F478899
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 357 | 746 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300059503|Ga0587080_045216|Ga0587080_045216_229_795 |
| Length | 188 |
| Sequence | MRAAVLAPPPVAALAKGRSTVIKGLHHNAYRCRDSEETRRFYEGFLGLPLVNALRIKESMTGRRTDVLHTFYQMDDGSCLAFFEAPDRPFDFKDQHDYDLHIALEVDYETLKRMFEKGKAEGREVRGISDHRFIHSIYFRDPNGYVIELTAKVAGHERDMDPTANHARDILNRWQVHKRKAHADAAAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 244 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 245 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 309 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 342 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 345 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.45 |
| Metatranscriptomes | 2.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.34 |
| Nodule | 0 |
| Rhizoplane | 3.08 |
| Rhizosphere | 94.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3151609 | 2162886006 | Bacteria | 1479 |
| 2 | rootH1_10075528 | 3300003323 | Bacteria | 1816 |
| 3 | Ga0065715_10164226 | 3300005293 | Bacteria | 1601 |
| 4 | Ga0070658_10008608 | 3300005327 | Bacteria | 8204 |
| 5 | Ga0070676_10021860 | 3300005328 | Bacteria | 3583 |
| 6 | Ga0070683_100011148 | 3300005329 | Bacteria | 7755 |
| 7 | Ga0070683_100478517 | 3300005329 | Bacteria | 1189 |
| 8 | Ga0070683_100676024 | 3300005329 | Bacteria | 989 |
| 9 | Ga0070690_100402429 | 3300005330 | Bacteria | 1006 |
| 10 | Ga0070690_100760030 | 3300005330 | Bacteria | 749 |
| 11 | Ga0070670_100001648 | 3300005331 | Bacteria | 18088 |
| 12 | Ga0070670_100004471 | 3300005331 | Bacteria | 11710 |
| 13 | Ga0070677_10158455 | 3300005333 | Bacteria | 1060 |
| 14 | Ga0068869_100054630 | 3300005334 | Bacteria | 2908 |
| 15 | Ga0068869_100156996 | 3300005334 | Bacteria | 1768 |
| 16 | Ga0068869_100360526 | 3300005334 | Unclassified | 1187 |
| 17 | Ga0070666_10005247 | 3300005335 | Bacteria | 7938 |
| 18 | Ga0070666_10437788 | 3300005335 | Bacteria | 943 |
| 19 | Ga0070680_100008942 | 3300005336 | Bacteria | 7679 |
| 20 | Ga0070680_100054427 | 3300005336 | Bacteria | 3268 |
| 21 | Ga0070682_100256385 | 3300005337 | Unclassified | 1264 |
| 22 | Ga0068868_100034757 | 3300005338 | Bacteria | 3893 |
| 23 | Ga0068868_100070854 | 3300005338 | Bacteria | 2780 |
| 24 | Ga0068868_100090667 | 3300005338 | Bacteria | 2462 |
| 25 | Ga0068868_101594796 | 3300005338 | Unclassified | 613 |
| 26 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 27 | Ga0070689_100190659 | 3300005340 | Bacteria | 1669 |
| 28 | Ga0070689_100317734 | 3300005340 | Bacteria | 1300 |
| 29 | Ga0070689_100348852 | 3300005340 | Bacteria | 1241 |
| 30 | Ga0070687_100258947 | 3300005343 | Bacteria | 1085 |
| 31 | Ga0070661_100264486 | 3300005344 | Bacteria | 1330 |
| 32 | Ga0070661_100653090 | 3300005344 | Bacteria | 854 |
| 33 | Ga0070692_10218759 | 3300005345 | Bacteria | 1125 |
| 34 | Ga0070668_100076494 | 3300005347 | Bacteria | 2615 |
| 35 | Ga0070668_100568488 | 3300005347 | Bacteria | 988 |
| 36 | Ga0070669_100021986 | 3300005353 | Bacteria | 4561 |
| 37 | Ga0070669_100167790 | 3300005353 | Bacteria | 1710 |
| 38 | Ga0070675_100012952 | 3300005354 | Bacteria | 6546 |
| 39 | Ga0070671_100052255 | 3300005355 | Bacteria | 3398 |
| 40 | Ga0070671_100168887 | 3300005355 | Bacteria | 1850 |
| 41 | Ga0070674_100005400 | 3300005356 | Bacteria | 7377 |
| 42 | Ga0070674_100013861 | 3300005356 | Bacteria | 4994 |
| 43 | Ga0070674_100082001 | 3300005356 | Bacteria | 2306 |
| 44 | Ga0070673_100027600 | 3300005364 | Bacteria | 4210 |
| 45 | Ga0070673_100043909 | 3300005364 | Bacteria | 3458 |
| 46 | Ga0070673_100167299 | 3300005364 | Bacteria | 1874 |
| 47 | Ga0070673_101180202 | 3300005364 | Bacteria | 717 |
| 48 | Ga0070688_100007711 | 3300005365 | Bacteria | 5812 |
| 49 | Ga0070688_100099785 | 3300005365 | Bacteria | 1912 |
| 50 | Ga0070688_100151679 | 3300005365 | Bacteria | 1585 |
| 51 | Ga0070659_100015338 | 3300005366 | Bacteria | 5738 |
| 52 | Ga0070659_100281287 | 3300005366 | Bacteria | 1384 |
| 53 | Ga0070659_100441060 | 3300005366 | Unclassified | 1103 |
| 54 | Ga0070659_100985038 | 3300005366 | Bacteria | 740 |
| 55 | Ga0070667_100020332 | 3300005367 | Bacteria | 5511 |
| 56 | Ga0070667_100045960 | 3300005367 | Bacteria | 3672 |
| 57 | Ga0070667_100630537 | 3300005367 | Bacteria | 989 |
| 58 | Ga0070709_10151533 | 3300005434 | Unclassified | 1603 |
| 59 | Ga0070709_10256229 | 3300005434 | Unclassified | 1262 |
| 60 | Ga0070713_100017271 | 3300005436 | Bacteria | 5453 |
| 61 | Ga0070710_10027580 | 3300005437 | Bacteria | 3030 |
| 62 | Ga0070710_10729193 | 3300005437 | Bacteria | 702 |
