F478899

General Info

Members Datasets Scaffolds Average Seq Length
746 357 746 165

Family's Representative Sequence

Representative Sequence 3300059503|Ga0587080_045216|Ga0587080_045216_229_795
Length 188
Sequence MRAAVLAPPPVAALAKGRSTVIKGLHHNAYRCRDSEETRRFYEGFLGLPLVNALRIKESMTGRRTDVLHTFYQMDDGSCLAFFEAPDRPFDFKDQHDYDLHIALEVDYETLKRMFEKGKAEGREVRGISDHRFIHSIYFRDPNGYVIELTAKVAGHERDMDPTANHARDILNRWQVHKRKAHADAAAS

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
202 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
243 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
244 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
245 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
267 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
268 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
269 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
270 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
295 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
296 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
342 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 2.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 3.08
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3151609 2162886006 Bacteria 1479
2 rootH1_10075528 3300003323 Bacteria 1816
3 Ga0065715_10164226 3300005293 Bacteria 1601
4 Ga0070658_10008608 3300005327 Bacteria 8204
5 Ga0070676_10021860 3300005328 Bacteria 3583
6 Ga0070683_100011148 3300005329 Bacteria 7755
7 Ga0070683_100478517 3300005329 Bacteria 1189
8 Ga0070683_100676024 3300005329 Bacteria 989
9 Ga0070690_100402429 3300005330 Bacteria 1006
10 Ga0070690_100760030 3300005330 Bacteria 749
11 Ga0070670_100001648 3300005331 Bacteria 18088
12 Ga0070670_100004471 3300005331 Bacteria 11710
13 Ga0070677_10158455 3300005333 Bacteria 1060
14 Ga0068869_100054630 3300005334 Bacteria 2908
15 Ga0068869_100156996 3300005334 Bacteria 1768
16 Ga0068869_100360526 3300005334 Unclassified 1187
17 Ga0070666_10005247 3300005335 Bacteria 7938
18 Ga0070666_10437788 3300005335 Bacteria 943
19 Ga0070680_100008942 3300005336 Bacteria 7679
20 Ga0070680_100054427 3300005336 Bacteria 3268
21 Ga0070682_100256385 3300005337 Unclassified 1264
22 Ga0068868_100034757 3300005338 Bacteria 3893
23 Ga0068868_100070854 3300005338 Bacteria 2780
24 Ga0068868_100090667 3300005338 Bacteria 2462
25 Ga0068868_101594796 3300005338 Unclassified 613
26 Ga0070689_100000001 3300005340 Bacteria 1334580
27 Ga0070689_100190659 3300005340 Bacteria 1669
28 Ga0070689_100317734 3300005340 Bacteria 1300
29 Ga0070689_100348852 3300005340 Bacteria 1241
30 Ga0070687_100258947 3300005343 Bacteria 1085
31 Ga0070661_100264486 3300005344 Bacteria 1330
32 Ga0070661_100653090 3300005344 Bacteria 854
33 Ga0070692_10218759 3300005345 Bacteria 1125
34 Ga0070668_100076494 3300005347 Bacteria 2615
35 Ga0070668_100568488 3300005347 Bacteria 988
36 Ga0070669_100021986 3300005353 Bacteria 4561
37 Ga0070669_100167790 3300005353 Bacteria 1710
38 Ga0070675_100012952 3300005354 Bacteria 6546
39 Ga0070671_100052255 3300005355 Bacteria 3398
40 Ga0070671_100168887 3300005355 Bacteria 1850
41 Ga0070674_100005400 3300005356 Bacteria 7377
42 Ga0070674_100013861 3300005356 Bacteria 4994
43 Ga0070674_100082001 3300005356 Bacteria 2306
44 Ga0070673_100027600 3300005364 Bacteria 4210
45 Ga0070673_100043909 3300005364 Bacteria 3458
46 Ga0070673_100167299 3300005364 Bacteria 1874
47 Ga0070673_101180202 3300005364 Bacteria 717
48 Ga0070688_100007711 3300005365 Bacteria 5812
49 Ga0070688_100099785 3300005365 Bacteria 1912
50 Ga0070688_100151679 3300005365 Bacteria 1585
51 Ga0070659_100015338 3300005366 Bacteria 5738
52 Ga0070659_100281287 3300005366 Bacteria 1384
53 Ga0070659_100441060 3300005366 Unclassified 1103
54 Ga0070659_100985038 3300005366 Bacteria 740
55 Ga0070667_100020332 3300005367 Bacteria 5511
56 Ga0070667_100045960 3300005367 Bacteria 3672
57 Ga0070667_100630537 3300005367 Bacteria 989
58 Ga0070709_10151533 3300005434 Unclassified 1603
59 Ga0070709_10256229 3300005434 Unclassified 1262
60 Ga0070713_100017271 3300005436 Bacteria 5453
61 Ga0070710_10027580 3300005437 Bacteria 3030
62 Ga0070710_10729193 3300005437 Bacteria 702
63 Ga0070701_10122702 3300005438 Unclassified 1466
64 Ga0070711_100008755 3300005439 Bacteria 6210
65 Ga0070711_100247380 3300005439 Bacteria 1397
66 Ga0070705_100009497 3300005440 Bacteria 4838
67 Ga0070705_100304261 3300005440 Bacteria 1144
68 Ga0070705_100388048 3300005440 Unclassified 1030
69 Ga0070705_100606499 3300005440 Bacteria 848
70 Ga0070700_100074201 3300005441 Bacteria 2179
71 Ga0070700_100081740 3300005441 Bacteria 2088
72 Ga0070700_100114080 3300005441 Bacteria 1801
73 Ga0070694_100594094 3300005444 Bacteria 891
74 Ga0070708_100071466 3300005445 Bacteria 3124
75 Ga0070663_100027987 3300005455 Bacteria 3833
76 Ga0070663_100337405 3300005455 Bacteria 1217
77 Ga0070662_100043586 3300005457 Unclassified 3211
78 Ga0070662_101227184 3300005457 Bacteria 645
79 Ga0070681_10112230 3300005458 Bacteria 2665
80 Ga0070681_10135171 3300005458 Bacteria 2397
81 Ga0068867_100009475 3300005459 Bacteria 6867
82 Ga0068867_100100538 3300005459 Unclassified 2208
83 Ga0068867_100405712 3300005459 Bacteria 1151
84 Ga0068867_101249573 3300005459 Bacteria 684
85 Ga0070685_10008871 3300005466 Bacteria 5185
86 Ga0070685_10585130 3300005466 Bacteria 801
87 Ga0070706_100023816 3300005467 Bacteria 5637
88 Ga0070706_100335196 3300005467 Bacteria 1410
89 Ga0070707_100012864 3300005468 Bacteria 7815
90 Ga0070707_100034532 3300005468 Bacteria 4824
91 Ga0070707_100473545 3300005468 Bacteria 1214
92 Ga0070698_100104741 3300005471 Bacteria 2798
93 Ga0070698_100385728 3300005471 Bacteria 1334
94 Ga0070698_100400351 3300005471 Bacteria 1306
95 Ga0070699_100035398 3300005518 Bacteria 4316
96 Ga0070679_100008815 3300005530 Bacteria 9516
97 Ga0070679_100159253 3300005530 Bacteria 2232
98 Ga0070679_100379975 3300005530 Bacteria 1359
99 Ga0070679_101262591 3300005530 Bacteria 684
100 Ga0070684_100244053 3300005535 Bacteria 1641
101 Ga0070684_100342925 3300005535 Bacteria 1374
102 Ga0070684_100372397 3300005535 Unclassified 1315
103 Ga0070684_101128391 3300005535 Bacteria 737
104 Ga0070697_100196093 3300005536 Bacteria 1715
105 Ga0070697_101101454 3300005536 Bacteria 707
106 Ga0068853_100009346 3300005539 Bacteria 7903
107 Ga0068853_100103460 3300005539 Bacteria 2520
108 Ga0068853_100116101 3300005539 Bacteria 2383
109 Ga0068853_100704304 3300005539 Bacteria 963
110 Ga0070672_100097994 3300005543 Bacteria 2374
111 Ga0070672_100280352 3300005543 Bacteria 1409
112 Ga0070686_100231182 3300005544 Unclassified 1341
113 Ga0070686_100400329 3300005544 Bacteria 1044
114 Ga0070686_100779429 3300005544 Bacteria 769
115 Ga0070695_100057718 3300005545 Bacteria 2508
116 Ga0070695_100059955 3300005545 Bacteria 2466
117 Ga0070695_100069841 3300005545 Bacteria 2296
118 Ga0070696_100549765 3300005546 Bacteria 925
119 Ga0070696_100983667 3300005546 Bacteria 704
120 Ga0070696_101025179 3300005546 Bacteria 690
121 Ga0070693_100010214 3300005547 Bacteria 4696
122 Ga0070693_100098545 3300005547 Bacteria 1776
123 Ga0070693_100165341 3300005547 Bacteria 1413
124 Ga0070693_100378553 3300005547 Bacteria 976
125 Ga0070665_100433940 3300005548 Bacteria 1323
126 Ga0070704_100052785 3300005549 Bacteria 2870
127 Ga0070704_100097687 3300005549 Bacteria 2205
128 Ga0070704_100225977 3300005549 Bacteria 1524
129 Ga0070704_100826432 3300005549 Archaea 829
130 Ga0068855_100029744 3300005563 Bacteria 6532
131 Ga0068855_100119530 3300005563 Bacteria 3017
132 Ga0068855_100131875 3300005563 Bacteria 2853
133 Ga0068855_100160365 3300005563 Bacteria 2553
134 Ga0070664_100073970 3300005564 Bacteria 2924
135 Ga0070664_100811992 3300005564 Bacteria 875
136 Ga0068857_100010399 3300005577 Bacteria 8086
137 Ga0068857_100444337 3300005577 Bacteria 1212
138 Ga0068857_100795241 3300005577 Bacteria 903
139 Ga0068857_101581863 3300005577 Bacteria 640
140 Ga0068854_100024272 3300005578 Bacteria 4149
141 Ga0068854_100584982 3300005578 Bacteria 951
142 Ga0068856_100067551 3300005614 Bacteria 3533
143 Ga0068856_100490020 3300005614 Bacteria 1250
144 Ga0068856_100762411 3300005614 Bacteria 988
145 Ga0068856_101442375 3300005614 Bacteria 702
146 Ga0070702_100004222 3300005615 Bacteria 6539
147 Ga0070702_100063146 3300005615 Unclassified 2161
148 Ga0070702_100104733 3300005615 Bacteria 1742
149 Ga0070702_100931185 3300005615 Bacteria 683
150 Ga0068852_100775206 3300005616 Bacteria 972
151 Ga0068852_101620937 3300005616 Bacteria 670
152 Ga0068859_100001347 3300005617 Bacteria 25058
153 Ga0068859_100009108 3300005617 Bacteria 10023
154 Ga0068859_100016297 3300005617 Bacteria 7466
155 Ga0068859_100016980 3300005617 Bacteria 7306
156 Ga0068859_100063206 3300005617 Bacteria 3732
157 Ga0068859_100076147 3300005617 Bacteria 3396
158 Ga0068859_100498096 3300005617 Bacteria 1313
159 Ga0068859_101280555 3300005617 Bacteria 808
160 Ga0068864_100000918 3300005618 Bacteria 24714
161 Ga0068864_100001786 3300005618 Bacteria 17662
162 Ga0068864_100002127 3300005618 Bacteria 16380
163 Ga0068864_100483635 3300005618 Bacteria 1189
164 Ga0068866_10011885 3300005718 Bacteria 3782
165 Ga0068866_10034994 3300005718 Bacteria 2450
166 Ga0068861_100002626 3300005719 Bacteria 11748
167 Ga0068861_100032259 3300005719 Bacteria 3855
168 Ga0068861_100279582 3300005719 Bacteria 1437
169 Ga0068870_10035490 3300005840 Bacteria 2559
170 Ga0068863_100039160 3300005841 Bacteria 4510
171 Ga0068863_100071294 3300005841 Bacteria 3287
172 Ga0068863_100274601 3300005841 Bacteria 1632
173 Ga0068863_100797441 3300005841 Bacteria 942
174 Ga0068858_100000924 3300005842 Bacteria 30445
175 Ga0068858_100005298 3300005842 Bacteria 12648
176 Ga0068858_100071185 3300005842 Bacteria 3225
177 Ga0068858_100708678 3300005842 Bacteria 980
178 Ga0068858_101058701 3300005842 Bacteria 796
179 Ga0068860_100006411 3300005843 Bacteria 11811
180 Ga0068860_100056397 3300005843 Bacteria 3735
181 Ga0068860_100077578 3300005843 Bacteria 3159
182 Ga0068860_101090758 3300005843 Bacteria 818
183 Ga0068862_100108368 3300005844 Bacteria 2436
184 Ga0068862_100244201 3300005844 Bacteria 1634
185 Ga0068862_100486305 3300005844 Bacteria 1169
186 Ga0068862_100850609 3300005844 Bacteria 894
187 Ga0068862_101649774 3300005844 Bacteria 649
188 Ga0081455_10051004 3300005937 Bacteria 3552
189 Ga0081538_10026343 3300005981 Bacteria 4068
190 Ga0081539_10077478 3300005985 Bacteria 1758
191 Ga0070716_100009552 3300006173 Bacteria 4836
