0307408_100047542
1226 Ga0307408_100425807
1227 Ga0307408_100644482
1228 Ga0307405_10010014
1229 Ga0307405_10050433
1230 Ga0307405_10097278
1231 Ga0307413_10120685
1232 Ga0307410_10197448
1233 Ga0307406_10001223
1234 Ga0307406_10158551
1235 Ga0307412_10071126
1236 Ga0307409_100000872
1237 Ga0307409_100014209
1238 Ga0307409_100319463
1239 Ga0307409_100690332
1240 Ga0307416_100001672
1241 Ga0307416_100160629
1242 Ga0307416_101222943
1243 Ga0307414_10040016
1244 Ga0307411_10002288
1245 Ga0307411_10175715
1246 Ga0307411_10311042
1247 Ga0307415_100001472
1248 Ga0307415_100003873
1249 Ga0373948_0012952
1250 Ga0373958_0011873
1251 Ga0373926_0069754
1252 Ga0373934_0015476
1253 Ga0373940_0015661
1254 Ga0373944_0003090
1255 Ga0373944_0104847
1256 Ga0373923_0006243
1257 Ga0373936_0005213
1258 Ga0373953_0099438
1259 Ga0373954_0004632
1260 Ga0373956_0006596
1261 Ga0373956_0016923
1262 Ga0373957_0109263
1263 Ga0373957_0189684
1264 Ga0373943_0002310
1265 Ga0373943_0175020
1266 Ga0373946_0428040
1267 Ga0373955_0027102
1268 Ga0373942_0022695
1269 Ga0373931_0002786
1270 Ga0373935_0021868
1271 Ga0373927_0288240
1272 Ga0373933_0014538
1273 Ga0373933_0019319
1274 Ga0373933_0350813
1275 Ga0373947_0011211
1276 Ga0373937_0013947
1277 Ga0373937_0022454
1278 Ga0373937_0037623
1279 Ga0373937_0124023
1280 Ga0373925_0015904
1281 Ga0373925_0020435
1282 Ga0373925_0691236
1283 Ga0451807_2741024
1284 Ga0439452_017049
1285 Ga0451577_0048471
1286 Ga0451577_0170523
1287 Ga0451577_0460418
1288 Ga0451577_0490983
1289 Ga0453683_0032126
1290 Ga0453684_0171134
1291 Ga0453684_0869798
1292 Ga0453684_1419961
1293 Ga0451576_0000239
1294 Ga0451576_0019510
1295 Ga0451576_0157899
1296 Ga0451576_0680273
1297 Ga0495592_0005206
1298 Ga0495629_0474735
1299 Ga0495638_0004071
1300 Ga0495641_0026460
1301 Ga0495641_0055967
1302 Ga0495653_0004510
1303 Ga0495653_0267541
1304 Ga0495650_0065331
1305 Ga0495580_0158248
1306 Ga0495580_0178510
1307 Ga0495580_0322692
1308 Ga0495582_0040901
1309 Ga0495605_0000921
1310 Ga0495605_0005211
1311 Ga0495639_0010559
1312 Ga0495664_0002776
1313 Ga0495664_0270408
1314 Ga0495584_0139931
1315 Ga0495594_0062725
1316 Ga0495594_0202661
1317 Ga0495596_0004018
1318 Ga0495607_0052692
1319 Ga0495583_0063207
1320 Ga0495606_0185122
1321 Ga0495608_0000582
1322 Ga0495608_0019213
1323 Ga0495608_0108931
1324 Ga0495610_0022214
1325 Ga0495610_0231655
1326 Ga0495618_0032348
1327 Ga0495618_0046498
1328 Ga0495628_0001020
1329 Ga0495630_0010808
1330 Ga0495630_0033128
1331 Ga0495630_0044319
1332 Ga0495631_0137930
1333 Ga0495644_0037345
1334 Ga0495648_0061052
1335 Ga0495648_0118492
1336 Ga0495666_0007331
1337 Ga0495642_0044153
1338 Ga0495652_0014404
1339 Ga0495640_0013142
1340 Ga0495640_0073677
1341 Ga0495586_0001549
1342 Ga0495586_0026322
1343 Ga0495586_0040026
1344 Ga0495586_0048246
1345 Ga0495587_0026809
1346 Ga0495598_0162315
1347 Ga0495609_0023481
1348 Ga0495597_0087768
1349 Ga0495597_0121168
1350 Ga0495645_0112012
1351 Ga0495667_0005737
1352 Ga0495667_0072056
1353 Ga0495667_0348588
1354 Ga0495667_0351816
1355 Ga0495668_0000120
1356 Ga0495634_0003915
1357 Ga0495634_0290850
1358 Ga0495634_0329610
1359 Ga0495634_0399640
1360 Ga0495635_0016219
1361 Ga0495661_0010743
1362 Ga0495588_0295780
1363 Ga0495599_0018862
1364 Ga0495646_0064031
1365 Ga0495658_0025628
1366 Ga0495658_0031129
1367 Ga0495669_0061034
1368 Ga0495669_0194318
1369 Ga0495669_0311045
1370 Ga0495613_0007761
1371 Ga0495624_0127462
1372 Ga0495624_0154582
1373 Ga0495670_0109296
1374 Ga0495671_0028319
1375 Ga0495671_0029039
1376 Ga0495649_0020198
1377 Ga0495589_0000657
1378 Ga0495600_0002875
1379 Ga0495600_0012270
1380 Ga0495581_0038561
1381 Ga0495604_0009170
1382 Ga0495604_0055202
1383 Ga0495636_0061419
1384 Ga0495636_0204350
1385 Ga0495674_0001667
1386 Ga0495674_0303906
1387 Ga0495672_0018295
1388 Ga0495672_0102947
1389 Ga0495680_0003120
1390 Ga0495685_055446