| 63 | Ga0070701_10122702 | 3300005438 | Unclassified | 1466 |
| 64 | Ga0070711_100008755 | 3300005439 | Bacteria | 6210 |
| 65 | Ga0070711_100247380 | 3300005439 | Bacteria | 1397 |
| 66 | Ga0070705_100009497 | 3300005440 | Bacteria | 4838 |
| 67 | Ga0070705_100304261 | 3300005440 | Bacteria | 1144 |
| 68 | Ga0070705_100388048 | 3300005440 | Unclassified | 1030 |
| 69 | Ga0070705_100606499 | 3300005440 | Bacteria | 848 |
| 70 | Ga0070700_100074201 | 3300005441 | Bacteria | 2179 |
| 71 | Ga0070700_100081740 | 3300005441 | Bacteria | 2088 |
| 72 | Ga0070700_100114080 | 3300005441 | Bacteria | 1801 |
| 73 | Ga0070694_100594094 | 3300005444 | Bacteria | 891 |
| 74 | Ga0070708_100071466 | 3300005445 | Bacteria | 3124 |
| 75 | Ga0070663_100027987 | 3300005455 | Bacteria | 3833 |
| 76 | Ga0070663_100337405 | 3300005455 | Bacteria | 1217 |
| 77 | Ga0070662_100043586 | 3300005457 | Unclassified | 3211 |
| 78 | Ga0070662_101227184 | 3300005457 | Bacteria | 645 |
| 79 | Ga0070681_10112230 | 3300005458 | Bacteria | 2665 |
| 80 | Ga0070681_10135171 | 3300005458 | Bacteria | 2397 |
| 81 | Ga0068867_100009475 | 3300005459 | Bacteria | 6867 |
| 82 | Ga0068867_100100538 | 3300005459 | Unclassified | 2208 |
| 83 | Ga0068867_100405712 | 3300005459 | Bacteria | 1151 |
| 84 | Ga0068867_101249573 | 3300005459 | Bacteria | 684 |
| 85 | Ga0070685_10008871 | 3300005466 | Bacteria | 5185 |
| 86 | Ga0070685_10585130 | 3300005466 | Bacteria | 801 |
| 87 | Ga0070706_100023816 | 3300005467 | Bacteria | 5637 |
| 88 | Ga0070706_100335196 | 3300005467 | Bacteria | 1410 |
| 89 | Ga0070707_100012864 | 3300005468 | Bacteria | 7815 |
| 90 | Ga0070707_100034532 | 3300005468 | Bacteria | 4824 |
| 91 | Ga0070707_100473545 | 3300005468 | Bacteria | 1214 |
| 92 | Ga0070698_100104741 | 3300005471 | Bacteria | 2798 |
| 93 | Ga0070698_100385728 | 3300005471 | Bacteria | 1334 |
| 94 | Ga0070698_100400351 | 3300005471 | Bacteria | 1306 |
| 95 | Ga0070699_100035398 | 3300005518 | Bacteria | 4316 |
| 96 | Ga0070679_100008815 | 3300005530 | Bacteria | 9516 |
| 97 | Ga0070679_100159253 | 3300005530 | Bacteria | 2232 |
| 98 | Ga0070679_100379975 | 3300005530 | Bacteria | 1359 |
| 99 | Ga0070679_101262591 | 3300005530 | Bacteria | 684 |
| 100 | Ga0070684_100244053 | 3300005535 | Bacteria | 1641 |
| 101 | Ga0070684_100342925 | 3300005535 | Bacteria | 1374 |
| 102 | Ga0070684_100372397 | 3300005535 | Unclassified | 1315 |
| 103 | Ga0070684_101128391 | 3300005535 | Bacteria | 737 |
| 104 | Ga0070697_100196093 | 3300005536 | Bacteria | 1715 |
| 105 | Ga0070697_101101454 | 3300005536 | Bacteria | 707 |
| 106 | Ga0068853_100009346 | 3300005539 | Bacteria | 7903 |
| 107 | Ga0068853_100103460 | 3300005539 | Bacteria | 2520 |
| 108 | Ga0068853_100116101 | 3300005539 | Bacteria | 2383 |
| 109 | Ga0068853_100704304 | 3300005539 | Bacteria | 963 |
| 110 | Ga0070672_100097994 | 3300005543 | Bacteria | 2374 |
| 111 | Ga0070672_100280352 | 3300005543 | Bacteria | 1409 |
| 112 | Ga0070686_100231182 | 3300005544 | Unclassified | 1341 |
| 113 | Ga0070686_100400329 | 3300005544 | Bacteria | 1044 |
| 114 | Ga0070686_100779429 | 3300005544 | Bacteria | 769 |
| 115 | Ga0070695_100057718 | 3300005545 | Bacteria | 2508 |
| 116 | Ga0070695_100059955 | 3300005545 | Bacteria | 2466 |
| 117 | Ga0070695_100069841 | 3300005545 | Bacteria | 2296 |
| 118 | Ga0070696_100549765 | 3300005546 | Bacteria | 925 |
| 119 | Ga0070696_100983667 | 3300005546 | Bacteria | 704 |
| 120 | Ga0070696_101025179 | 3300005546 | Bacteria | 690 |
| 121 | Ga0070693_100010214 | 3300005547 | Bacteria | 4696 |
| 122 | Ga0070693_100098545 | 3300005547 | Bacteria | 1776 |
| 123 | Ga0070693_100165341 | 3300005547 | Bacteria | 1413 |
| 124 | Ga0070693_100378553 | 3300005547 | Bacteria | 976 |
| 125 | Ga0070665_100433940 | 3300005548 | Bacteria | 1323 |
| 126 | Ga0070704_100052785 | 3300005549 | Bacteria | 2870 |
| 127 | Ga0070704_100097687 | 3300005549 | Bacteria | 2205 |
| 128 | Ga0070704_100225977 | 3300005549 | Bacteria | 1524 |
| 129 | Ga0070704_100826432 | 3300005549 | Archaea | 829 |
| 130 | Ga0068855_100029744 | 3300005563 | Bacteria | 6532 |
| 131 | Ga0068855_100119530 | 3300005563 | Bacteria | 3017 |
| 132 | Ga0068855_100131875 | 3300005563 | Bacteria | 2853 |
| 133 | Ga0068855_100160365 | 3300005563 | Bacteria | 2553 |
| 134 | Ga0070664_100073970 | 3300005564 | Bacteria | 2924 |
| 135 | Ga0070664_100811992 | 3300005564 | Bacteria | 875 |
| 136 | Ga0068857_100010399 | 3300005577 | Bacteria | 8086 |
| 137 | Ga0068857_100444337 | 3300005577 | Bacteria | 1212 |
| 138 | Ga0068857_100795241 | 3300005577 | Bacteria | 903 |
| 139 | Ga0068857_101581863 | 3300005577 | Bacteria | 640 |