192 Ga0070716_100564865 3300006173 Unclassified 850
193 Ga0070712_100017504 3300006175 Bacteria 4640
194 Ga0070712_100102871 3300006175 Bacteria 2116
195 Ga0075366_10185611 3300006195 Bacteria 1263
196 Ga0097621_100029079 3300006237 Bacteria 4362
197 Ga0097621_100087682 3300006237 Bacteria 2599
198 Ga0097621_100281678 3300006237 Unclassified 1463
199 Ga0097621_100558056 3300006237 Bacteria 1043
200 Ga0068871_100101076 3300006358 Unclassified 2416
201 Ga0068871_100106556 3300006358 Bacteria 2353
202 Ga0068871_100208550 3300006358 Bacteria 1689
203 Ga0068871_101462686 3300006358 Bacteria 645
204 Ga0075428_100024555 3300006844 Bacteria 6669
205 Ga0075430_100139328 3300006846 Bacteria 2020
206 Ga0075431_100149430 3300006847 Bacteria 2406
207 Ga0075431_100215328 3300006847 Bacteria 1961
208 Ga0075431_100449419 3300006847 Bacteria 1284
209 Ga0075433_10255373 3300006852 Bacteria 1555
210 Ga0075434_100048545 3300006871 Bacteria 4212
211 Ga0075434_100335790 3300006871 Bacteria 1532
212 Ga0075434_100632506 3300006871 Bacteria 1089
213 Ga0075429_100005681 3300006880 Bacteria 10755
214 Ga0075429_100028299 3300006880 Bacteria 4867
215 Ga0068865_100021637 3300006881 Bacteria 4185
216 Ga0068865_100032117 3300006881 Bacteria 3505
217 Ga0068865_100240758 3300006881 Bacteria 1423
218 Ga0075436_100295790 3300006914 Bacteria 1160
219 Ga0097620_100001347 3300006931 Bacteria 25058
220 Ga0097620_100009108 3300006931 Bacteria 10023
221 Ga0097620_100016298 3300006931 Bacteria 7466
222 Ga0097620_100016978 3300006931 Bacteria 7306
223 Ga0097620_100063209 3300006931 Bacteria 3732
224 Ga0097620_100076149 3300006931 Bacteria 3396
225 Ga0097620_100498100 3300006931 Bacteria 1313
226 Ga0075435_100398110 3300007076 Bacteria 1184
227 Ga0105240_10000262 3300009093 Bacteria 104268
228 Ga0105240_10064488 3300009093 Bacteria 4551
229 Ga0105240_10074462 3300009093 Bacteria 4191
230 Ga0105240_10322796 3300009093 Bacteria 1759
231 Ga0105240_10960933 3300009093 Bacteria 916
232 Ga0111539_10001915 3300009094 Bacteria 27718
233 Ga0111539_10008405 3300009094 Bacteria 13136
234 Ga0111539_10202553 3300009094 Bacteria 2314
235 Ga0111539_10226885 3300009094 Bacteria 2175
236 Ga0111539_10272125 3300009094 Bacteria 1971
237 Ga0111539_10277642 3300009094 Bacteria 1950
238 Ga0111539_11890469 3300009094 Bacteria 692
239 Ga0111539_12127390 3300009094 Bacteria 651
240 Ga0105245_10001111 3300009098 Bacteria 24332
241 Ga0105245_10203801 3300009098 Bacteria 1901
242 Ga0105245_10220818 3300009098 Bacteria 1828
243 Ga0105245_10319309 3300009098 Bacteria 1529
244 Ga0105247_10062341 3300009101 Bacteria 2313
245 Ga0105247_10519944 3300009101 Bacteria 870
246 Ga0105247_10892238 3300009101 Bacteria 686
247 Ga0114129_10306609 3300009147 Bacteria 2115
248 Ga0114129_10536455 3300009147 Bacteria 1523
249 Ga0105243_10187232 3300009148 Bacteria 1805
250 Ga0105243_12145826 3300009148 Bacteria 595
251 Ga0105241_10123324 3300009174 Bacteria 2089
252 Ga0105241_10317902 3300009174 Bacteria 1341
253 Ga0105241_10860204 3300009174 Unclassified 839
254 Ga0105242_10005080 3300009176 Bacteria 10163
255 Ga0105242_10238437 3300009176 Bacteria 1634
256 Ga0105242_11513231 3300009176 Bacteria 702
257 Ga0105242_12504600 3300009176 Bacteria 564
258 Ga0105248_10044422 3300009177 Bacteria 4982
259 Ga0105248_10686561 3300009177 Bacteria 1155
260 Ga0105248_11165236 3300009177 Unclassified 871
261 Ga0105237_10000050 3300009545 Bacteria 160580
262 Ga0105237_10218975 3300009545 Bacteria 1904
263 Ga0105237_10226871 3300009545 Bacteria 1868
264 Ga0105238_10006468 3300009551 Bacteria 11653
265 Ga0105238_10048067 3300009551 Bacteria 4300
266 Ga0105238_10195374 3300009551 Bacteria 1999
267 Ga0105238_10238650 3300009551 Bacteria 1795
268 Ga0105238_10367873 3300009551 Unclassified 1428
269 Ga0105249_10063930 3300009553 Bacteria 3382
270 Ga0105249_10232752 3300009553 Bacteria 1818
271 Ga0105249_10950003 3300009553 Bacteria 927
272 Ga0105249_11055910 3300009553 Bacteria 882
273 Ga0105239_11421605 3300010375 Unclassified 801
274 Ga0105246_10210366 3300011119 Unclassified 1518
275 Ga0105246_11039353 3300011119 Bacteria 744
276 Ga0157373_10184595 3300013100 Bacteria 1469
277 Ga0157371_10066746 3300013102 Bacteria 2547
278 Ga0157370_10354958 3300013104 Bacteria 1351
279 Ga0157369_10036715 3300013105 Bacteria 5367
280 Ga0157374_10006996 3300013296 Bacteria 9603
281 Ga0157374_10120474 3300013296 Bacteria 2532
282 Ga0157374_10198327 3300013296 Bacteria 1965
283 Ga0157378_10009382 3300013297 Bacteria 8525
284 Ga0157378_10298084 3300013297 Bacteria 1559
285 Ga0157378_10452792 3300013297 Bacteria 1274
286 Ga0163162_11671577 3300013306 Bacteria 727
287 Ga0157372_10284909 3300013307 Bacteria 1921
288 Ga0157375_10040858 3300013308 Bacteria 4474
289 Ga0157375_10347676 3300013308 Unclassified 1648
290 Ga0157375_10740154 3300013308 Bacteria 1135
291 Ga0163163_10009374 3300014325 Bacteria 8738
292 Ga0163163_10020582 3300014325 Bacteria 6216
293 Ga0163163_10051526 3300014325 Bacteria 4059
294 Ga0163163_10577761 3300014325 Unclassified 1187
295 Ga0157380_10047719 3300014326 Bacteria 3369
296 Ga0157380_10052814 3300014326 Bacteria 3219
297 Ga0157380_10400827 3300014326 Bacteria 1302
298 Ga0157380_11624197 3300014326 Bacteria 702
299 Ga0157377_10453072 3300014745 Bacteria 886
300 Ga0157379_10004817 3300014968 Bacteria 11596
301 Ga0157379_10258098 3300014968 Bacteria 1583
302 Ga0157376_10382483 3300014969 Unclassified 1356
303 Ga0157376_11569476 3300014969 Bacteria 692
304 Ga0163161_10382436 3300017792 Bacteria 1125
305 Ga0163161_10610016 3300017792 Bacteria 900
306 Ga0206356_10789639 3300020070 Bacteria 1046
307 Ga0206352_10103059 3300020078 Bacteria 883
308 Ga0206350_10936070 3300020080 Bacteria 793
309 Ga0206350_11280726 3300020080 Bacteria 755
310 Ga0206354_10692315 3300020081 Bacteria 904
311 Ga0206353_11834576 3300020082 Bacteria 1121
312 Ga0154015_1046432 3300020610 Bacteria 690
313 Ga0213873_10160452 3300021358 Bacteria 681
314 Ga0213871_10001206 3300021441 Bacteria 4179
315 Ga0224712_10270614 3300022467 Bacteria 789
316 Ga0207697_10366283 3300025315 Bacteria 640
317 Ga0207692_10082197 3300025898 Bacteria 1725
318 Ga0207642_10173920 3300025899 Bacteria 1167
319 Ga0207642_10224331 3300025899 Bacteria 1052
320 Ga0207642_10587705 3300025899 Bacteria 692
321 Ga0207710_10015110 3300025900 Bacteria 3260
322 Ga0207688_10233703 3300025901 Bacteria 1110
323 Ga0207688_10568588 3300025901 Bacteria 713
324 Ga0207680_10023548 3300025903 Bacteria 3365
325 Ga0207680_10087485 3300025903 Unclassified 1973
326 Ga0207680_10261756 3300025903 Bacteria 1197
327 Ga0207685_10013464 3300025905 Bacteria 2531
328 Ga0207699_10019156 3300025906 Bacteria 3643
329 Ga0207699_10079175 3300025906 Bacteria 2032
330 Ga0207645_10019696 3300025907 Bacteria 4422
331 Ga0207645_10889148 3300025907 Unclassified 605
332 Ga0207643_10040021 3300025908 Bacteria 2638
333 Ga0207705_10020349 3300025909 Bacteria 4744
334 Ga0207705_10675545 3300025909 Bacteria 803
335 Ga0207684_10020818 3300025910 Bacteria 5603
336 Ga0207684_10166713 3300025910 Bacteria 1898
337 Ga0207654_10004656 3300025911 Bacteria 6935
338 Ga0207654_10258994 3300025911 Bacteria 1169
339 Ga0207707_10192067 3300025912 Bacteria 1781
340 Ga0207707_10243331 3300025912 Bacteria 1563
341 Ga0207707_10273001 3300025912 Bacteria 1465
342 Ga0207695_10003817 3300025913 Bacteria 20883
343 Ga0207695_10149233 3300025913 Bacteria 2278
344 Ga0207695_10181541 3300025913 Bacteria 2025
345 Ga0207695_10913973 3300025913 Bacteria 757
346 Ga0207671_10019884 3300025914 Bacteria 5124
347 Ga0207693_10026174 3300025915 Bacteria 4619
348 Ga0207693_10101821 3300025915 Bacteria 2252
349 Ga0207663_10074486 3300025916 Bacteria 2200
350 Ga0207660_10154413 3300025917 Bacteria 1766
351 Ga0207657_10012272 3300025919 Bacteria 8465
352 Ga0207649_10142508 3300025920 Bacteria 1642
353 Ga0207649_10640605 3300025920 Bacteria 820
354 Ga0207649_11197673 3300025920 Unclassified 600
355 Ga0207652_10015622 3300025921 Bacteria 6179
356 Ga0207652_10020675 3300025921 Bacteria 5425
357 Ga0207652_10167925 3300025921 Bacteria 1968
358 Ga0207652_10442788 3300025921 Bacteria 1171
359 Ga0207646_10121417 3300025922 Bacteria 2347
360 Ga0207681_10140706 3300025923 Bacteria 1796
361 Ga0207681_10328691 3300025923 Bacteria 1218
362 Ga0207681_10690833 3300025923 Bacteria 848
363 Ga0207694_10003133 3300025924 Bacteria 13228
364 Ga0207694_10273682 3300025924 Bacteria 1385
365 Ga0207650_10015581 3300025925 Bacteria 5297
366 Ga0207650_10092270 3300025925 Bacteria 2316
367 Ga0207650_10143773 3300025925 Bacteria 1877
368 Ga0207659_10012688 3300025926 Bacteria 5375
369 Ga0207659_10165082 3300025926 Bacteria 1742
370 Ga0207659_10410620 3300025926 Bacteria 1134
371 Ga0207687_10000792 3300025927 Bacteria 21334
372 Ga0207687_10021109 3300025927 Bacteria 4323
373 Ga0207687_10028889 3300025927 Bacteria 3727
374 Ga0207700_10009373 3300025928 Bacteria 6111
375 Ga0207664_10242129 3300025929 Bacteria 1571
376 Ga0207644_10201637 3300025931 Bacteria 1570
377 Ga0207644_10369856 3300025931 Bacteria 1167
378 Ga0207690_10451017 3300025932 Bacteria 1034
379 Ga0207690_10537734 3300025932 Bacteria 949
380 Ga0207706_10022997 3300025933 Bacteria 5597
381 Ga0207706_10166599 3300025933 Bacteria 1936
382 Ga0207706_11003956 3300025933 Bacteria 701
383 Ga0207706_11122926 3300025933 Bacteria 656
384 Ga0207686_10000643 3300025934 Bacteria 21534
385 Ga0207686_10569602 3300025934 Bacteria 888
386 Ga0207686_10704516 3300025934 Bacteria 803
387 Ga0207709_10114978 3300025935 Bacteria 1806
388 Ga0207709_10295624 3300025935 Unclassified 1202
389 Ga0207670_10000011 3300025936 Bacteria 266639
390 Ga0207670_10100286 3300025936 Bacteria 2067
391 Ga0207670_10200333 3300025936 Bacteria 1516
392 Ga0207670_10413798 3300025936 Bacteria 1080
393 Ga0207670_10659490 3300025936 Bacteria 863
394 Ga0207669_10030571 3300025937 Unclassified 2994
395 Ga0207669_10074279 3300025937 Bacteria 2149
396 Ga0207704_10028106 3300025938 Bacteria 3115
397 Ga0207704_10072463 3300025938 Bacteria 2190
398 Ga0207704_10254352 3300025938 Bacteria 1321
399 Ga0207665_10006482 3300025939 Bacteria 7762
400 Ga0207665_10007475 3300025939 Bacteria 7221
401 Ga0207691_10317585 3300025940 Bacteria 1336
402 Ga0207691_10375502 3300025940 Bacteria 1214
403 Ga0207711_10000841 3300025941 Bacteria 29654
404 Ga0207711_10202967 3300025941 Bacteria 1810
405 Ga0207711_10362735 3300025941 Bacteria 1342
406 Ga0207689_10000042 3300025942 Bacteria 93077
407 Ga0207689_10098125 3300025942 Bacteria 2406