1391 Ga0495685_073157
1392 Ga0495684_0011259
1393 Ga0495684_0055345
1394 Ga0495686_0003241
1395 Ga0495686_0216970
1396 Ga0495593_0097713
1397 Ga0496100_0426663
1398 Ga0496102_0115196
1399 Ga0496102_0221616
1400 Ga0496104_0318522
1401 Ga0496106_0000011
1402 Ga0496106_0131797
1403 Ga0496107_0120344
1404 Ga0496109_0641900
1405 Ga0496114_0268547
1406 Ga0496115_0329812
1407 Ga0496116_0048230
1408 Ga0496116_0250783
1409 Ga0496121_0008623
1410 Ga0496121_0014332
1411 Ga0496122_0108360
1412 Ga0496123_0036006
1413 Ga0496124_0091245
1414 Ga0501033_0025541
1415 Ga0501034_0043764
1416 Ga0501034_0232999
1417 Ga0501036_0009459
1418 Ga0501037_0030635
1419 Ga0501038_0029012
1420 Ga0501038_0247647
1421 Ga0501039_0000137
1422 Ga0501039_0106242
1423 Ga0501040_0012247
1424 Ga0501041_0000864
1425 Ga0501041_0004312
1426 Ga0501042_0011178
1427 Ga0501043_0004207
1428 Ga0501046_0007474
1429 Ga0501048_0015206
1430 Ga0501068_0036541
1431 Ga0501071_0001821
1432 Ga0501071_0336747
1433 Ga0501071_0766277
1434 Ga0501072_0008308
1435 Ga0501072_0149124
1436 Ga0501072_0273748
1437 Ga0501073_0054345
1438 Ga0501074_0008222
1439 Ga0501075_0001079
1440 Ga0501075_0167570
1441 Ga0501076_0002377
1442 Ga0501077_0002690
1443 Ga0501202_009848
1444 Ga0501216_028128
1445 Ga0501222_042516
1446 Ga0501224_040714
1447 Ga0501257_042342
1448 Ga0501261_008120
1449 Ga0501225_0061400
1450 Ga0501079_0000543
1451 Ga0501080_0032950
1452 Ga0501080_0265243
1453 Ga0501081_0008524
1454 Ga0501081_0194603
1455 Ga0501083_0024960
1456 Ga0501035_0028358
1457 Ga0501045_0005220
1458 nmdc:mga0k408_3583_c1
1459 nmdc:mga05p37_33797_c1
1460 nmdc:mga05p37_421163_c1
1461 nmdc:mga05p37_58990_c1
1462 nmdc:mga05p37_943_c1
1463 nmdc:mga09592_15239_c1
1464 nmdc:mga09592_155345_c1
1465 nmdc:mga09592_3210_c1
1466 nmdc:mga0qj67_18756_c1
1467 nmdc:mga0qj67_3128_c1
1468 nmdc:mga0qj67_75011_c1
1469 nmdc:mga0qj67_82921_c1
1470 nmdc:mga06r32_11414_c1
1471 nmdc:mga06r32_57440_c1
1472 nmdc:mga06r32_99738_c1
1473 nmdc:mga08y16_122333_c1
1474 nmdc:mga08y16_171982_c1
1475 nmdc:mga08y16_3900_c1
1476 nmdc:mga08y16_536824_c1
1477 nmdc:mga08y16_76746_c1
1478 nmdc:mga0n895_205218_c1
1479 nmdc:mga0n895_67555_c1
1480 nmdc:mga0rr50_135883_c1
1481 nmdc:mga0rr50_901320_c1
1482 nmdc:mga0a205_170920_c1
1483 nmdc:mga0a205_393965_c1
1484 Ga0495601_0017460
1485 Ga0495595_0010059
1486 Ga0500566_0173161
1487 Ga0501084_0020389
1488 Ga0501084_0412829
1489 Ga0501082_0004675
1490 Ga0530510_0008507
1491 Ga0530510_0058677
1492 2509077374
1493 2513952723
1494 2774870861
1495 2882459647
1496 2894238236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

50

137

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.781 11 160
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7408 11 160
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.674 13 187
6tmh-assembly1.cif.gz_N cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.5801 84 164
6tmh-assembly1.cif.gz_N cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model 0.5574 84 164
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7324 27 160 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7184 27 160 1.20.120.550
af_Q7XQN2_1_124_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.55 2 154 1.20.120.20
af_A0A2R8QSC2_1_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4835 47 166 1.20.140.150
af_Q7XQN2_1_124_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.4697 2 154 1.20.120.20
ID Description Score Start End GO Terms
AF-A0A519FSQ0-F1-model_v4 deleted 0.9319 1 170
AF-A0A519FSQ0-F1-model_v4 deleted 0.9267 1 170
AF-A0A450ZDI5-F1-model_v4 TRAP transporter small permease protein 0.9204 3 163 GO:0005886
GO:0022857
AF-A0A3N5HFQ2-F1-model_v4 TRAP transporter small permease subunit 0.9132 3 163 GO:0005886
AF-A0A839AEY1-F1-model_v4 TRAP transporter small permease protein 0.9127 1 163 GO:0005886
GO:0022857

Map