| 140 | Ga0068854_100024272 | 3300005578 | Bacteria | 4149 |
| 141 | Ga0068854_100584982 | 3300005578 | Bacteria | 951 |
| 142 | Ga0068856_100067551 | 3300005614 | Bacteria | 3533 |
| 143 | Ga0068856_100490020 | 3300005614 | Bacteria | 1250 |
| 144 | Ga0068856_100762411 | 3300005614 | Bacteria | 988 |
| 145 | Ga0068856_101442375 | 3300005614 | Bacteria | 702 |
| 146 | Ga0070702_100004222 | 3300005615 | Bacteria | 6539 |
| 147 | Ga0070702_100063146 | 3300005615 | Unclassified | 2161 |
| 148 | Ga0070702_100104733 | 3300005615 | Bacteria | 1742 |
| 149 | Ga0070702_100931185 | 3300005615 | Bacteria | 683 |
| 150 | Ga0068852_100775206 | 3300005616 | Bacteria | 972 |
| 151 | Ga0068852_101620937 | 3300005616 | Bacteria | 670 |
| 152 | Ga0068859_100001347 | 3300005617 | Bacteria | 25058 |
| 153 | Ga0068859_100009108 | 3300005617 | Bacteria | 10023 |
| 154 | Ga0068859_100016297 | 3300005617 | Bacteria | 7466 |
| 155 | Ga0068859_100016980 | 3300005617 | Bacteria | 7306 |
| 156 | Ga0068859_100063206 | 3300005617 | Bacteria | 3732 |
| 157 | Ga0068859_100076147 | 3300005617 | Bacteria | 3396 |
| 158 | Ga0068859_100498096 | 3300005617 | Bacteria | 1313 |
| 159 | Ga0068859_101280555 | 3300005617 | Bacteria | 808 |
| 160 | Ga0068864_100000918 | 3300005618 | Bacteria | 24714 |
| 161 | Ga0068864_100001786 | 3300005618 | Bacteria | 17662 |
| 162 | Ga0068864_100002127 | 3300005618 | Bacteria | 16380 |
| 163 | Ga0068864_100483635 | 3300005618 | Bacteria | 1189 |
| 164 | Ga0068866_10011885 | 3300005718 | Bacteria | 3782 |
| 165 | Ga0068866_10034994 | 3300005718 | Bacteria | 2450 |
| 166 | Ga0068861_100002626 | 3300005719 | Bacteria | 11748 |
| 167 | Ga0068861_100032259 | 3300005719 | Bacteria | 3855 |
| 168 | Ga0068861_100279582 | 3300005719 | Bacteria | 1437 |
| 169 | Ga0068870_10035490 | 3300005840 | Bacteria | 2559 |
| 170 | Ga0068863_100039160 | 3300005841 | Bacteria | 4510 |
| 171 | Ga0068863_100071294 | 3300005841 | Bacteria | 3287 |
| 172 | Ga0068863_100274601 | 3300005841 | Bacteria | 1632 |
| 173 | Ga0068863_100797441 | 3300005841 | Bacteria | 942 |
| 174 | Ga0068858_100000924 | 3300005842 | Bacteria | 30445 |
| 175 | Ga0068858_100005298 | 3300005842 | Bacteria | 12648 |
| 176 | Ga0068858_100071185 | 3300005842 | Bacteria | 3225 |
| 177 | Ga0068858_100708678 | 3300005842 | Bacteria | 980 |
| 178 | Ga0068858_101058701 | 3300005842 | Bacteria | 796 |
| 179 | Ga0068860_100006411 | 3300005843 | Bacteria | 11811 |
| 180 | Ga0068860_100056397 | 3300005843 | Bacteria | 3735 |
| 181 | Ga0068860_100077578 | 3300005843 | Bacteria | 3159 |
| 182 | Ga0068860_101090758 | 3300005843 | Bacteria | 818 |
| 183 | Ga0068862_100108368 | 3300005844 | Bacteria | 2436 |
| 184 | Ga0068862_100244201 | 3300005844 | Bacteria | 1634 |
| 185 | Ga0068862_100486305 | 3300005844 | Bacteria | 1169 |
| 186 | Ga0068862_100850609 | 3300005844 | Bacteria | 894 |
| 187 | Ga0068862_101649774 | 3300005844 | Bacteria | 649 |
| 188 | Ga0081455_10051004 | 3300005937 | Bacteria | 3552 |
| 189 | Ga0081538_10026343 | 3300005981 | Bacteria | 4068 |
| 190 | Ga0081539_10077478 | 3300005985 | Bacteria | 1758 |
| 191 | Ga0070716_100009552 | 3300006173 | Bacteria | 4836 |
| 192 | Ga0070716_100564865 | 3300006173 | Unclassified | 850 |
| 193 | Ga0070712_100017504 | 3300006175 | Bacteria | 4640 |
| 194 | Ga0070712_100102871 | 3300006175 | Bacteria | 2116 |
| 195 | Ga0075366_10185611 | 3300006195 | Bacteria | 1263 |
| 196 | Ga0097621_100029079 | 3300006237 | Bacteria | 4362 |
| 197 | Ga0097621_100087682 | 3300006237 | Bacteria | 2599 |
| 198 | Ga0097621_100281678 | 3300006237 | Unclassified | 1463 |
| 199 | Ga0097621_100558056 | 3300006237 | Bacteria | 1043 |
| 200 | Ga0068871_100101076 | 3300006358 | Unclassified | 2416 |
| 201 | Ga0068871_100106556 | 3300006358 | Bacteria | 2353 |
| 202 | Ga0068871_100208550 | 3300006358 | Bacteria | 1689 |
| 203 | Ga0068871_101462686 | 3300006358 | Bacteria | 645 |
| 204 | Ga0075428_100024555 | 3300006844 | Bacteria | 6669 |
| 205 | Ga0075430_100139328 | 3300006846 | Bacteria | 2020 |
| 206 | Ga0075431_100149430 | 3300006847 | Bacteria | 2406 |
| 207 | Ga0075431_100215328 | 3300006847 | Bacteria | 1961 |
| 208 | Ga0075431_100449419 | 3300006847 | Bacteria | 1284 |
| 209 | Ga0075433_10255373 | 3300006852 | Bacteria | 1555 |
| 210 | Ga0075434_100048545 | 3300006871 | Bacteria | 4212 |
| 211 | Ga0075434_100335790 | 3300006871 | Bacteria | 1532 |
| 212 | Ga0075434_100632506 | 3300006871 | Bacteria | 1089 |
| 213 | Ga0075429_100005681 | 3300006880 | Bacteria | 10755 |
| 214 | Ga0075429_100028299 | 3300006880 | Bacteria | 4867 |
| 215 | Ga0068865_100021637 | 3300006881 | Bacteria | 4185 |