408 Ga0207689_10259163 3300025942 Unclassified 1438
409 Ga0207689_10364843 3300025942 Unclassified 1201
410 Ga0207689_10647650 3300025942 Bacteria 890
411 Ga0207689_10757065 3300025942 Bacteria 820
412 Ga0207661_10269918 3300025944 Bacteria 1518
413 Ga0207661_10318953 3300025944 Bacteria 1396
414 Ga0207679_10428914 3300025945 Bacteria 1168
415 Ga0207667_10049086 3300025949 Bacteria 4460
416 Ga0207667_10104113 3300025949 Bacteria 2927
417 Ga0207667_10629151 3300025949 Bacteria 1080
418 Ga0207651_10005645 3300025960 Bacteria 6449
419 Ga0207651_10028595 3300025960 Bacteria 3519
420 Ga0207651_10243783 3300025960 Bacteria 1466
421 Ga0207651_10478385 3300025960 Bacteria 1073
422 Ga0207651_10482934 3300025960 Bacteria 1068
423 Ga0207712_10117038 3300025961 Bacteria 2009
424 Ga0207712_10146338 3300025961 Bacteria 1819
425 Ga0207668_10008926 3300025972 Bacteria 5996
426 Ga0207668_10038683 3300025972 Bacteria 3204
427 Ga0207668_10198223 3300025972 Bacteria 1597
428 Ga0207668_10246020 3300025972 Bacteria 1450
429 Ga0207668_10497162 3300025972 Bacteria 1048
430 Ga0207640_10009528 3300025981 Bacteria 5439
431 Ga0207640_10674081 3300025981 Bacteria 884
432 Ga0207658_10067312 3300025986 Bacteria 2697
433 Ga0207658_10174812 3300025986 Bacteria 1772
434 Ga0207658_10799841 3300025986 Bacteria 856
435 Ga0207677_10000387 3300026023 Bacteria 30319
436 Ga0207677_10050315 3300026023 Bacteria 2818
437 Ga0207677_10144882 3300026023 Bacteria 1824
438 Ga0207703_10001656 3300026035 Bacteria 20008
439 Ga0207703_10066974 3300026035 Bacteria 2955
440 Ga0207703_11083279 3300026035 Bacteria 770
441 Ga0207639_10094355 3300026041 Bacteria 2402
442 Ga0207639_10175758 3300026041 Bacteria 1818
443 Ga0207639_10298956 3300026041 Bacteria 1422
444 Ga0207639_10494486 3300026041 Bacteria 1116
445 Ga0207639_11925959 3300026041 Bacteria 552
446 Ga0207678_10011990 3300026067 Bacteria 7611
447 Ga0207678_10047155 3300026067 Bacteria 3727
448 Ga0207708_10063137 3300026075 Bacteria 2830
449 Ga0207708_10122879 3300026075 Bacteria 2024
450 Ga0207708_10218378 3300026075 Bacteria 1527
451 Ga0207708_10458748 3300026075 Bacteria 1063
452 Ga0207702_10005967 3300026078 Bacteria 10580
453 Ga0207702_10174329 3300026078 Bacteria 1975
454 Ga0207702_10853379 3300026078 Bacteria 901
455 Ga0207641_10050841 3300026088 Bacteria 3508
456 Ga0207641_10122809 3300026088 Bacteria 2320
457 Ga0207641_10325624 3300026088 Bacteria 1458
458 Ga0207648_10001802 3300026089 Bacteria 23480
459 Ga0207648_10033330 3300026089 Bacteria 4543
460 Ga0207648_10096629 3300026089 Bacteria 2585
461 Ga0207648_10146549 3300026089 Bacteria 2082
462 Ga0207648_10236136 3300026089 Bacteria 1627
463 Ga0207648_10479342 3300026089 Bacteria 1136
464 Ga0207676_10000321 3300026095 Bacteria 41273
465 Ga0207676_10010216 3300026095 Bacteria 6678
466 Ga0207676_10080329 3300026095 Bacteria 2646
467 Ga0207676_10399000 3300026095 Bacteria 1285
468 Ga0207676_10763772 3300026095 Bacteria 941
469 Ga0207674_10002494 3300026116 Bacteria 23211
470 Ga0207674_10085917 3300026116 Bacteria 3140
471 Ga0207674_11292007 3300026116 Bacteria 699
472 Ga0207675_100001457 3300026118 Bacteria 23724
473 Ga0207675_100002290 3300026118 Bacteria 19014
474 Ga0207675_100008960 3300026118 Bacteria 9388
475 Ga0207675_100100666 3300026118 Bacteria 2722
476 Ga0207675_100699921 3300026118 Bacteria 1022
477 Ga0207675_100799938 3300026118 Bacteria 956
478 Ga0207683_10000560 3300026121 Bacteria 34398
479 Ga0207698_10466482 3300026142 Bacteria 1222
480 Ga0209999_1011300 3300027543 Bacteria 1616
481 Ga0209999_1041480 3300027543 Unclassified 863
482 Ga0209982_1014676 3300027552 Bacteria 1185
483 Ga0209970_1009340 3300027614 Bacteria 1602
484 Ga0209966_1002775 3300027695 Bacteria 2934
485 Ga0207428_10004753 3300027907 Bacteria 12842
486 Ga0268266_10144234 3300028379 Bacteria 2139
487 Ga0268266_10305428 3300028379 Bacteria 1485
488 Ga0268265_10615139 3300028380 Bacteria 1040
489 Ga0268265_10696734 3300028380 Bacteria 981
490 Ga0268265_11508562 3300028380 Bacteria 676
491 Ga0268264_10001973 3300028381 Bacteria 18439
492 Ga0268264_10242666 3300028381 Bacteria 1669
493 Ga0268264_10277121 3300028381 Bacteria 1569
494 Ga0268264_10422946 3300028381 Bacteria 1285
495 Ga0265332_10021647 3300031238 Bacteria 2839
496 Ga0265320_10111765 3300031240 Bacteria 1251
497 Ga0265339_10000248 3300031249 Bacteria 43570
498 Ga0265316_10002854 3300031344 Bacteria 17682
499 Ga0307513_10363528 3300031456 Bacteria 1191
500 Ga0307408_100170733 3300031548 Bacteria 1736
501 Ga0265313_10015875 3300031595 Bacteria 4357
502 Ga0265313_10068272 3300031595 Bacteria 1643
503 Ga0307508_10103265 3300031616 Bacteria 2447
504 Ga0265314_10000001 3300031711 Bacteria 3792860
505 Ga0265314_10581360 3300031711 Bacteria 579
506 Ga0265342_10045808 3300031712 Bacteria 2631
507 Ga0307412_10473369 3300031911 Bacteria 1037
508 Ga0307416_100166858 3300032002 Bacteria 2043
509 Ga0373926_0031384 3300035083 Bacteria 1873
510 Ga0373934_0010133 3300035086 Bacteria 3539
511 Ga0373934_0158597 3300035086 Bacteria 928
512 Ga0373944_0075636 3300035089 Bacteria 1104
513 Ga0373923_0184299 3300035111 Bacteria 960
514 Ga0373945_0018850 3300035116 Bacteria 2351
515 Ga0373953_0043984 3300035117 Bacteria 1784
516 Ga0373954_0006090 3300035118 Bacteria 5249
517 Ga0373956_0017921 3300035119 Bacteria 2993
518 Ga0373956_0166267 3300035119 Bacteria 1040
519 Ga0373956_0378562 3300035119 Bacteria 675
520 Ga0373957_0002940 3300035120 Bacteria 4938
521 Ga0373957_0030865 3300035120 Bacteria 1966
522 Ga0373957_0069706 3300035120 Bacteria 1373
523 Ga0373943_0052145 3300035170 Bacteria 2016
524 Ga0373943_0127206 3300035170 Unclassified 1360
525 Ga0373946_0007519 3300035171 Bacteria 3985
526 Ga0373955_0005891 3300035172 Bacteria 5541
527 Ga0373955_0008584 3300035172 Bacteria 4751
528 Ga0373961_0030097 3300035241 Bacteria 1508
529 Ga0373924_0108093 3300035410 Unclassified 1200
530 Ga0373924_0335314 3300035410 Bacteria 673
531 Ga0373935_0044421 3300035692 Bacteria 2800
532 Ga0373935_0288218 3300035692 Bacteria 1157
533 Ga0373927_0044913 3300035695 Bacteria 2858
534 Ga0373927_0297729 3300035695 Bacteria 1062
535 Ga0373927_0331556 3300035695 Bacteria 1002
536 Ga0373933_0022005 3300035724 Bacteria 3627
537 Ga0373933_0052624 3300035724 Bacteria 2437
538 Ga0373947_0016734 3300035725 Bacteria 4213
539 Ga0373947_0017986 3300035725 Bacteria 4067
540 Ga0373937_0015812 3300036401 Bacteria 6684
541 Ga0373937_0041017 3300036401 Bacteria 4221
542 Ga0373937_0074317 3300036401 Bacteria 3136
543 Ga0373937_0107371 3300036401 Bacteria 2595
544 Ga0373937_0338733 3300036401 Bacteria 1424
545 Ga0373925_0000590 3300037068 Bacteria 34985
546 Ga0373925_0005479 3300037068 Bacteria 9449
547 Ga0373925_0049162 3300037068 Bacteria 3143
548 Ga0395899_0030853 3300037312 Bacteria 4029
549 Ga0395900_0022094 3300037418 Bacteria 6508
550 Ga0395900_0046752 3300037418 Bacteria 4456
551 Ga0395898_0057947 3300037466 Bacteria 3772
552 Ga0436364_1477909 3300037853 Bacteria 1101
553 Ga0395901_0013320 3300038443 Bacteria 8353
554 Ga0395901_0018343 3300038443 Bacteria 7144
555 Ga0395901_0404854 3300038443 Bacteria 1401
556 Ga0436365_1399826 3300039437 Bacteria 781
557 Ga0436360_0281756 3300039438 Bacteria 727
558 Ga0436360_0945100 3300039438 Bacteria 6705
559 Ga0436360_1348452 3300039438 Bacteria 1570
560 Ga0436361_1004545 3300039447 Bacteria 679
561 Ga0436363_1459367 3300039450 Bacteria 911
562 Ga0436362_0819930 3300039453 Bacteria 1162
563 Ga0451793_0235094 3300041452 Bacteria 607
564 Ga0451807_2295206 3300041486 Unclassified 609
565 Ga0439443_001304 3300042003 Bacteria 2693
566 Ga0439435_0001712 3300042436 Bacteria 4152
567 Ga0453683_0251882 3300044673 Bacteria 1126
568 Ga0466963_0193097 3300044694 Bacteria 1423
569 Ga0451576_0004811 3300045051 Bacteria 17299
570 Ga0451576_0353048 3300045051 Bacteria 1539
571 Ga0466958_0768647 3300045836 Unclassified 628
572 Ga0466967_0512318 3300045976 Bacteria 1178
573 Ga0495592_0029324 3300046454 Bacteria 4167
574 Ga0495629_0004517 3300046459 Bacteria 10406
575 Ga0495629_0346996 3300046459 Bacteria 1013
576 Ga0495641_0175688 3300046461 Bacteria 958
577 Ga0495651_0702827 3300046462 Bacteria 630
578 Ga0495653_0105774 3300046463 Bacteria 2031
579 Ga0495580_0010020 3300046472 Bacteria 7411
580 Ga0495580_0344231 3300046472 Bacteria 1011
581 Ga0495580_0389717 3300046472 Bacteria 940
582 Ga0495582_0002001 3300046473 Bacteria 11415
583 Ga0495582_0169587 3300046473 Bacteria 1242
584 Ga0495582_0373482 3300046473 Bacteria 822
585 Ga0495639_0096816 3300046475 Bacteria 1390
586 Ga0495639_0125472 3300046475 Bacteria 1226
587 Ga0495662_0011736 3300046476 Bacteria 4282
588 Ga0495662_0023697 3300046476 Bacteria 2964
589 Ga0495664_0005933 3300046477 Bacteria 6727
590 Ga0495664_0262644 3300046477 Bacteria 1044
591 Ga0495664_0425006 3300046477 Unclassified 797
592 Ga0495608_0004898 3300046511 Bacteria 9586
593 Ga0495618_0070203 3300046514 Bacteria 2227
594 Ga0495618_0298661 3300046514 Bacteria 1001
595 Ga0495628_0000915 3300046516 Bacteria 27087
596 Ga0495630_0007486 3300046517 Bacteria 7804
597 Ga0495663_0075729 3300046525 Bacteria 1077
598 Ga0495663_0087499 3300046525 Bacteria 1011
599 Ga0495642_0079165 3300046528 Bacteria 1382
600 Ga0495652_0142094 3300046529 Bacteria 1887
601 Ga0495652_0221040 3300046529 Bacteria 1423
602 Ga0495665_0127698 3300046531 Bacteria 1331
603 Ga0495640_0020825 3300046533 Bacteria 4819
604 Ga0495640_0157869 3300046533 Bacteria 1455
605 Ga0495586_0000698 3300046535 Bacteria 19053
606 Ga0495587_0012453 3300046536 Bacteria 5353
607 Ga0495587_0028617 3300046536 Bacteria 3388
608 Ga0495587_0398914 3300046536 Bacteria 764
609 Ga0495598_0007922 3300046537 Bacteria 2457
610 Ga0495621_0021020 3300046539 Bacteria 2148
611 Ga0495621_0286167 3300046539 Bacteria 680
612 Ga0495645_0006456 3300046543 Bacteria 8136
613 Ga0495667_0004720 3300046559 Bacteria 9213
614 Ga0495667_0173461 3300046559 Bacteria 1385
615 Ga0495667_0394094 3300046559 Bacteria 872
616 Ga0495656_0007785 3300046615 Bacteria 3803
617 Ga0495656_0037933 3300046615 Bacteria 1993
618 Ga0495668_0372347 3300046616 Unclassified 784
619 Ga0495634_0003402 3300046642 Bacteria 12776
620 Ga0495634_0170024 3300046642 Bacteria 1370
621 Ga0495635_0023563 3300046663 Bacteria 4287
622 Ga0495635_0047563 3300046663 Bacteria 2958
623 Ga0495588_0057887 3300046674 Bacteria 2003
624 Ga0495623_0162624 3300046679 Unclassified 1311
625 Ga0495658_0092228 3300046683 Bacteria 1795
626 Ga0495669_0163967 3300046684 Bacteria 1055
627 Ga0495613_0003488 3300046689 Bacteria 11768