| 216 | Ga0068865_100032117 | 3300006881 | Bacteria | 3505 |
| 217 | Ga0068865_100240758 | 3300006881 | Bacteria | 1423 |
| 218 | Ga0075436_100295790 | 3300006914 | Bacteria | 1160 |
| 219 | Ga0097620_100001347 | 3300006931 | Bacteria | 25058 |
| 220 | Ga0097620_100009108 | 3300006931 | Bacteria | 10023 |
| 221 | Ga0097620_100016298 | 3300006931 | Bacteria | 7466 |
| 222 | Ga0097620_100016978 | 3300006931 | Bacteria | 7306 |
| 223 | Ga0097620_100063209 | 3300006931 | Bacteria | 3732 |
| 224 | Ga0097620_100076149 | 3300006931 | Bacteria | 3396 |
| 225 | Ga0097620_100498100 | 3300006931 | Bacteria | 1313 |
| 226 | Ga0075435_100398110 | 3300007076 | Bacteria | 1184 |
| 227 | Ga0105240_10000262 | 3300009093 | Bacteria | 104268 |
| 228 | Ga0105240_10064488 | 3300009093 | Bacteria | 4551 |
| 229 | Ga0105240_10074462 | 3300009093 | Bacteria | 4191 |
| 230 | Ga0105240_10322796 | 3300009093 | Bacteria | 1759 |
| 231 | Ga0105240_10960933 | 3300009093 | Bacteria | 916 |
| 232 | Ga0111539_10001915 | 3300009094 | Bacteria | 27718 |
| 233 | Ga0111539_10008405 | 3300009094 | Bacteria | 13136 |
| 234 | Ga0111539_10202553 | 3300009094 | Bacteria | 2314 |
| 235 | Ga0111539_10226885 | 3300009094 | Bacteria | 2175 |
| 236 | Ga0111539_10272125 | 3300009094 | Bacteria | 1971 |
| 237 | Ga0111539_10277642 | 3300009094 | Bacteria | 1950 |
| 238 | Ga0111539_11890469 | 3300009094 | Bacteria | 692 |
| 239 | Ga0111539_12127390 | 3300009094 | Bacteria | 651 |
| 240 | Ga0105245_10001111 | 3300009098 | Bacteria | 24332 |
| 241 | Ga0105245_10203801 | 3300009098 | Bacteria | 1901 |
| 242 | Ga0105245_10220818 | 3300009098 | Bacteria | 1828 |
| 243 | Ga0105245_10319309 | 3300009098 | Bacteria | 1529 |
| 244 | Ga0105247_10062341 | 3300009101 | Bacteria | 2313 |
| 245 | Ga0105247_10519944 | 3300009101 | Bacteria | 870 |
| 246 | Ga0105247_10892238 | 3300009101 | Bacteria | 686 |
| 247 | Ga0114129_10306609 | 3300009147 | Bacteria | 2115 |
| 248 | Ga0114129_10536455 | 3300009147 | Bacteria | 1523 |
| 249 | Ga0105243_10187232 | 3300009148 | Bacteria | 1805 |
| 250 | Ga0105243_12145826 | 3300009148 | Bacteria | 595 |
| 251 | Ga0105241_10123324 | 3300009174 | Bacteria | 2089 |
| 252 | Ga0105241_10317902 | 3300009174 | Bacteria | 1341 |
| 253 | Ga0105241_10860204 | 3300009174 | Unclassified | 839 |
| 254 | Ga0105242_10005080 | 3300009176 | Bacteria | 10163 |
| 255 | Ga0105242_10238437 | 3300009176 | Bacteria | 1634 |
| 256 | Ga0105242_11513231 | 3300009176 | Bacteria | 702 |
| 257 | Ga0105242_12504600 | 3300009176 | Bacteria | 564 |
| 258 | Ga0105248_10044422 | 3300009177 | Bacteria | 4982 |
| 259 | Ga0105248_10686561 | 3300009177 | Bacteria | 1155 |
| 260 | Ga0105248_11165236 | 3300009177 | Unclassified | 871 |
| 261 | Ga0105237_10000050 | 3300009545 | Bacteria | 160580 |
| 262 | Ga0105237_10218975 | 3300009545 | Bacteria | 1904 |
| 263 | Ga0105237_10226871 | 3300009545 | Bacteria | 1868 |
| 264 | Ga0105238_10006468 | 3300009551 | Bacteria | 11653 |
| 265 | Ga0105238_10048067 | 3300009551 | Bacteria | 4300 |
| 266 | Ga0105238_10195374 | 3300009551 | Bacteria | 1999 |
| 267 | Ga0105238_10238650 | 3300009551 | Bacteria | 1795 |
| 268 | Ga0105238_10367873 | 3300009551 | Unclassified | 1428 |
| 269 | Ga0105249_10063930 | 3300009553 | Bacteria | 3382 |
| 270 | Ga0105249_10232752 | 3300009553 | Bacteria | 1818 |
| 271 | Ga0105249_10950003 | 3300009553 | Bacteria | 927 |
| 272 | Ga0105249_11055910 | 3300009553 | Bacteria | 882 |
| 273 | Ga0105239_11421605 | 3300010375 | Unclassified | 801 |
| 274 | Ga0105246_10210366 | 3300011119 | Unclassified | 1518 |
| 275 | Ga0105246_11039353 | 3300011119 | Bacteria | 744 |
| 276 | Ga0157373_10184595 | 3300013100 | Bacteria | 1469 |
| 277 | Ga0157371_10066746 | 3300013102 | Bacteria | 2547 |
| 278 | Ga0157370_10354958 | 3300013104 | Bacteria | 1351 |
| 279 | Ga0157369_10036715 | 3300013105 | Bacteria | 5367 |
| 280 | Ga0157374_10006996 | 3300013296 | Bacteria | 9603 |
| 281 | Ga0157374_10120474 | 3300013296 | Bacteria | 2532 |
| 282 | Ga0157374_10198327 | 3300013296 | Bacteria | 1965 |
| 283 | Ga0157378_10009382 | 3300013297 | Bacteria | 8525 |
| 284 | Ga0157378_10298084 | 3300013297 | Bacteria | 1559 |
| 285 | Ga0157378_10452792 | 3300013297 | Bacteria | 1274 |
| 286 | Ga0163162_11671577 | 3300013306 | Bacteria | 727 |
| 287 | Ga0157372_10284909 | 3300013307 | Bacteria | 1921 |
| 288 | Ga0157375_10040858 | 3300013308 | Bacteria | 4474 |
| 289 | Ga0157375_10347676 | 3300013308 | Unclassified | 1648 |
| 290 | Ga0157375_10740154 | 3300013308 | Bacteria | 1135 |
| 291 | Ga0163163_10009374 | 3300014325 | Bacteria | 8738 |
| 292 | Ga0163163_10020582 | 3300014325 | Bacteria | 6216 |