628 Ga0495613_0126616 3300046689 Bacteria 1831
629 Ga0495613_0672666 3300046689 Unclassified 683
630 Ga0495624_0374256 3300046690 Unclassified 856
631 Ga0495600_0071018 3300046809 Bacteria 2275
632 Ga0495600_0078997 3300046809 Bacteria 2148
633 Ga0495581_0000748 3300047315 Bacteria 17240
634 Ga0495604_0005164 3300047317 Bacteria 10338
635 Ga0495636_0014976 3300047318 Bacteria 3088
636 Ga0495636_0390461 3300047318 Bacteria 662
637 Ga0495674_0100401 3300047319 Bacteria 2463
638 Ga0495674_0492754 3300047319 Bacteria 981
639 Ga0495680_0004292 3300047322 Bacteria 13673
640 Ga0495680_0009463 3300047322 Bacteria 8763
641 Ga0495680_0684177 3300047322 Unclassified 679
642 Ga0495675_0309187 3300047444 Bacteria 937
643 Ga0495675_0345641 3300047444 Bacteria 876
644 Ga0495677_0059048 3300047445 Bacteria 1420
645 Ga0495684_0074302 3300047471 Bacteria 2583
646 Ga0495684_0087484 3300047471 Bacteria 2361
647 Ga0495684_0090417 3300047471 Bacteria 2319
648 Ga0495593_0201082 3300047673 Bacteria 1001
649 Ga0496100_0582065 3300048903 Bacteria 868
650 Ga0496102_0146402 3300048905 Bacteria 2217
651 Ga0496102_0316656 3300048905 Bacteria 1470
652 Ga0496103_0079575 3300048906 Bacteria 2060
653 Ga0496104_0351887 3300048907 Unclassified 1386
654 Ga0496104_1201085 3300048907 Bacteria 662
655 Ga0496105_0384267 3300048908 Bacteria 1117
656 Ga0496106_0000002 3300048909 Bacteria 377020
657 Ga0496106_0171325 3300048909 Bacteria 1721
658 Ga0496106_0418544 3300048909 Bacteria 1077
659 Ga0496107_0670060 3300048910 Bacteria 764
660 Ga0496109_0624444 3300048912 Bacteria 1014
661 Ga0496112_0014655 3300048915 Bacteria 7285
662 Ga0496112_0289240 3300048915 Bacteria 1585
663 Ga0496112_0529515 3300048915 Bacteria 1113
664 Ga0496112_0573926 3300048915 Bacteria 1061
665 Ga0496113_0672280 3300048916 Bacteria 827
666 Ga0496113_0845842 3300048916 Bacteria 725
667 Ga0496114_0106711 3300048917 Bacteria 2396
668 Ga0496114_0595426 3300048917 Bacteria 975
669 Ga0496115_0131409 3300048918 Unclassified 2064
670 Ga0496121_0004950 3300048924 Bacteria 17473
671 Ga0501032_0677794 3300049569 Bacteria 654
672 Ga0501034_0126534 3300049571 Bacteria 2540
673 Ga0501034_0315929 3300049571 Bacteria 1496
674 Ga0501041_0685584 3300049577 Bacteria 655
675 Ga0501042_0068598 3300049578 Bacteria 2536
676 Ga0501043_0179933 3300049579 Bacteria 1648
677 Ga0501046_0168402 3300049580 Bacteria 1645
678 Ga0501047_0240369 3300049581 Bacteria 1662
679 Ga0501067_0443892 3300049583 Bacteria 724
680 Ga0501069_0174337 3300049585 Bacteria 1242
681 Ga0501070_0299282 3300049586 Bacteria 1311
682 Ga0501071_0017767 3300049587 Bacteria 4913
683 Ga0501073_0039619 3300049589 Bacteria 3337
684 Ga0501073_0106149 3300049589 Bacteria 1949
685 Ga0501075_0362120 3300049591 Bacteria 1105
686 Ga0501075_0415172 3300049591 Bacteria 1026
687 Ga0501076_0194641 3300049592 Bacteria 1655
688 Ga0501079_0039824 3300049741 Bacteria 3626
689 Ga0501079_1325898 3300049741 Bacteria 567
690 Ga0501080_0176954 3300049742 Bacteria 1965
691 Ga0501080_0290527 3300049742 Bacteria 1484
692 Ga0501081_0127322 3300049743 Bacteria 1817
693 Ga0501083_0044412 3300049744 Bacteria 3008
694 Ga0501035_1114745 3300049822 Bacteria 616
695 Ga0501045_0352526 3300049824 Bacteria 1095
696 nmdc:mga0k408_481208_c1 3300050493 Bacteria 736
697 nmdc:mga0k408_50078_c1 3300050493 Bacteria 2418
698 nmdc:mga06z11_269343_c1 3300050494 Bacteria 1007
699 nmdc:mga05p37_718862_c1 3300050507 Bacteria 1106
700 nmdc:mga05p37_893525_c1 3300050507 Bacteria 959
701 nmdc:mga09592_4118_c1 3300050508 Bacteria 11745
702 nmdc:mga09592_746504_c1 3300050508 Bacteria 831
703 nmdc:mga09592_9052_c1 3300050508 Bacteria 8093
704 nmdc:mga09592_982617_c1 3300050508 Bacteria 706
705 nmdc:mga06r32_180407_c1 3300050510 Bacteria 2097
706 nmdc:mga06r32_308625_c1 3300050510 Bacteria 1568
707 nmdc:mga08y16_206328_c1 3300050511 Bacteria 2036
708 nmdc:mga08y16_334083_c1 3300050511 Bacteria 1558
709 nmdc:mga08y16_4633_c1 3300050511 Bacteria 14327
710 nmdc:mga08y16_92120_c1 3300050511 Bacteria 3158
711 nmdc:mga0n895_390491_c1 3300050512 Bacteria 1408
712 nmdc:mga0n895_431072_c1 3300050512 Bacteria 1332
713 nmdc:mga0n895_458627_c1 3300050512 Bacteria 1286
714 nmdc:mga0n895_720958_c1 3300050512 Bacteria 992
715 nmdc:mga0rr50_795250_c1 3300050513 Bacteria 807
716 nmdc:mga0a205_1196519_c1 3300050515 Bacteria 608
717 Ga0495601_0043782 3300053077 Bacteria 2811
718 Ga0495601_0276660 3300053077 Bacteria 1095
719 Ga0495595_0137343 3300053084 Bacteria 1198
720 Ga0495595_0166901 3300053084 Bacteria 1088
721 Ga0495595_0332930 3300053084 Bacteria 765
722 Ga0495619_0003508 3300053085 Bacteria 10115
723 Ga0495619_0290755 3300053085 Bacteria 1132
724 Ga0500647_0102184 3300053091 Bacteria 1368
725 Ga0500566_0234531 3300053094 Bacteria 903
726 Ga0500658_0078495 3300053134 Bacteria 1407
727 Ga0500658_0452414 3300053134 Bacteria 584
728 Ga0500568_0015816 3300053139 Bacteria 3368
729 Ga0500588_0134871 3300053146 Bacteria 882
730 Ga0501084_0115150 3300054114 Bacteria 2260
731 Ga0501084_0452721 3300054114 Bacteria 1085
732 Ga0587084_012657 3300059477 Bacteria 1146
733 Ga0587066_031447 3300059490 Bacteria 949
734 Ga0587080_045216 3300059503 Bacteria 815
735 Ga0587080_047059 3300059503 Bacteria 804
736 Ga0587090_039217 3300059510 Bacteria 827
737 Ga0587090_068009 3300059510 Bacteria 690
738 Ga0587095_022840 3300059514 Bacteria 611
739 Ga0587101_053164 3300059623 Bacteria 703
740 Ga0587069_052312 3300059642 Bacteria 730
741 Ga0587110_039579 3300059654 Bacteria 602
742 Ga0587071_030440 3300060344 Bacteria 1037
743 Ga0501082_0171616 3300060353 Bacteria 1886
744 Ga0501082_0340263 3300060353 Bacteria 1307
745 Ga0501082_0936510 3300060353 Bacteria 758
746 Ga0530510_0243931 3300061734 Bacteria 1338

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100826432 Ga0070704_1008264321 148
2 3300005844 Ga0068862_100850609 Ga0068862_1008506092 152
3 3300026095 Ga0207676_10399000 Ga0207676_103990002 153
4 3300028380 Ga0268265_11508562 Ga0268265_115085622 154
5 3300003323 rootH1_10075528 rootH1_100755282 155
6 3300038443 Ga0395901_0404854 Ga0395901_0404854_120_596 155
7 3300005471 Ga0070698_100400351 Ga0070698_1004003513 156
8 3300045976 Ga0466967_0512318 Ga0466967_0512318_603_1076 157
9 3300005336 Ga0070680_100054427 Ga0070680_1000544273 158
10 3300005530 Ga0070679_100008815 Ga0070679_10000881510 158
11 3300005981 Ga0081538_10026343 Ga0081538_100263436 158
12 3300006846 Ga0075430_100139328 Ga0075430_1001393283 158
13 3300006847 Ga0075431_100149430 Ga0075431_1001494303 158
14 3300006880 Ga0075429_100005681 Ga0075429_1000056813 158
15 3300025921 Ga0207652_10167925 Ga0207652_101679252 158
16 3300050508 nmdc:mga09592_4118_c1 nmdc:mga09592_4118_c1_9529_10005 158
17 3300050510 nmdc:mga06r32_180407_c1 nmdc:mga06r32_180407_c1_779_1255 158
18 3300005355 Ga0070671_100168887 Ga0070671_1001688872 159
19 3300005440 Ga0070705_100606499 Ga0070705_1006064991 159
20 3300005937 Ga0081455_10051004 Ga0081455_100510044 159
21 3300006880 Ga0075429_100028299 Ga0075429_1000282994 159
22 3300009094 Ga0111539_10001915 Ga0111539_100019154 159
23 3300025934 Ga0207686_10704516 Ga0207686_107045162 159
24 3300027543 Ga0209999_1041480 Ga0209999_10414801 159
25 3300027907 Ga0207428_10004753 Ga0207428_100047537 159
26 3300035241 Ga0373961_0030097 Ga0373961_0030097_604_1083 159
27 3300046537 Ga0495598_0007922 Ga0495598_0007922_523_1002 159
28 3300046539 Ga0495621_0286167 Ga0495621_0286167_132_611 159
29 3300046615 Ga0495656_0007785 Ga0495656_0007785_1853_2332 159
30 3300050507 nmdc:mga05p37_893525_c1 nmdc:mga05p37_893525_c1_237_719 159
31 3300050508 nmdc:mga09592_9052_c1 nmdc:mga09592_9052_c1_4471_4953 159
32 3300050511 nmdc:mga08y16_4633_c1 nmdc:mga08y16_4633_c1_7983_8465 159
33 3300005577 Ga0068857_101581863 Ga0068857_1015818631 160
34 3300005844 Ga0068862_100486305 Ga0068862_1004863052 160
35 3300006173 Ga0070716_100564865 Ga0070716_1005648652 160
36 3300007076 Ga0075435_100398110 Ga0075435_1003981102 160
37 3300009093 Ga0105240_10074462 Ga0105240_100744626 160
38 3300014326 Ga0157380_11624197 Ga0157380_116241972 160
39 3300025913 Ga0207695_10181541 Ga0207695_101815413 160
40 3300025933 Ga0207706_11003956 Ga0207706_110039562 160
41 3300026116 Ga0207674_11292007 Ga0207674_112920072 160
42 3300046525 Ga0495663_0087499 Ga0495663_0087499_225_707 160
43 3300046528 Ga0495642_0079165 Ga0495642_0079165_590_1072 160
44 3300046615 Ga0495656_0037933 Ga0495656_0037933_1243_1725 160
45 3300046674 Ga0495588_0057887 Ga0495588_0057887_184_666 160
46 3300046684 Ga0495669_0163967 Ga0495669_0163967_558_1040 160
47 3300047318 Ga0495636_0390461 Ga0495636_0390461_51_533 160
48 3300047445 Ga0495677_0059048 Ga0495677_0059048_405_887 160
49 3300048917 Ga0496114_0106711 Ga0496114_0106711_1788_2270 160
50 3300050512 nmdc:mga0n895_458627_c1 nmdc:mga0n895_458627_c1_101_583 160
51 3300053139 Ga0500568_0015816 Ga0500568_0015816_1351_1836 160
52 3300005327 Ga0070658_10008608 Ga0070658_100086089 161
53 3300005330 Ga0070690_100760030 Ga0070690_1007600302 161
54 3300005331 Ga0070670_100004471 Ga0070670_1000044714 161
55 3300005347 Ga0070668_100568488 Ga0070668_1005684881 161
56 3300005544 Ga0070686_100779429 Ga0070686_1007794292 161
57 3300005563 Ga0068855_100131875 Ga0068855_1001318753 161
58 3300005577 Ga0068857_100795241 Ga0068857_1007952412 161
59 3300005841 Ga0068863_100797441 Ga0068863_1007974412 161
60 3300005844 Ga0068862_100244201 Ga0068862_1002442012 161
61 3300009093 Ga0105240_10000262 Ga0105240_1000026268 161
62 3300009094 Ga0111539_10008405 Ga0111539_1000840510 161
63 3300009094 Ga0111539_10202553 Ga0111539_102025533 161
64 3300009094 Ga0111539_11890469 Ga0111539_118904691 161
65 3300009147 Ga0114129_10306609 Ga0114129_103066092 161
66 3300009177 Ga0105248_11165236 Ga0105248_111652362 161
67 3300009545 Ga0105237_10000050 Ga0105237_1000005048 161
68 3300009551 Ga0105238_10006468 Ga0105238_100064684 161
69 3300009553 Ga0105249_10950003 Ga0105249_109500031 161
70 3300014969 Ga0157376_11569476 Ga0157376_115694761 161
71 3300017792 Ga0163161_10610016 Ga0163161_106100162 161
72 3300025909 Ga0207705_10020349 Ga0207705_100203493 161
73 3300025913 Ga0207695_10003817 Ga0207695_100038174 161
74 3300025914 Ga0207671_10019884 Ga0207671_100198846 161
75 3300025921 Ga0207652_10020675 Ga0207652_100206753 161
76 3300025924 Ga0207694_10003133 Ga0207694_100031339 161
77 3300025942 Ga0207689_10757065 Ga0207689_107570651 161
78 3300025960 Ga0207651_10478385 Ga0207651_104783852 161
79 3300028381 Ga0268264_10422946 Ga0268264_104229462 161
80 3300031240 Ga0265320_10111765 Ga0265320_101117651 161
81 3300031595 Ga0265313_10068272 Ga0265313_100682722 161
82 3300031712 Ga0265342_10045808 Ga0265342_100458084 161
83 3300035111 Ga0373923_0184299 Ga0373923_0184299_252_737 161
84 3300035117 Ga0373953_0043984 Ga0373953_0043984_712_1197 161
85 3300035118 Ga0373954_0006090 Ga0373954_0006090_2355_2840 161
86 3300035119 Ga0373956_0017921 Ga0373956_0017921_329_814 161
87 3300035120 Ga0373957_0002940 Ga0373957_0002940_3750_4235 161
88 3300035172 Ga0373955_0008584 Ga0373955_0008584_3265_3750 161
89 3300035410 Ga0373924_0335314 Ga0373924_0335314_15_500 161
90 3300035724 Ga0373933_0052624 Ga0373933_0052624_357_842 161
91 3300036401 Ga0373937_0015812 Ga0373937_0015812_1036_1521 161
92 3300037853 Ga0436364_1477909 Ga0436364_1477909_543_1028 161
93 3300046462 Ga0495651_0702827 Ga0495651_0702827_126_611 161
94 3300046514 Ga0495618_0298661 Ga0495618_0298661_443_928 161
95 3300046525 Ga0495663_0075729 Ga0495663_0075729_569_1054 161
96 3300046529 Ga0495652_0142094 Ga0495652_0142094_462_947 161
97 3300046559 Ga0495667_0394094 Ga0495667_0394094_188_673 161
98 3300047444 Ga0495675_0345641 Ga0495675_0345641_178_663 161
99 3300049571 Ga0501034_0315929 Ga0501034_0315929_225_710 161
100 3300049589 Ga0501073_0106149 Ga0501073_0106149_353_838 161
101 3300049591 Ga0501075_0415172 Ga0501075_0415172_57_542 161
102 3300049742 Ga0501080_0176954 Ga0501080_0176954_1306_1791 161
103 3300050507 nmdc:mga05p37_718862_c1 nmdc:mga05p37_718862_c1_555_1040 161
104 3300050508 nmdc:mga09592_982617_c1 nmdc:mga09592_982617_c1_178_663 161
105 3300050511 nmdc:mga08y16_206328_c1 nmdc:mga08y16_206328_c1_445_930 161
106 3300053077 Ga0495601_0276660 Ga0495601_0276660_274_759 161
107 3300053084 Ga0495595_0332930 Ga0495595_0332930_101_586 161
108 3300054114 Ga0501084_0452721 Ga0501084_0452721_299_784 161
109 3300005329 Ga0070683_100478517 Ga0070683_1004785172 162
110 3300005338 Ga0068868_100070854 Ga0068868_1000708543 162
111 3300005366 Ga0070659_100281287 Ga0070659_1002812872 162
112 3300005441 Ga0070700_100114080 Ga0070700_1001140801 162
113 3300005455 Ga0070663_100027987 Ga0070663_1000279873 162
114 3300005459 Ga0068867_101249573 Ga0068867_1012495732 162
115 3300005530 Ga0070679_101262591 Ga0070679_1012625911 162
116 3300005535 Ga0070684_101128391 Ga0070684_1011283911 162
117 3300005548 Ga0070665_100433940 Ga0070665_1004339402 162
118 3300005549 Ga0070704_100052785 Ga0070704_1000527852 162
119 3300005564 Ga0070664_100811992 Ga0070664_1008119922 162
120 3300005617 Ga0068859_100063206 Ga0068859_1000632065 162
121 3300005841 Ga0068863_100071294 Ga0068863_1000712943 162
122 3300005842 Ga0068858_100071185 Ga0068858_1000711854 162
123 3300006237 Ga0097621_100558056 Ga0097621_1005580563 162
124 3300006358 Ga0068871_101462686 Ga0068871_1014626862 162
125 3300006852 Ga0075433_10255373 Ga0075433_102553732 162
126 3300006931 Ga0097620_100063209 Ga0097620_1000632095 162
127 3300009176 Ga0105242_12504600 Ga0105242_125046001 162
128 3300009177 Ga0105248_10686561 Ga0105248_106865612 162
129 3300009545 Ga0105237_10226871 Ga0105237_102268712 162
130 3300014325 Ga0163163_10020582 Ga0163163_100205825 162
131 3300014745 Ga0157377_10453072 Ga0157377_104530722 162
132 3300017792 Ga0163161_10382436 Ga0163161_103824361 162
133 3300025932 Ga0207690_10451017 Ga0207690_104510172 162
134 3300025936 Ga0207670_10100286 Ga0207670_101002862 162
135 3300025941 Ga0207711_10362735 Ga0207711_103627352 162
136 3300025972 Ga0207668_10038683 Ga0207668_100386834 162
137 3300025972 Ga0207668_10198223 Ga0207668_101982232 162
138 3300025986 Ga0207658_10799841 Ga0207658_107998412 162
139 3300026035 Ga0207703_10066974 Ga0207703_100669743 162
140 3300026041 Ga0207639_11925959 Ga0207639_119259591 162
141 3300026067 Ga0207678_10011990 Ga0207678_100119906 162
142 3300026075 Ga0207708_10458748 Ga0207708_104587482 162
143 3300026089 Ga0207648_10236136 Ga0207648_102361362 162
144 3300026118 Ga0207675_100008960 Ga0207675_1000089602 162
145 3300031456 Ga0307513_10363528 Ga0307513_103635282 162
146 3300031616 Ga0307508_10103265 Ga0307508_101032651 162
147 3300046536 Ga0495587_0398914 Ga0495587_0398914_19_507 162
148 3300048903 Ga0496100_0582065 Ga0496100_0582065_90_578 162
149 3300048907 Ga0496104_1201085 Ga0496104_1201085_34_522 162
150 3300048909 Ga0496106_0418544 Ga0496106_0418544_313_804 162
151 3300048915 Ga0496112_0529515 Ga0496112_0529515_202_690 162
152 3300048917 Ga0496114_0595426 Ga0496114_0595426_77_568 162
153 3300049569 Ga0501032_0677794 Ga0501032_0677794_125_613 162
154 3300049577 Ga0501041_0685584 Ga0501041_0685584_100_588 162
155 3300049578 Ga0501042_0068598 Ga0501042_0068598_72_560 162
156 3300049579 Ga0501043_0179933 Ga0501043_0179933_262_750 162
157 3300049580 Ga0501046_0168402 Ga0501046_0168402_714_1202 162
158 3300049583 Ga0501067_0443892 Ga0501067_0443892_224_712 162
159 3300049585 Ga0501069_0174337 Ga0501069_0174337_661_1149 162
160 3300049586 Ga0501070_0299282 Ga0501070_0299282_355_843 162
161 3300049587 Ga0501071_0017767 Ga0501071_0017767_4413_4901 162
162 3300049589 Ga0501073_0039619 Ga0501073_0039619_706_1194 162
163 3300049591 Ga0501075_0362120 Ga0501075_0362120_565_1053 162
164 3300049741 Ga0501079_0039824 Ga0501079_0039824_1731_2219 162
165 3300049741 Ga0501079_1325898 Ga0501079_1325898_31_519 162
166 3300049742 Ga0501080_0290527 Ga0501080_0290527_504_992 162
167 3300049743 Ga0501081_0127322 Ga0501081_0127322_183_671 162
168 3300049744 Ga0501083_0044412 Ga0501083_0044412_372_860 162
169 3300049822 Ga0501035_1114745 Ga0501035_1114745_79_567 162
170 3300053134 Ga0500658_0078495 Ga0500658_0078495_193_687 162
171 3300053146 Ga0500588_0134871 Ga0500588_0134871_134_634 162
172 3300054114 Ga0501084_0115150 Ga0501084_0115150_767_1255 162
173 3300060353 Ga0501082_0171616 Ga0501082_0171616_795_1283 162
174 3300060353 Ga0501082_0340263 Ga0501082_0340263_371_859 162
175 3300061734 Ga0530510_0243931 Ga0530510_0243931_453_941 162
176 3300005340 Ga0070689_100000001 Ga0070689_100000001877 163
177 3300005340 Ga0070689_100348852 Ga0070689_1003488521 163
178 3300005345 Ga0070692_10218759 Ga0070692_102187592 163
179 3300005365 Ga0070688_100099785 Ga0070688_1000997852 163
180 3300005440 Ga0070705_100388048 Ga0070705_1003880481 163
181 3300005441 Ga0070700_100081740 Ga0070700_1000817403 163
182 3300005444 Ga0070694_100594094 Ga0070694_1005940942 163
183 3300005466 Ga0070685_10585130 Ga0070685_105851301 163
184 3300005539 Ga0068853_100009346 Ga0068853_1000093465 163
185 3300005544 Ga0070686_100400329 Ga0070686_1004003292 163
186 3300005547 Ga0070693_100165341 Ga0070693_1001653412 163
187 3300005563 Ga0068855_100029744 Ga0068855_1000297442 163
188 3300005614 Ga0068856_100067551 Ga0068856_1000675513 163
189 3300005617 Ga0068859_100009108 Ga0068859_1000091082 163
190 3300005617 Ga0068859_100016980 Ga0068859_1000169802 163
191 3300005719 Ga0068861_100279582 Ga0068861_1002795822 163
192 3300005841 Ga0068863_100274601 Ga0068863_1002746013 163
193 3300005842 Ga0068858_101058701 Ga0068858_1010587012 163
194 3300005844 Ga0068862_101649774 Ga0068862_1016497741 163
195 3300006931 Ga0097620_100009108 Ga0097620_1000091082 163
196 3300006931 Ga0097620_100016978 Ga0097620_1000169782 163
197 3300009101 Ga0105247_10892238 Ga0105247_108922381 163
198 3300009147 Ga0114129_10536455 Ga0114129_105364551 163
199 3300009148 Ga0105243_12145826 Ga0105243_121458261 163
200 3300009174 Ga0105241_10123324 Ga0105241_101233242 163
201 3300009551 Ga0105238_10195374 Ga0105238_101953742 163
202 3300009553 Ga0105249_10063930 Ga0105249_100639302 163
203 3300020080 Ga0206350_10936070 Ga0206350_109360701 163
204 3300025924 Ga0207694_10273682 Ga0207694_102736822 163
205 3300025936 Ga0207670_10000011 Ga0207670_1000001162 163
206 3300025936 Ga0207670_10413798 Ga0207670_104137981 163
207 3300025949 Ga0207667_10104113 Ga0207667_101041131 163
208 3300026023 Ga0207677_10144882 Ga0207677_101448822 163
209 3300026035 Ga0207703_11083279 Ga0207703_110832792 163
210 3300026075 Ga0207708_10122879 Ga0207708_101228792 163
211 3300026088 Ga0207641_10325624 Ga0207641_103256242 163
212 3300026089 Ga0207648_10146549 Ga0207648_101465491 163
213 3300026118 Ga0207675_100799938 Ga0207675_1007999381 163
214 3300027543 Ga0209999_1011300 Ga0209999_10113002 163
215 3300027552 Ga0209982_1014676 Ga0209982_10146762 163
216 3300027614 Ga0209970_1009340 Ga0209970_10093402 163
217 3300027695 Ga0209966_1002775 Ga0209966_10027752 163
218 3300028380 Ga0268265_10696734 Ga0268265_106967342 163
219 3300035119 Ga0373956_0378562 Ga0373956_0378562_164_655 163
220 3300036401 Ga0373937_0338733 Ga0373937_0338733_450_941 163
221 3300037068 Ga0373925_0005479 Ga0373925_0005479_8695_9186 163
222 3300039438 Ga0436360_0281756 Ga0436360_0281756_115_609 163
223 3300039447 Ga0436361_1004545 Ga0436361_1004545_12_506 163
224 3300039453 Ga0436362_0819930 Ga0436362_0819930_508_1002 163
225 3300042003 Ga0439443_001304 Ga0439443_001304_1973_2467 163
226 3300042436 Ga0439435_0001712 Ga0439435_0001712_1127_1621 163
227 3300044694 Ga0466963_0193097 Ga0466963_0193097_685_1230 163
228 3300045836 Ga0466958_0768647 Ga0466958_0768647_35_526 163
229 3300046616 Ga0495668_0372347 Ga0495668_0372347_17_508 163
230 3300048908 Ga0496105_0384267 Ga0496105_0384267_11_502 163
231 3300050508 nmdc:mga09592_746504_c1 nmdc:mga09592_746504_c1_144_638 163
232 3300050510 nmdc:mga06r32_308625_c1 nmdc:mga06r32_308625_c1_297_791 163
233 3300050512 nmdc:mga0n895_431072_c1 nmdc:mga0n895_431072_c1_359_850 163
234 3300050513 nmdc:mga0rr50_795250_c1 nmdc:mga0rr50_795250_c1_30_521 163
235 3300060353 Ga0501082_0936510 Ga0501082_0936510_94_585 163
236 3300005343 Ga0070687_100258947 Ga0070687_1002589472 164
237 3300005347 Ga0070668_100076494 Ga0070668_1000764941 164
238 3300005353 Ga0070669_100021986 Ga0070669_1000219863 164
239 3300005356 Ga0070674_100013861 Ga0070674_1000138615 164
240 3300005356 Ga0070674_100082001 Ga0070674_1000820012 164
241 3300005367 Ga0070667_100630537 Ga0070667_1006305371 164
242 3300005437 Ga0070710_10729193 Ga0070710_107291931 164
243 3300005471 Ga0070698_100104741 Ga0070698_1001047413 164
244 3300005535 Ga0070684_100372397 Ga0070684_1003723971 164
245 3300005545 Ga0070695_100059955 Ga0070695_1000599552 164
246 3300005545 Ga0070695_100069841 Ga0070695_1000698413 164
247 3300005546 Ga0070696_101025179 Ga0070696_1010251791 164
248 3300005618 Ga0068864_100000918 Ga0068864_10000091811 164
249 3300005718 Ga0068866_10034994 Ga0068866_100349942 164
250 3300005719 Ga0068861_100032259 Ga0068861_1000322594 164