| 293 | Ga0163163_10051526 | 3300014325 | Bacteria | 4059 |
| 294 | Ga0163163_10577761 | 3300014325 | Unclassified | 1187 |
| 295 | Ga0157380_10047719 | 3300014326 | Bacteria | 3369 |
| 296 | Ga0157380_10052814 | 3300014326 | Bacteria | 3219 |
| 297 | Ga0157380_10400827 | 3300014326 | Bacteria | 1302 |
| 298 | Ga0157380_11624197 | 3300014326 | Bacteria | 702 |
| 299 | Ga0157377_10453072 | 3300014745 | Bacteria | 886 |
| 300 | Ga0157379_10004817 | 3300014968 | Bacteria | 11596 |
| 301 | Ga0157379_10258098 | 3300014968 | Bacteria | 1583 |
| 302 | Ga0157376_10382483 | 3300014969 | Unclassified | 1356 |
| 303 | Ga0157376_11569476 | 3300014969 | Bacteria | 692 |
| 304 | Ga0163161_10382436 | 3300017792 | Bacteria | 1125 |
| 305 | Ga0163161_10610016 | 3300017792 | Bacteria | 900 |
| 306 | Ga0206356_10789639 | 3300020070 | Bacteria | 1046 |
| 307 | Ga0206352_10103059 | 3300020078 | Bacteria | 883 |
| 308 | Ga0206350_10936070 | 3300020080 | Bacteria | 793 |
| 309 | Ga0206350_11280726 | 3300020080 | Bacteria | 755 |
| 310 | Ga0206354_10692315 | 3300020081 | Bacteria | 904 |
| 311 | Ga0206353_11834576 | 3300020082 | Bacteria | 1121 |
| 312 | Ga0154015_1046432 | 3300020610 | Bacteria | 690 |
| 313 | Ga0213873_10160452 | 3300021358 | Bacteria | 681 |
| 314 | Ga0213871_10001206 | 3300021441 | Bacteria | 4179 |
| 315 | Ga0224712_10270614 | 3300022467 | Bacteria | 789 |
| 316 | Ga0207697_10366283 | 3300025315 | Bacteria | 640 |
| 317 | Ga0207692_10082197 | 3300025898 | Bacteria | 1725 |
| 318 | Ga0207642_10173920 | 3300025899 | Bacteria | 1167 |
| 319 | Ga0207642_10224331 | 3300025899 | Bacteria | 1052 |
| 320 | Ga0207642_10587705 | 3300025899 | Bacteria | 692 |
| 321 | Ga0207710_10015110 | 3300025900 | Bacteria | 3260 |
| 322 | Ga0207688_10233703 | 3300025901 | Bacteria | 1110 |
| 323 | Ga0207688_10568588 | 3300025901 | Bacteria | 713 |
| 324 | Ga0207680_10023548 | 3300025903 | Bacteria | 3365 |
| 325 | Ga0207680_10087485 | 3300025903 | Unclassified | 1973 |
| 326 | Ga0207680_10261756 | 3300025903 | Bacteria | 1197 |
| 327 | Ga0207685_10013464 | 3300025905 | Bacteria | 2531 |
| 328 | Ga0207699_10019156 | 3300025906 | Bacteria | 3643 |
| 329 | Ga0207699_10079175 | 3300025906 | Bacteria | 2032 |
| 330 | Ga0207645_10019696 | 3300025907 | Bacteria | 4422 |
| 331 | Ga0207645_10889148 | 3300025907 | Unclassified | 605 |
| 332 | Ga0207643_10040021 | 3300025908 | Bacteria | 2638 |
| 333 | Ga0207705_10020349 | 3300025909 | Bacteria | 4744 |
| 334 | Ga0207705_10675545 | 3300025909 | Bacteria | 803 |
| 335 | Ga0207684_10020818 | 3300025910 | Bacteria | 5603 |
| 336 | Ga0207684_10166713 | 3300025910 | Bacteria | 1898 |
| 337 | Ga0207654_10004656 | 3300025911 | Bacteria | 6935 |
| 338 | Ga0207654_10258994 | 3300025911 | Bacteria | 1169 |
| 339 | Ga0207707_10192067 | 3300025912 | Bacteria | 1781 |
| 340 | Ga0207707_10243331 | 3300025912 | Bacteria | 1563 |
| 341 | Ga0207707_10273001 | 3300025912 | Bacteria | 1465 |
| 342 | Ga0207695_10003817 | 3300025913 | Bacteria | 20883 |
| 343 | Ga0207695_10149233 | 3300025913 | Bacteria | 2278 |
| 344 | Ga0207695_10181541 | 3300025913 | Bacteria | 2025 |
| 345 | Ga0207695_10913973 | 3300025913 | Bacteria | 757 |
| 346 | Ga0207671_10019884 | 3300025914 | Bacteria | 5124 |
| 347 | Ga0207693_10026174 | 3300025915 | Bacteria | 4619 |
| 348 | Ga0207693_10101821 | 3300025915 | Bacteria | 2252 |
| 349 | Ga0207663_10074486 | 3300025916 | Bacteria | 2200 |
| 350 | Ga0207660_10154413 | 3300025917 | Bacteria | 1766 |
| 351 | Ga0207657_10012272 | 3300025919 | Bacteria | 8465 |
| 352 | Ga0207649_10142508 | 3300025920 | Bacteria | 1642 |
| 353 | Ga0207649_10640605 | 3300025920 | Bacteria | 820 |
| 354 | Ga0207649_11197673 | 3300025920 | Unclassified | 600 |
| 355 | Ga0207652_10015622 | 3300025921 | Bacteria | 6179 |
| 356 | Ga0207652_10020675 | 3300025921 | Bacteria | 5425 |
| 357 | Ga0207652_10167925 | 3300025921 | Bacteria | 1968 |
| 358 | Ga0207652_10442788 | 3300025921 | Bacteria | 1171 |
| 359 | Ga0207646_10121417 | 3300025922 | Bacteria | 2347 |
| 360 | Ga0207681_10140706 | 3300025923 | Bacteria | 1796 |
| 361 | Ga0207681_10328691 | 3300025923 | Bacteria | 1218 |
| 362 | Ga0207681_10690833 | 3300025923 | Bacteria | 848 |
| 363 | Ga0207694_10003133 | 3300025924 | Bacteria | 13228 |
| 364 | Ga0207694_10273682 | 3300025924 | Bacteria | 1385 |
| 365 | Ga0207650_10015581 | 3300025925 | Bacteria | 5297 |
| 366 | Ga0207650_10092270 | 3300025925 | Bacteria | 2316 |
| 367 | Ga0207650_10143773 | 3300025925 | Bacteria | 1877 |
| 368 | Ga0207659_10012688 | 3300025926 | Bacteria | 5375 |
| 369 | Ga0207659_10165082 | 3300025926 | Bacteria | 1742 |
| 370 | Ga0207659_10410620 | 3300025926 | Bacteria | 1134 |
| 371 | Ga0207687_10000792 | 3300025927 | Bacteria | 21334 |
| 372 | Ga0207687_10021109 | 3300025927 | Bacteria | 4323 |
| 373 | Ga0207687_10028889 | 3300025927 | Bacteria | 3727 |
| 374 | Ga0207700_10009373 | 3300025928 | Bacteria | 6111 |
| 375 | Ga0207664_10242129 | 3300025929 | Bacteria | 1571 |
| 376 | Ga0207644_10201637 | 3300025931 | Bacteria | 1570 |
| 377 | Ga0207644_10369856 | 3300025931 | Bacteria | 1167 |
| 378 | Ga0207690_10451017 | 3300025932 | Bacteria | 1034 |
| 379 | Ga0207690_10537734 | 3300025932 | Bacteria | 949 |
| 380 | Ga0207706_10022997 | 3300025933 | Bacteria | 5597 |
| 381 | Ga0207706_10166599 | 3300025933 | Bacteria | 1936 |
| 382 | Ga0207706_11003956 | 3300025933 | Bacteria | 701 |
| 383 | Ga0207706_11122926 | 3300025933 | Bacteria | 656 |
| 384 | Ga0207686_10000643 | 3300025934 | Bacteria | 21534 |
| 385 | Ga0207686_10569602 | 3300025934 | Bacteria | 888 |
| 386 | Ga0207686_10704516 | 3300025934 | Bacteria | 803 |
| 387 | Ga0207709_10114978 | 3300025935 | Bacteria | 1806 |
| 388 | Ga0207709_10295624 | 3300025935 | Unclassified | 1202 |
| 389 | Ga0207670_10000011 | 3300025936 | Bacteria | 266639 |
| 390 | Ga0207670_10100286 | 3300025936 | Bacteria | 2067 |
| 391 | Ga0207670_10200333 | 3300025936 | Bacteria | 1516 |
| 392 | Ga0207670_10413798 | 3300025936 | Bacteria | 1080 |
| 393 | Ga0207670_10659490 | 3300025936 | Bacteria | 863 |
| 394 | Ga0207669_10030571 | 3300025937 | Unclassified | 2994 |
| 395 | Ga0207669_10074279 | 3300025937 | Bacteria | 2149 |
| 396 | Ga0207704_10028106 | 3300025938 | Bacteria | 3115 |
| 397 | Ga0207704_10072463 | 3300025938 | Bacteria | 2190 |
| 398 | Ga0207704_10254352 | 3300025938 | Bacteria | 1321 |
| 399 | Ga0207665_10006482 | 3300025939 | Bacteria | 7762 |
| 400 | Ga0207665_10007475 | 3300025939 | Bacteria | 7221 |
| 401 | Ga0207691_10317585 | 3300025940 | Bacteria | 1336 |
| 402 | Ga0207691_10375502 | 3300025940 | Bacteria | 1214 |
| 403 | Ga0207711_10000841 | 3300025941 | Bacteria | 29654 |
| 404 | Ga0207711_10202967 | 3300025941 | Bacteria | 1810 |
| 405 | Ga0207711_10362735 | 3300025941 | Bacteria | 1342 |
| 406 | Ga0207689_10000042 | 3300025942 | Bacteria | 93077 |
| 407 | Ga0207689_10098125 | 3300025942 | Bacteria | 2406 |
| 408 | Ga0207689_10259163 | 3300025942 | Unclassified | 1438 |
| 409 | Ga0207689_10364843 | 3300025942 | Unclassified | 1201 |
| 410 | Ga0207689_10647650 | 3300025942 | Bacteria | 890 |
| 411 | Ga0207689_10757065 | 3300025942 | Bacteria | 820 |
| 412 | Ga0207661_10269918 | 3300025944 | Bacteria | 1518 |
| 413 | Ga0207661_10318953 | 3300025944 | Bacteria | 1396 |
| 414 | Ga0207679_10428914 | 3300025945 | Bacteria | 1168 |
| 415 | Ga0207667_10049086 | 3300025949 | Bacteria | 4460 |
| 416 | Ga0207667_10104113 | 3300025949 | Bacteria | 2927 |
| 417 | Ga0207667_10629151 | 3300025949 | Bacteria | 1080 |
| 418 | Ga0207651_10005645 | 3300025960 | Bacteria | 6449 |
| 419 | Ga0207651_10028595 | 3300025960 | Bacteria | 3519 |
| 420 | Ga0207651_10243783 | 3300025960 | Bacteria | 1466 |
| 421 | Ga0207651_10478385 | 3300025960 | Bacteria | 1073 |
| 422 | Ga0207651_10482934 | 3300025960 | Bacteria | 1068 |
| 423 | Ga0207712_10117038 | 3300025961 | Bacteria | 2009 |
| 424 | Ga0207712_10146338 | 3300025961 | Bacteria | 1819 |
| 425 | Ga0207668_10008926 | 3300025972 | Bacteria | 5996 |
| 426 | Ga0207668_10038683 | 3300025972 | Bacteria | 3204 |
| 427 | Ga0207668_10198223 | 3300025972 | Bacteria | 1597 |
| 428 | Ga0207668_10246020 | 3300025972 | Bacteria | 1450 |
| 429 | Ga0207668_10497162 | 3300025972 | Bacteria | 1048 |
| 430 | Ga0207640_10009528 | 3300025981 | Bacteria | 5439 |
| 431 | Ga0207640_10674081 | 3300025981 | Bacteria | 884 |
| 432 | Ga0207658_10067312 | 3300025986 | Bacteria | 2697 |
| 433 | Ga0207658_10174812 | 3300025986 | Bacteria | 1772 |
| 434 | Ga0207658_10799841 | 3300025986 | Bacteria | 856 |
| 435 | Ga0207677_10000387 | 3300026023 | Bacteria | 30319 |
| 436 | Ga0207677_10050315 | 3300026023 | Bacteria | 2818 |
| 437 | Ga0207677_10144882 | 3300026023 | Bacteria | 1824 |
| 438 | Ga0207703_10001656 | 3300026035 | Bacteria | 20008 |
| 439 | Ga0207703_10066974 | 3300026035 | Bacteria | 2955 |
| 440 | Ga0207703_11083279 | 3300026035 | Bacteria | 770 |
| 441 | Ga0207639_10094355 | 3300026041 | Bacteria | 2402 |
| 442 | Ga0207639_10175758 | 3300026041 | Bacteria | 1818 |
| 443 | Ga0207639_10298956 | 3300026041 | Bacteria | 1422 |
| 444 | Ga0207639_10494486 | 3300026041 | Bacteria | 1116 |
| 445 | Ga0207639_11925959 | 3300026041 | Bacteria | 552 |
| 446 | Ga0207678_10011990 | 3300026067 | Bacteria | 7611 |