251 3300006237 Ga0097621_100087682 Ga0097621_1000876823 164
252 3300006358 Ga0068871_100106556 Ga0068871_1001065562 164
253 3300006358 Ga0068871_100208550 Ga0068871_1002085502 164
254 3300006847 Ga0075431_100449419 Ga0075431_1004494192 164
255 3300006881 Ga0068865_100032117 Ga0068865_1000321172 164
256 3300009094 Ga0111539_10226885 Ga0111539_102268852 164
257 3300009176 Ga0105242_11513231 Ga0105242_115132312 164
258 3300009553 Ga0105249_11055910 Ga0105249_110559102 164
259 3300013296 Ga0157374_10198327 Ga0157374_101983273 164
260 3300013306 Ga0163162_11671577 Ga0163162_116715772 164
261 3300014325 Ga0163163_10009374 Ga0163163_1000937412 164
262 3300014326 Ga0157380_10047719 Ga0157380_100477192 164
263 3300025899 Ga0207642_10173920 Ga0207642_101739202 164
264 3300025926 Ga0207659_10410620 Ga0207659_104106203 164
265 3300025937 Ga0207669_10074279 Ga0207669_100742793 164
266 3300025938 Ga0207704_10028106 Ga0207704_100281063 164
267 3300025961 Ga0207712_10117038 Ga0207712_101170384 164
268 3300025972 Ga0207668_10246020 Ga0207668_102460202 164
269 3300025972 Ga0207668_10497162 Ga0207668_104971622 164
270 3300026075 Ga0207708_10063137 Ga0207708_100631372 164
271 3300026075 Ga0207708_10218378 Ga0207708_102183782 164
272 3300026078 Ga0207702_10174329 Ga0207702_101743292 164
273 3300026089 Ga0207648_10096629 Ga0207648_100966292 164
274 3300026095 Ga0207676_10080329 Ga0207676_100803294 164
275 3300026118 Ga0207675_100100666 Ga0207675_1001006662 164
276 3300028379 Ga0268266_10305428 Ga0268266_103054281 164
277 3300031548 Ga0307408_100170733 Ga0307408_1001707332 164
278 3300031911 Ga0307412_10473369 Ga0307412_104733692 164
279 3300032002 Ga0307416_100166858 Ga0307416_1001668582 164
280 3300047318 Ga0495636_0014976 Ga0495636_0014976_1100_1657 164
281 3300048915 Ga0496112_0289240 Ga0496112_0289240_51_545 164
282 3300050511 nmdc:mga08y16_92120_c1 nmdc:mga08y16_92120_c1_2073_2579 164
283 3300053134 Ga0500658_0452414 Ga0500658_0452414_50_547 164
284 3300005293 Ga0065715_10164226 Ga0065715_101642261 165
285 3300005328 Ga0070676_10021860 Ga0070676_100218604 165
286 3300005329 Ga0070683_100676024 Ga0070683_1006760241 165
287 3300005330 Ga0070690_100402429 Ga0070690_1004024292 165
288 3300005331 Ga0070670_100001648 Ga0070670_10000164813 165
289 3300005334 Ga0068869_100054630 Ga0068869_1000546301 165
290 3300005334 Ga0068869_100156996 Ga0068869_1001569963 165
291 3300005334 Ga0068869_100360526 Ga0068869_1003605261 165
292 3300005335 Ga0070666_10005247 Ga0070666_100052472 165
293 3300005335 Ga0070666_10437788 Ga0070666_104377881 165
294 3300005336 Ga0070680_100008942 Ga0070680_1000089429 165
295 3300005337 Ga0070682_100256385 Ga0070682_1002563852 165
296 3300005338 Ga0068868_100034757 Ga0068868_1000347575 165
297 3300005338 Ga0068868_100090667 Ga0068868_1000906672 165
298 3300005338 Ga0068868_101594796 Ga0068868_1015947961 165
299 3300005340 Ga0070689_100190659 Ga0070689_1001906592 165
300 3300005344 Ga0070661_100264486 Ga0070661_1002644861 165
301 3300005344 Ga0070661_100653090 Ga0070661_1006530902 165
302 3300005354 Ga0070675_100012952 Ga0070675_1000129525 165
303 3300005355 Ga0070671_100052255 Ga0070671_1000522552 165
304 3300005356 Ga0070674_100005400 Ga0070674_1000054005 165
305 3300005364 Ga0070673_100027600 Ga0070673_1000276003 165
306 3300005364 Ga0070673_100043909 Ga0070673_1000439093 165
307 3300005364 Ga0070673_100167299 Ga0070673_1001672992 165
308 3300005364 Ga0070673_101180202 Ga0070673_1011802021 165
309 3300005365 Ga0070688_100007711 Ga0070688_1000077113 165
310 3300005365 Ga0070688_100151679 Ga0070688_1001516791 165
311 3300005366 Ga0070659_100015338 Ga0070659_1000153387 165
312 3300005366 Ga0070659_100441060 Ga0070659_1004410601 165
313 3300005367 Ga0070667_100020332 Ga0070667_1000203324 165
314 3300005367 Ga0070667_100045960 Ga0070667_1000459604 165
315 3300005434 Ga0070709_10151533 Ga0070709_101515332 165
316 3300005434 Ga0070709_10256229 Ga0070709_102562292 165
317 3300005436 Ga0070713_100017271 Ga0070713_1000172711 165
318 3300005437 Ga0070710_10027580 Ga0070710_100275804 165
319 3300005438 Ga0070701_10122702 Ga0070701_101227022 165
320 3300005439 Ga0070711_100008755 Ga0070711_1000087554 165
321 3300005439 Ga0070711_100247380 Ga0070711_1002473802 165
322 3300005440 Ga0070705_100009497 Ga0070705_1000094974 165
323 3300005440 Ga0070705_100304261 Ga0070705_1003042611 165
324 3300005441 Ga0070700_100074201 Ga0070700_1000742013 165
325 3300005445 Ga0070708_100071466 Ga0070708_1000714662 165
326 3300005455 Ga0070663_100337405 Ga0070663_1003374052 165
327 3300005457 Ga0070662_100043586 Ga0070662_1000435864 165
328 3300005457 Ga0070662_101227184 Ga0070662_1012271841 165
329 3300005458 Ga0070681_10112230 Ga0070681_101122302 165
330 3300005459 Ga0068867_100009475 Ga0068867_1000094754 165
331 3300005459 Ga0068867_100100538 Ga0068867_1001005382 165
332 3300005459 Ga0068867_100405712 Ga0068867_1004057122 165
333 3300005466 Ga0070685_10008871 Ga0070685_100088714 165
334 3300005467 Ga0070706_100023816 Ga0070706_1000238163 165
335 3300005467 Ga0070706_100335196 Ga0070706_1003351962 165
336 3300005468 Ga0070707_100012864 Ga0070707_1000128643 165
337 3300005468 Ga0070707_100034532 Ga0070707_1000345324 165
338 3300005468 Ga0070707_100473545 Ga0070707_1004735452 165
339 3300005471 Ga0070698_100385728 Ga0070698_1003857282 165
340 3300005518 Ga0070699_100035398 Ga0070699_1000353983 165
341 3300005530 Ga0070679_100159253 Ga0070679_1001592533 165
342 3300005530 Ga0070679_100379975 Ga0070679_1003799752 165
343 3300005535 Ga0070684_100342925 Ga0070684_1003429252 165
344 3300005536 Ga0070697_100196093 Ga0070697_1001960932 165
345 3300005536 Ga0070697_101101454 Ga0070697_1011014541 165
346 3300005539 Ga0068853_100103460 Ga0068853_1001034602 165
347 3300005539 Ga0068853_100116101 Ga0068853_1001161012 165
348 3300005539 Ga0068853_100704304 Ga0068853_1007043042 165
349 3300005543 Ga0070672_100097994 Ga0070672_1000979942 165
350 3300005543 Ga0070672_100280352 Ga0070672_1002803522 165
351 3300005544 Ga0070686_100231182 Ga0070686_1002311822 165
352 3300005545 Ga0070695_100057718 Ga0070695_1000577182 165
353 3300005546 Ga0070696_100549765 Ga0070696_1005497652 165
354 3300005546 Ga0070696_100983667 Ga0070696_1009836671 165
355 3300005547 Ga0070693_100010214 Ga0070693_1000102144 165
356 3300005547 Ga0070693_100098545 Ga0070693_1000985452 165
357 3300005547 Ga0070693_100378553 Ga0070693_1003785532 165
358 3300005549 Ga0070704_100097687 Ga0070704_1000976873 165
359 3300005549 Ga0070704_100225977 Ga0070704_1002259772 165
360 3300005563 Ga0068855_100119530 Ga0068855_1001195302 165
361 3300005577 Ga0068857_100010399 Ga0068857_1000103992 165
362 3300005578 Ga0068854_100024272 Ga0068854_1000242725 165
363 3300005578 Ga0068854_100584982 Ga0068854_1005849822 165
364 3300005614 Ga0068856_100490020 Ga0068856_1004900202 165
365 3300005614 Ga0068856_100762411 Ga0068856_1007624112 165
366 3300005615 Ga0070702_100004222 Ga0070702_1000042227 165
367 3300005615 Ga0070702_100063146 Ga0070702_1000631463 165
368 3300005615 Ga0070702_100104733 Ga0070702_1001047332 165
369 3300005615 Ga0070702_100931185 Ga0070702_1009311851 165
370 3300005616 Ga0068852_100775206 Ga0068852_1007752062 165
371 3300005617 Ga0068859_100001347 Ga0068859_10000134719 165
372 3300005617 Ga0068859_100016297 Ga0068859_1000162974 165
373 3300005617 Ga0068859_100076147 Ga0068859_1000761474 165
374 3300005617 Ga0068859_101280555 Ga0068859_1012805551 165
375 3300005618 Ga0068864_100001786 Ga0068864_1000017866 165
376 3300005618 Ga0068864_100002127 Ga0068864_1000021274 165
377 3300005618 Ga0068864_100483635 Ga0068864_1004836352 165
378 3300005718 Ga0068866_10011885 Ga0068866_100118853 165
379 3300005719 Ga0068861_100002626 Ga0068861_10000262618 165
380 3300005840 Ga0068870_10035490 Ga0068870_100354902 165
381 3300005841 Ga0068863_100039160 Ga0068863_1000391602 165
382 3300005842 Ga0068858_100000924 Ga0068858_10000092410 165
383 3300005842 Ga0068858_100005298 Ga0068858_1000052989 165
384 3300005842 Ga0068858_100708678 Ga0068858_1007086782 165
385 3300005843 Ga0068860_100006411 Ga0068860_10000641111 165
386 3300005843 Ga0068860_100056397 Ga0068860_1000563972 165
387 3300005843 Ga0068860_100077578 Ga0068860_1000775782 165
388 3300005843 Ga0068860_101090758 Ga0068860_1010907582 165
389 3300005844 Ga0068862_100108368 Ga0068862_1001083683 165
390 3300005985 Ga0081539_10077478 Ga0081539_100774783 165
391 3300006173 Ga0070716_100009552 Ga0070716_1000095523 165
392 3300006175 Ga0070712_100017504 Ga0070712_1000175044 165
393 3300006175 Ga0070712_100102871 Ga0070712_1001028712 165
394 3300006195 Ga0075366_10185611 Ga0075366_101856112 165
395 3300006237 Ga0097621_100029079 Ga0097621_1000290795 165
396 3300006237 Ga0097621_100281678 Ga0097621_1002816782 165
397 3300006358 Ga0068871_100101076 Ga0068871_1001010762 165
398 3300006844 Ga0075428_100024555 Ga0075428_1000245553 165
399 3300006847 Ga0075431_100215328 Ga0075431_1002153282 165
400 3300006871 Ga0075434_100048545 Ga0075434_1000485451 165
401 3300006871 Ga0075434_100335790 Ga0075434_1003357902 165
402 3300006871 Ga0075434_100632506 Ga0075434_1006325062 165
403 3300006881 Ga0068865_100021637 Ga0068865_1000216372 165
404 3300006881 Ga0068865_100240758 Ga0068865_1002407582 165
405 3300006914 Ga0075436_100295790 Ga0075436_1002957901 165
406 3300006931 Ga0097620_100001347 Ga0097620_10000134719 165
407 3300006931 Ga0097620_100016298 Ga0097620_1000162984 165
408 3300006931 Ga0097620_100076149 Ga0097620_1000761494 165
409 3300009093 Ga0105240_10322796 Ga0105240_103227961 165
410 3300009094 Ga0111539_10272125 Ga0111539_102721252 165
411 3300009094 Ga0111539_12127390 Ga0111539_121273902 165
412 3300009098 Ga0105245_10001111 Ga0105245_100011112 165
413 3300009098 Ga0105245_10203801 Ga0105245_102038012 165
414 3300009098 Ga0105245_10220818 Ga0105245_102208182 165
415 3300009098 Ga0105245_10319309 Ga0105245_103193092 165
416 3300009101 Ga0105247_10062341 Ga0105247_100623412 165
417 3300009101 Ga0105247_10519944 Ga0105247_105199442 165
418 3300009148 Ga0105243_10187232 Ga0105243_101872322 165
419 3300009174 Ga0105241_10860204 Ga0105241_108602041 165
420 3300009176 Ga0105242_10005080 Ga0105242_100050802 165
421 3300009176 Ga0105242_10238437 Ga0105242_102384371 165
422 3300009177 Ga0105248_10044422 Ga0105248_100444222 165
423 3300009551 Ga0105238_10238650 Ga0105238_102386502 165
424 3300009551 Ga0105238_10367873 Ga0105238_103678732 165
425 3300009553 Ga0105249_10232752 Ga0105249_102327524 165
426 3300010375 Ga0105239_11421605 Ga0105239_114216051 165
427 3300011119 Ga0105246_10210366 Ga0105246_102103663 165
428 3300011119 Ga0105246_11039353 Ga0105246_110393532 165
429 3300013104 Ga0157370_10354958 Ga0157370_103549581 165
430 3300013296 Ga0157374_10006996 Ga0157374_100069964 165
431 3300013296 Ga0157374_10120474 Ga0157374_101204742 165
432 3300013297 Ga0157378_10009382 Ga0157378_100093822 165
433 3300013297 Ga0157378_10298084 Ga0157378_102980842 165
434 3300013297 Ga0157378_10452792 Ga0157378_104527922 165
435 3300013307 Ga0157372_10284909 Ga0157372_102849093 165
436 3300013308 Ga0157375_10040858 Ga0157375_100408583 165
437 3300013308 Ga0157375_10347676 Ga0157375_103476762 165
438 3300013308 Ga0157375_10740154 Ga0157375_107401541 165
439 3300014325 Ga0163163_10051526 Ga0163163_100515264 165
440 3300014325 Ga0163163_10577761 Ga0163163_105777611 165
441 3300014326 Ga0157380_10052814 Ga0157380_100528144 165
442 3300014326 Ga0157380_10400827 Ga0157380_104008272 165
443 3300014968 Ga0157379_10004817 Ga0157379_100048173 165
444 3300014968 Ga0157379_10258098 Ga0157379_102580982 165
445 3300014969 Ga0157376_10382483 Ga0157376_103824832 165
446 3300020080 Ga0206350_11280726 Ga0206350_112807261 165
447 3300020081 Ga0206354_10692315 Ga0206354_106923152 165
448 3300020610 Ga0154015_1046432 Ga0154015_10464322 165
449 3300021358 Ga0213873_10160452 Ga0213873_101604521 165
450 3300021441 Ga0213871_10001206 Ga0213871_100012065 165
451 3300022467 Ga0224712_10270614 Ga0224712_102706142 165
452 3300025315 Ga0207697_10366283 Ga0207697_103662831 165
453 3300025898 Ga0207692_10082197 Ga0207692_100821972 165
454 3300025899 Ga0207642_10224331 Ga0207642_102243312 165
455 3300025899 Ga0207642_10587705 Ga0207642_105877051 165
456 3300025900 Ga0207710_10015110 Ga0207710_100151102 165
457 3300025901 Ga0207688_10233703 Ga0207688_102337032 165
458 3300025901 Ga0207688_10568588 Ga0207688_105685881 165
459 3300025903 Ga0207680_10023548 Ga0207680_100235483 165
460 3300025903 Ga0207680_10087485 Ga0207680_100874853 165
461 3300025903 Ga0207680_10261756 Ga0207680_102617562 165
462 3300025905 Ga0207685_10013464 Ga0207685_100134642 165
463 3300025906 Ga0207699_10019156 Ga0207699_100191562 165
464 3300025906 Ga0207699_10079175 Ga0207699_100791752 165
465 3300025907 Ga0207645_10019696 Ga0207645_100196962 165
466 3300025907 Ga0207645_10889148 Ga0207645_108891481 165
467 3300025908 Ga0207643_10040021 Ga0207643_100400213 165
468 3300025910 Ga0207684_10020818 Ga0207684_100208185 165
469 3300025910 Ga0207684_10166713 Ga0207684_101667132 165
470 3300025911 Ga0207654_10004656 Ga0207654_100046567 165
471 3300025912 Ga0207707_10192067 Ga0207707_101920671 165
472 3300025912 Ga0207707_10273001 Ga0207707_102730012 165
473 3300025915 Ga0207693_10026174 Ga0207693_100261743 165
474 3300025915 Ga0207693_10101821 Ga0207693_101018212 165
475 3300025916 Ga0207663_10074486 Ga0207663_100744863 165
476 3300025917 Ga0207660_10154413 Ga0207660_101544132 165
477 3300025919 Ga0207657_10012272 Ga0207657_100122725 165
478 3300025920 Ga0207649_10640605 Ga0207649_106406052 165
479 3300025920 Ga0207649_11197673 Ga0207649_111976731 165
480 3300025921 Ga0207652_10015622 Ga0207652_100156222 165
481 3300025921 Ga0207652_10442788 Ga0207652_104427882 165
482 3300025922 Ga0207646_10121417 Ga0207646_101214171 165
483 3300025923 Ga0207681_10140706 Ga0207681_101407062 165
484 3300025923 Ga0207681_10328691 Ga0207681_103286912 165
485 3300025923 Ga0207681_10690833 Ga0207681_106908331 165
486 3300025925 Ga0207650_10015581 Ga0207650_100155811 165
487 3300025925 Ga0207650_10092270 Ga0207650_100922702 165
488 3300025925 Ga0207650_10143773 Ga0207650_101437732 165
489 3300025926 Ga0207659_10165082 Ga0207659_101650822 165
490 3300025927 Ga0207687_10000792 Ga0207687_1000079214 165
491 3300025927 Ga0207687_10021109 Ga0207687_100211094 165
492 3300025927 Ga0207687_10028889 Ga0207687_100288892 165
493 3300025928 Ga0207700_10009373 Ga0207700_100093733 165
494 3300025929 Ga0207664_10242129 Ga0207664_102421293 165
495 3300025931 Ga0207644_10201637 Ga0207644_102016372 165
496 3300025931 Ga0207644_10369856 Ga0207644_103698562 165
497 3300025933 Ga0207706_10022997 Ga0207706_100229975 165
498 3300025933 Ga0207706_10166599 Ga0207706_101665992 165
499 3300025933 Ga0207706_11122926 Ga0207706_111229261 165
500 3300025934 Ga0207686_10000643 Ga0207686_100006437 165
501 3300025934 Ga0207686_10569602 Ga0207686_105696022 165
502 3300025935 Ga0207709_10114978 Ga0207709_101149782 165
503 3300025935 Ga0207709_10295624 Ga0207709_102956242 165
504 3300025936 Ga0207670_10200333 Ga0207670_102003332 165
505 3300025937 Ga0207669_10030571 Ga0207669_100305714 165
506 3300025938 Ga0207704_10072463 Ga0207704_100724632 165
507 3300025938 Ga0207704_10254352 Ga0207704_102543522 165
508 3300025939 Ga0207665_10006482 Ga0207665_100064823 165
509 3300025939 Ga0207665_10007475 Ga0207665_100074756 165
510 3300025940 Ga0207691_10317585 Ga0207691_103175851 165
511 3300025940 Ga0207691_10375502 Ga0207691_103755022 165
512 3300025941 Ga0207711_10000841 Ga0207711_1000084130 165
513 3300025941 Ga0207711_10202967 Ga0207711_102029672 165
514 3300025942 Ga0207689_10000042 Ga0207689_100000421 165
515 3300025942 Ga0207689_10098125 Ga0207689_100981253 165
516 3300025942 Ga0207689_10259163 Ga0207689_102591632 165
517 3300025942 Ga0207689_10364843 Ga0207689_103648432 165
518 3300025942 Ga0207689_10647650 Ga0207689_106476501 165
519 3300025944 Ga0207661_10269918 Ga0207661_102699181 165
520 3300025960 Ga0207651_10005645 Ga0207651_100056456 165
521 3300025960 Ga0207651_10028595 Ga0207651_100285956 165
522 3300025960 Ga0207651_10243783 Ga0207651_102437832 165
523 3300025960 Ga0207651_10482934 Ga0207651_104829342 165
524 3300025961 Ga0207712_10146338 Ga0207712_101463381 165
525 3300025972 Ga0207668_10008926 Ga0207668_100089262 165
526 3300025981 Ga0207640_10009528 Ga0207640_100095286 165
527 3300025981 Ga0207640_10674081 Ga0207640_106740812 165
528 3300025986 Ga0207658_10067312 Ga0207658_100673123 165
529 3300025986 Ga0207658_10174812 Ga0207658_101748123 165
530 3300026023 Ga0207677_10000387 Ga0207677_100003879 165
531 3300026023 Ga0207677_10050315 Ga0207677_100503152 165
532 3300026035 Ga0207703_10001656 Ga0207703_100016569 165
533 3300026041 Ga0207639_10175758 Ga0207639_101757582 165
534 3300026041 Ga0207639_10298956 Ga0207639_102989562 165
535 3300026041 Ga0207639_10494486 Ga0207639_104944862 165
536 3300026067 Ga0207678_10047155 Ga0207678_100471552 165
537 3300026078 Ga0207702_10005967 Ga0207702_1000596710 165
538 3300026078 Ga0207702_10853379 Ga0207702_108533792 165
539 3300026088 Ga0207641_10050841 Ga0207641_100508412 165
540 3300026088 Ga0207641_10122809 Ga0207641_101228092 165
541 3300026089 Ga0207648_10001802 Ga0207648_100018029 165
542 3300026089 Ga0207648_10033330 Ga0207648_100333304 165
543 3300026089 Ga0207648_10479342 Ga0207648_104793421 165
544 3300026095 Ga0207676_10000321 Ga0207676_1000032112 165
545 3300026095 Ga0207676_10010216 Ga0207676_100102165 165
546 3300026116 Ga0207674_10002494 Ga0207674_1000249421 165
547 3300026118 Ga0207675_100001457 Ga0207675_10000145717 165
548 3300026118 Ga0207675_100002290 Ga0207675_1000022907 165
549 3300026118 Ga0207675_100699921 Ga0207675_1006999212 165
550 3300026121 Ga0207683_10000560 Ga0207683_1000056020 165
551 3300026142 Ga0207698_10466482 Ga0207698_104664821 165
552 3300028380 Ga0268265_10615139 Ga0268265_106151392 165
553 3300028381 Ga0268264_10001973 Ga0268264_100019738 165
554 3300028381 Ga0268264_10242666 Ga0268264_102426662 165
555 3300028381 Ga0268264_10277121 Ga0268264_102771211 165
556 3300031238 Ga0265332_10021647 Ga0265332_100216473 165
557 3300031249 Ga0265339_10000248 Ga0265339_1000024836 165
558 3300031344 Ga0265316_10002854 Ga0265316_100028543 165
559 3300031595 Ga0265313_10015875 Ga0265313_100158753 165
560 3300031711 Ga0265314_10000001 Ga0265314_10000001962 165
561 3300031711 Ga0265314_10581360 Ga0265314_105813601 165
562 3300035083 Ga0373926_0031384 Ga0373926_0031384_1232_1732 165
563 3300035086 Ga0373934_0010133 Ga0373934_0010133_872_1372 165
564 3300035086 Ga0373934_0158597 Ga0373934_0158597_247_750 165
565 3300035089 Ga0373944_0075636 Ga0373944_0075636_429_929 165
566 3300035116 Ga0373945_0018850 Ga0373945_0018850_995_1498 165
567 3300035119 Ga0373956_0166267 Ga0373956_0166267_133_633 165
568 3300035120 Ga0373957_0030865 Ga0373957_0030865_1301_1801 165
569 3300035120 Ga0373957_0069706 Ga0373957_0069706_638_1138 165
570 3300035170 Ga0373943_0052145 Ga0373943_0052145_84_584 165
571 3300035170 Ga0373943_0127206 Ga0373943_0127206_154_654 165
572 3300035171 Ga0373946_0007519 Ga0373946_0007519_1113_1613 165
573 3300035172 Ga0373955_0005891 Ga0373955_0005891_1705_2205 165
574 3300035410 Ga0373924_0108093 Ga0373924_0108093_448_948 165
575 3300035692 Ga0373935_0044421 Ga0373935_0044421_1791_2291 165
576 3300035692 Ga0373935_0288218 Ga0373935_0288218_43_543 165
577 3300035695 Ga0373927_0044913 Ga0373927_0044913_2245_2748 165
578 3300035695 Ga0373927_0297729 Ga0373927_0297729_353_856 165
579 3300035695 Ga0373927_0331556 Ga0373927_0331556_483_983 165
580 3300035724 Ga0373933_0022005 Ga0373933_0022005_3057_3557 165
581 3300035725 Ga0373947_0016734 Ga0373947_0016734_1458_1958 165
582 3300035725 Ga0373947_0017986 Ga0373947_0017986_774_1274 165
583 3300036401 Ga0373937_0041017 Ga0373937_0041017_645_1148 165
584 3300036401 Ga0373937_0074317 Ga0373937_0074317_1148_1717 165
585 3300036401 Ga0373937_0107371 Ga0373937_0107371_166_666 165
586 3300037068 Ga0373925_0000590 Ga0373925_0000590_9222_9725 165
587 3300037068 Ga0373925_0049162 Ga0373925_0049162_1155_1655 165
588 3300039438 Ga0436360_0945100 Ga0436360_0945100_166_669 165
589 3300039438 Ga0436360_1348452 Ga0436360_1348452_362_865 165
590 3300039450 Ga0436363_1459367 Ga0436363_1459367_303_806 165
591 3300041452 Ga0451793_0235094 Ga0451793_0235094_73_573 165
592 3300041486 Ga0451807_2295206 Ga0451807_2295206_78_578 165
593 3300044673 Ga0453683_0251882 Ga0453683_0251882_230_736 165
594 3300045051 Ga0451576_0004811 Ga0451576_0004811_1435_1941 165
595 3300046454 Ga0495592_0029324 Ga0495592_0029324_1232_1801 165
596 3300046459 Ga0495629_0004517 Ga0495629_0004517_127_630 165
597 3300046459 Ga0495629_0346996 Ga0495629_0346996_217_717 165
598 3300046461 Ga0495641_0175688 Ga0495641_0175688_212_781 165
599 3300046463 Ga0495653_0105774 Ga0495653_0105774_1336_1905 165
600 3300046472 Ga0495580_0010020 Ga0495580_0010020_786_1289 165
601 3300046472 Ga0495580_0344231 Ga0495580_0344231_425_925 165