| 447 | Ga0207678_10047155 | 3300026067 | Bacteria | 3727 |
| 448 | Ga0207708_10063137 | 3300026075 | Bacteria | 2830 |
| 449 | Ga0207708_10122879 | 3300026075 | Bacteria | 2024 |
| 450 | Ga0207708_10218378 | 3300026075 | Bacteria | 1527 |
| 451 | Ga0207708_10458748 | 3300026075 | Bacteria | 1063 |
| 452 | Ga0207702_10005967 | 3300026078 | Bacteria | 10580 |
| 453 | Ga0207702_10174329 | 3300026078 | Bacteria | 1975 |
| 454 | Ga0207702_10853379 | 3300026078 | Bacteria | 901 |
| 455 | Ga0207641_10050841 | 3300026088 | Bacteria | 3508 |
| 456 | Ga0207641_10122809 | 3300026088 | Bacteria | 2320 |
| 457 | Ga0207641_10325624 | 3300026088 | Bacteria | 1458 |
| 458 | Ga0207648_10001802 | 3300026089 | Bacteria | 23480 |
| 459 | Ga0207648_10033330 | 3300026089 | Bacteria | 4543 |
| 460 | Ga0207648_10096629 | 3300026089 | Bacteria | 2585 |
| 461 | Ga0207648_10146549 | 3300026089 | Bacteria | 2082 |
| 462 | Ga0207648_10236136 | 3300026089 | Bacteria | 1627 |
| 463 | Ga0207648_10479342 | 3300026089 | Bacteria | 1136 |
| 464 | Ga0207676_10000321 | 3300026095 | Bacteria | 41273 |
| 465 | Ga0207676_10010216 | 3300026095 | Bacteria | 6678 |
| 466 | Ga0207676_10080329 | 3300026095 | Bacteria | 2646 |
| 467 | Ga0207676_10399000 | 3300026095 | Bacteria | 1285 |
| 468 | Ga0207676_10763772 | 3300026095 | Bacteria | 941 |
| 469 | Ga0207674_10002494 | 3300026116 | Bacteria | 23211 |
| 470 | Ga0207674_10085917 | 3300026116 | Bacteria | 3140 |
| 471 | Ga0207674_11292007 | 3300026116 | Bacteria | 699 |
| 472 | Ga0207675_100001457 | 3300026118 | Bacteria | 23724 |
| 473 | Ga0207675_100002290 | 3300026118 | Bacteria | 19014 |
| 474 | Ga0207675_100008960 | 3300026118 | Bacteria | 9388 |
| 475 | Ga0207675_100100666 | 3300026118 | Bacteria | 2722 |
| 476 | Ga0207675_100699921 | 3300026118 | Bacteria | 1022 |
| 477 | Ga0207675_100799938 | 3300026118 | Bacteria | 956 |
| 478 | Ga0207683_10000560 | 3300026121 | Bacteria | 34398 |
| 479 | Ga0207698_10466482 | 3300026142 | Bacteria | 1222 |
| 480 | Ga0209999_1011300 | 3300027543 | Bacteria | 1616 |
| 481 | Ga0209999_1041480 | 3300027543 | Unclassified | 863 |
| 482 | Ga0209982_1014676 | 3300027552 | Bacteria | 1185 |
| 483 | Ga0209970_1009340 | 3300027614 | Bacteria | 1602 |
| 484 | Ga0209966_1002775 | 3300027695 | Bacteria | 2934 |
| 485 | Ga0207428_10004753 | 3300027907 | Bacteria | 12842 |
| 486 | Ga0268266_10144234 | 3300028379 | Bacteria | 2139 |
| 487 | Ga0268266_10305428 | 3300028379 | Bacteria | 1485 |
| 488 | Ga0268265_10615139 | 3300028380 | Bacteria | 1040 |
| 489 | Ga0268265_10696734 | 3300028380 | Bacteria | 981 |
| 490 | Ga0268265_11508562 | 3300028380 | Bacteria | 676 |
| 491 | Ga0268264_10001973 | 3300028381 | Bacteria | 18439 |
| 492 | Ga0268264_10242666 | 3300028381 | Bacteria | 1669 |
| 493 | Ga0268264_10277121 | 3300028381 | Bacteria | 1569 |
| 494 | Ga0268264_10422946 | 3300028381 | Bacteria | 1285 |
| 495 | Ga0265332_10021647 | 3300031238 | Bacteria | 2839 |
| 496 | Ga0265320_10111765 | 3300031240 | Bacteria | 1251 |
| 497 | Ga0265339_10000248 | 3300031249 | Bacteria | 43570 |
| 498 | Ga0265316_10002854 | 3300031344 | Bacteria | 17682 |
| 499 | Ga0307513_10363528 | 3300031456 | Bacteria | 1191 |
| 500 | Ga0307408_100170733 | 3300031548 | Bacteria | 1736 |
| 501 | Ga0265313_10015875 | 3300031595 | Bacteria | 4357 |
| 502 | Ga0265313_10068272 | 3300031595 | Bacteria | 1643 |
| 503 | Ga0307508_10103265 | 3300031616 | Bacteria | 2447 |
| 504 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 505 | Ga0265314_10581360 | 3300031711 | Bacteria | 579 |
| 506 | Ga0265342_10045808 | 3300031712 | Bacteria | 2631 |
| 507 | Ga0307412_10473369 | 3300031911 | Bacteria | 1037 |
| 508 | Ga0307416_100166858 | 3300032002 | Bacteria | 2043 |
| 509 | Ga0373926_0031384 | 3300035083 | Bacteria | 1873 |
| 510 | Ga0373934_0010133 | 3300035086 | Bacteria | 3539 |
| 511 | Ga0373934_0158597 | 3300035086 | Bacteria | 928 |
| 512 | Ga0373944_0075636 | 3300035089 | Bacteria | 1104 |
| 513 | Ga0373923_0184299 | 3300035111 | Bacteria | 960 |
| 514 | Ga0373945_0018850 | 3300035116 | Bacteria | 2351 |
| 515 | Ga0373953_0043984 | 3300035117 | Bacteria | 1784 |
| 516 | Ga0373954_0006090 | 3300035118 | Bacteria | 5249 |
| 517 | Ga0373956_0017921 | 3300035119 | Bacteria | 2993 |
| 518 | Ga0373956_0166267 | 3300035119 | Bacteria | 1040 |
| 519 | Ga0373956_0378562 | 3300035119 | Bacteria | 675 |
| 520 | Ga0373957_0002940 | 3300035120 | Bacteria | 4938 |
| 521 | Ga0373957_0030865 | 3300035120 | Bacteria | 1966 |
| 522 | Ga0373957_0069706 | 3300035120 | Bacteria | 1373 |
| 523 | Ga0373943_0052145 | 3300035170 | Bacteria | 2016 |
| 524 | Ga0373943_0127206 | 3300035170 | Unclassified | 1360 |