602 3300046472 Ga0495580_0389717 Ga0495580_0389717_260_760 165
603 3300046473 Ga0495582_0002001 Ga0495582_0002001_10131_10631 165
604 3300046473 Ga0495582_0169587 Ga0495582_0169587_225_722 165
605 3300046473 Ga0495582_0373482 Ga0495582_0373482_163_732 165
606 3300046475 Ga0495639_0096816 Ga0495639_0096816_882_1379 165
607 3300046475 Ga0495639_0125472 Ga0495639_0125472_331_831 165
608 3300046476 Ga0495662_0011736 Ga0495662_0011736_1437_1940 165
609 3300046476 Ga0495662_0023697 Ga0495662_0023697_1072_1641 165
610 3300046477 Ga0495664_0005933 Ga0495664_0005933_472_972 165
611 3300046477 Ga0495664_0262644 Ga0495664_0262644_69_638 165
612 3300046477 Ga0495664_0425006 Ga0495664_0425006_122_622 165
613 3300046511 Ga0495608_0004898 Ga0495608_0004898_8163_8732 165
614 3300046514 Ga0495618_0070203 Ga0495618_0070203_930_1499 165
615 3300046516 Ga0495628_0000915 Ga0495628_0000915_19610_20179 165
616 3300046517 Ga0495630_0007486 Ga0495630_0007486_1256_1825 165
617 3300046529 Ga0495652_0221040 Ga0495652_0221040_321_890 165
618 3300046531 Ga0495665_0127698 Ga0495665_0127698_531_1034 165
619 3300046533 Ga0495640_0020825 Ga0495640_0020825_2541_3110 165
620 3300046533 Ga0495640_0157869 Ga0495640_0157869_615_1112 165
621 3300046535 Ga0495586_0000698 Ga0495586_0000698_10469_11038 165
622 3300046536 Ga0495587_0012453 Ga0495587_0012453_1960_2529 165
623 3300046536 Ga0495587_0028617 Ga0495587_0028617_2549_3049 165
624 3300046539 Ga0495621_0021020 Ga0495621_0021020_1318_1818 165
625 3300046543 Ga0495645_0006456 Ga0495645_0006456_1831_2331 165
626 3300046559 Ga0495667_0004720 Ga0495667_0004720_5219_5788 165
627 3300046559 Ga0495667_0173461 Ga0495667_0173461_482_985 165
628 3300046642 Ga0495634_0003402 Ga0495634_0003402_3926_4495 165
629 3300046642 Ga0495634_0170024 Ga0495634_0170024_791_1291 165
630 3300046663 Ga0495635_0023563 Ga0495635_0023563_784_1287 165
631 3300046663 Ga0495635_0047563 Ga0495635_0047563_1144_1713 165
632 3300046679 Ga0495623_0162624 Ga0495623_0162624_590_1090 165
633 3300046683 Ga0495658_0092228 Ga0495658_0092228_225_794 165
634 3300046689 Ga0495613_0003488 Ga0495613_0003488_8823_9392 165
635 3300046689 Ga0495613_0126616 Ga0495613_0126616_925_1428 165
636 3300046689 Ga0495613_0672666 Ga0495613_0672666_148_645 165
637 3300046690 Ga0495624_0374256 Ga0495624_0374256_344_844 165
638 3300046809 Ga0495600_0071018 Ga0495600_0071018_1260_1829 165
639 3300046809 Ga0495600_0078997 Ga0495600_0078997_14_517 165
640 3300047315 Ga0495581_0000748 Ga0495581_0000748_15785_16288 165
641 3300047317 Ga0495604_0005164 Ga0495604_0005164_3078_3647 165
642 3300047319 Ga0495674_0100401 Ga0495674_0100401_1637_2137 165
643 3300047319 Ga0495674_0492754 Ga0495674_0492754_304_873 165
644 3300047322 Ga0495680_0004292 Ga0495680_0004292_6583_7152 165
645 3300047322 Ga0495680_0009463 Ga0495680_0009463_3814_4314 165
646 3300047322 Ga0495680_0684177 Ga0495680_0684177_26_526 165
647 3300047444 Ga0495675_0309187 Ga0495675_0309187_297_797 165
648 3300047471 Ga0495684_0074302 Ga0495684_0074302_1233_1802 165
649 3300047471 Ga0495684_0087484 Ga0495684_0087484_1077_1577 165
650 3300047471 Ga0495684_0090417 Ga0495684_0090417_292_792 165
651 3300047673 Ga0495593_0201082 Ga0495593_0201082_242_811 165
652 3300048905 Ga0496102_0146402 Ga0496102_0146402_1631_2128 165
653 3300048905 Ga0496102_0316656 Ga0496102_0316656_708_1208 165
654 3300048906 Ga0496103_0079575 Ga0496103_0079575_16_513 165
655 3300048907 Ga0496104_0351887 Ga0496104_0351887_208_708 165
656 3300048909 Ga0496106_0000002 Ga0496106_0000002_93614_94138 165
657 3300048909 Ga0496106_0171325 Ga0496106_0171325_746_1246 165
658 3300048910 Ga0496107_0670060 Ga0496107_0670060_177_677 165
659 3300048912 Ga0496109_0624444 Ga0496109_0624444_382_882 165
660 3300048915 Ga0496112_0014655 Ga0496112_0014655_1502_2002 165
661 3300048916 Ga0496113_0672280 Ga0496113_0672280_243_740 165
662 3300048916 Ga0496113_0845842 Ga0496113_0845842_154_654 165
663 3300048918 Ga0496115_0131409 Ga0496115_0131409_488_988 165
664 3300048924 Ga0496121_0004950 Ga0496121_0004950_14996_15520 165
665 3300049581 Ga0501047_0240369 Ga0501047_0240369_1086_1589 165
666 3300049592 Ga0501076_0194641 Ga0501076_0194641_779_1279 165
667 3300049824 Ga0501045_0352526 Ga0501045_0352526_488_988 165
668 3300050493 nmdc:mga0k408_481208_c1 nmdc:mga0k408_481208_c1_205_705 165
669 3300050493 nmdc:mga0k408_50078_c1 nmdc:mga0k408_50078_c1_245_748 165
670 3300050494 nmdc:mga06z11_269343_c1 nmdc:mga06z11_269343_c1_447_950 165
671 3300050511 nmdc:mga08y16_334083_c1 nmdc:mga08y16_334083_c1_321_818 165
672 3300050512 nmdc:mga0n895_390491_c1 nmdc:mga0n895_390491_c1_309_809 165
673 3300050512 nmdc:mga0n895_720958_c1 nmdc:mga0n895_720958_c1_219_719 165
674 3300050515 nmdc:mga0a205_1196519_c1 nmdc:mga0a205_1196519_c1_94_594 165
675 3300053077 Ga0495601_0043782 Ga0495601_0043782_855_1424 165
676 3300053084 Ga0495595_0137343 Ga0495595_0137343_215_715 165
677 3300053084 Ga0495595_0166901 Ga0495595_0166901_78_647 165
678 3300053085 Ga0495619_0003508 Ga0495619_0003508_5970_6473 165
679 3300053085 Ga0495619_0290755 Ga0495619_0290755_349_849 165
680 3300053091 Ga0500647_0102184 Ga0500647_0102184_431_934 165
681 3300053094 Ga0500566_0234531 Ga0500566_0234531_101_670 165
682 2162886006 SwRhRL3b_contig_3151609 SwRhRL3b_0432.00001760 166
683 3300005329 Ga0070683_100011148 Ga0070683_1000111484 166
684 3300005333 Ga0070677_10158455 Ga0070677_101584552 166
685 3300005340 Ga0070689_100317734 Ga0070689_1003177342 166
686 3300005353 Ga0070669_100167790 Ga0070669_1001677902 166
687 3300005366 Ga0070659_100985038 Ga0070659_1009850381 166
688 3300005458 Ga0070681_10135171 Ga0070681_101351712 166
689 3300005535 Ga0070684_100244053 Ga0070684_1002440531 166
690 3300005563 Ga0068855_100160365 Ga0068855_1001603653 166
691 3300005564 Ga0070664_100073970 Ga0070664_1000739702 166
692 3300005577 Ga0068857_100444337 Ga0068857_1004443372 166
693 3300005614 Ga0068856_101442375 Ga0068856_1014423752 166
694 3300005616 Ga0068852_101620937 Ga0068852_1016209372 166
695 3300005617 Ga0068859_100498096 Ga0068859_1004980962 166
696 3300006931 Ga0097620_100498100 Ga0097620_1004981002 166
697 3300009093 Ga0105240_10064488 Ga0105240_100644884 166
698 3300009093 Ga0105240_10960933 Ga0105240_109609331 166
699 3300009094 Ga0111539_10277642 Ga0111539_102776422 166
700 3300009174 Ga0105241_10317902 Ga0105241_103179022 166
701 3300009545 Ga0105237_10218975 Ga0105237_102189753 166
702 3300009551 Ga0105238_10048067 Ga0105238_100480675 166
703 3300013100 Ga0157373_10184595 Ga0157373_101845952 166
704 3300013102 Ga0157371_10066746 Ga0157371_100667462 166
705 3300013105 Ga0157369_10036715 Ga0157369_100367156 166
706 3300020070 Ga0206356_10789639 Ga0206356_107896392 166
707 3300020078 Ga0206352_10103059 Ga0206352_101030592 166
708 3300020082 Ga0206353_11834576 Ga0206353_118345762 166
709 3300025909 Ga0207705_10675545 Ga0207705_106755452 166
710 3300025911 Ga0207654_10258994 Ga0207654_102589941 166
711 3300025912 Ga0207707_10243331 Ga0207707_102433312 166
712 3300025913 Ga0207695_10149233 Ga0207695_101492333 166
713 3300025913 Ga0207695_10913973 Ga0207695_109139731 166
714 3300025920 Ga0207649_10142508 Ga0207649_101425082 166
715 3300025926 Ga0207659_10012688 Ga0207659_100126882 166
716 3300025932 Ga0207690_10537734 Ga0207690_105377342 166
717 3300025936 Ga0207670_10659490 Ga0207670_106594902 166
718 3300025944 Ga0207661_10318953 Ga0207661_103189532 166
719 3300025945 Ga0207679_10428914 Ga0207679_104289142 166
720 3300025949 Ga0207667_10049086 Ga0207667_100490863 166
721 3300025949 Ga0207667_10629151 Ga0207667_106291512 166
722 3300026041 Ga0207639_10094355 Ga0207639_100943553 166
723 3300026095 Ga0207676_10763772 Ga0207676_107637722 166
724 3300026116 Ga0207674_10085917 Ga0207674_100859174 166
725 3300028379 Ga0268266_10144234 Ga0268266_101442342 166
726 3300037312 Ga0395899_0030853 Ga0395899_0030853_2583_3095 166
727 3300037418 Ga0395900_0022094 Ga0395900_0022094_5134_5649 166
728 3300037418 Ga0395900_0046752 Ga0395900_0046752_2585_3097 166
729 3300037466 Ga0395898_0057947 Ga0395898_0057947_2601_3113 166
730 3300038443 Ga0395901_0013320 Ga0395901_0013320_2693_3205 166
731 3300038443 Ga0395901_0018343 Ga0395901_0018343_6132_6647 166
732 3300039437 Ga0436365_1399826 Ga0436365_1399826_30_530 166
733 3300045051 Ga0451576_0353048 Ga0451576_0353048_416_916 166
734 3300048915 Ga0496112_0573926 Ga0496112_0573926_221_736 166
735 3300049571 Ga0501034_0126534 Ga0501034_0126534_1634_2146 166
736 3300059477 Ga0587084_012657 Ga0587084_012657_449_964 166
737 3300059490 Ga0587066_031447 Ga0587066_031447_358_873 166
738 3300059503 Ga0587080_045216 Ga0587080_045216_229_795 166
739 3300059503 Ga0587080_047059 Ga0587080_047059_272_784 166
740 3300059510 Ga0587090_039217 Ga0587090_039217_83_598 166
741 3300059510 Ga0587090_068009 Ga0587090_068009_68_580 166
742 3300059514 Ga0587095_022840 Ga0587095_022840_89_601 166
743 3300059623 Ga0587101_053164 Ga0587101_053164_98_610 166
744 3300059642 Ga0587069_052312 Ga0587069_052312_141_656 166
745 3300059654 Ga0587110_039579 Ga0587110_039579_77_592 166
746 3300060344 Ga0587071_030440 Ga0587071_030440_238_753 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

149

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e5d-assembly1.cif.gz_A-2 crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution 0.8338 5 130
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.8303 1 136
2p7q-assembly4.cif.gz_D-2 crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid 0.8199 1 136
2p7l-assembly4.cif.gz_A crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 0.8157 1 137
2p7p-assembly4.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.811 1 138
ID Description Score Start End Superfamily
af_Q2FZ81_10_141_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8299 5 133 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8226 3 135 3.10.180.10
3e5dA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8164 4 130 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8132 1 64 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8123 6 129 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A523JZR9-F1-model_v4 VOC family protein 0.9727 1 134
AF-A0A537MQR2-F1-model_v4 VOC family protein 0.9702 1 120
AF-A0A523JZR9-F1-model_v4 VOC family protein 0.9657 1 134
AF-A0A3D5I989-F1-model_v4 VOC family protein 0.9622 1 148
AF-A0A537MQR2-F1-model_v4 VOC family protein 0.9547 1 120

Feature Viewer

pLDDT pTM Quality
91.18 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map