| 525 | Ga0373946_0007519 | 3300035171 | Bacteria | 3985 |
| 526 | Ga0373955_0005891 | 3300035172 | Bacteria | 5541 |
| 527 | Ga0373955_0008584 | 3300035172 | Bacteria | 4751 |
| 528 | Ga0373961_0030097 | 3300035241 | Bacteria | 1508 |
| 529 | Ga0373924_0108093 | 3300035410 | Unclassified | 1200 |
| 530 | Ga0373924_0335314 | 3300035410 | Bacteria | 673 |
| 531 | Ga0373935_0044421 | 3300035692 | Bacteria | 2800 |
| 532 | Ga0373935_0288218 | 3300035692 | Bacteria | 1157 |
| 533 | Ga0373927_0044913 | 3300035695 | Bacteria | 2858 |
| 534 | Ga0373927_0297729 | 3300035695 | Bacteria | 1062 |
| 535 | Ga0373927_0331556 | 3300035695 | Bacteria | 1002 |
| 536 | Ga0373933_0022005 | 3300035724 | Bacteria | 3627 |
| 537 | Ga0373933_0052624 | 3300035724 | Bacteria | 2437 |
| 538 | Ga0373947_0016734 | 3300035725 | Bacteria | 4213 |
| 539 | Ga0373947_0017986 | 3300035725 | Bacteria | 4067 |
| 540 | Ga0373937_0015812 | 3300036401 | Bacteria | 6684 |
| 541 | Ga0373937_0041017 | 3300036401 | Bacteria | 4221 |
| 542 | Ga0373937_0074317 | 3300036401 | Bacteria | 3136 |
| 543 | Ga0373937_0107371 | 3300036401 | Bacteria | 2595 |
| 544 | Ga0373937_0338733 | 3300036401 | Bacteria | 1424 |
| 545 | Ga0373925_0000590 | 3300037068 | Bacteria | 34985 |
| 546 | Ga0373925_0005479 | 3300037068 | Bacteria | 9449 |
| 547 | Ga0373925_0049162 | 3300037068 | Bacteria | 3143 |
| 548 | Ga0395899_0030853 | 3300037312 | Bacteria | 4029 |
| 549 | Ga0395900_0022094 | 3300037418 | Bacteria | 6508 |
| 550 | Ga0395900_0046752 | 3300037418 | Bacteria | 4456 |
| 551 | Ga0395898_0057947 | 3300037466 | Bacteria | 3772 |
| 552 | Ga0436364_1477909 | 3300037853 | Bacteria | 1101 |
| 553 | Ga0395901_0013320 | 3300038443 | Bacteria | 8353 |
| 554 | Ga0395901_0018343 | 3300038443 | Bacteria | 7144 |
| 555 | Ga0395901_0404854 | 3300038443 | Bacteria | 1401 |
| 556 | Ga0436365_1399826 | 3300039437 | Bacteria | 781 |
| 557 | Ga0436360_0281756 | 3300039438 | Bacteria | 727 |
| 558 | Ga0436360_0945100 | 3300039438 | Bacteria | 6705 |
| 559 | Ga0436360_1348452 | 3300039438 | Bacteria | 1570 |
| 560 | Ga0436361_1004545 | 3300039447 | Bacteria | 679 |
| 561 | Ga0436363_1459367 | 3300039450 | Bacteria | 911 |
| 562 | Ga0436362_0819930 | 3300039453 | Bacteria | 1162 |
| 563 | Ga0451793_0235094 | 3300041452 | Bacteria | 607 |
| 564 | Ga0451807_2295206 | 3300041486 | Unclassified | 609 |
| 565 | Ga0439443_001304 | 3300042003 | Bacteria | 2693 |
| 566 | Ga0439435_0001712 | 3300042436 | Bacteria | 4152 |
| 567 | Ga0453683_0251882 | 3300044673 | Bacteria | 1126 |
| 568 | Ga0466963_0193097 | 3300044694 | Bacteria | 1423 |
| 569 | Ga0451576_0004811 | 3300045051 | Bacteria | 17299 |
| 570 | Ga0451576_0353048 | 3300045051 | Bacteria | 1539 |
| 571 | Ga0466958_0768647 | 3300045836 | Unclassified | 628 |
| 572 | Ga0466967_0512318 | 3300045976 | Bacteria | 1178 |
| 573 | Ga0495592_0029324 | 3300046454 | Bacteria | 4167 |
| 574 | Ga0495629_0004517 | 3300046459 | Bacteria | 10406 |
| 575 | Ga0495629_0346996 | 3300046459 | Bacteria | 1013 |
| 576 | Ga0495641_0175688 | 3300046461 | Bacteria | 958 |
| 577 | Ga0495651_0702827 | 3300046462 | Bacteria | 630 |
| 578 | Ga0495653_0105774 | 3300046463 | Bacteria | 2031 |
| 579 | Ga0495580_0010020 | 3300046472 | Bacteria | 7411 |
| 580 | Ga0495580_0344231 | 3300046472 | Bacteria | 1011 |
| 581 | Ga0495580_0389717 | 3300046472 | Bacteria | 940 |
| 582 | Ga0495582_0002001 | 3300046473 | Bacteria | 11415 |
| 583 | Ga0495582_0169587 | 3300046473 | Bacteria | 1242 |
| 584 | Ga0495582_0373482 | 3300046473 | Bacteria | 822 |
| 585 | Ga0495639_0096816 | 3300046475 | Bacteria | 1390 |
| 586 | Ga0495639_0125472 | 3300046475 | Bacteria | 1226 |
| 587 | Ga0495662_0011736 | 3300046476 | Bacteria | 4282 |
| 588 | Ga0495662_0023697 | 3300046476 | Bacteria | 2964 |
| 589 | Ga0495664_0005933 | 3300046477 | Bacteria | 6727 |
| 590 | Ga0495664_0262644 | 3300046477 | Bacteria | 1044 |
| 591 | Ga0495664_0425006 | 3300046477 | Unclassified | 797 |
| 592 | Ga0495608_0004898 | 3300046511 | Bacteria | 9586 |
| 593 | Ga0495618_0070203 | 3300046514 | Bacteria | 2227 |
| 594 | Ga0495618_0298661 | 3300046514 | Bacteria | 1001 |
| 595 | Ga0495628_0000915 | 3300046516 | Bacteria | 27087 |
| 596 | Ga0495630_0007486 | 3300046517 | Bacteria | 7804 |
| 597 | Ga0495663_0075729 | 3300046525 | Bacteria | 1077 |
| 598 | Ga0495663_0087499 | 3300046525 | Bacteria | 1011 |
| 599 | Ga0495642_0079165 | 3300046528 | Bacteria | 1382 |
| 600 | Ga0495652_0142094 | 3300046529 | Bacteria | 1887 |
| 601 | Ga0495652_0221040 | 3300046529 | Bacteria | 1423 |
| 602 | Ga0495665_0127698 | 3300046531 | Bacteria | 1331 |
| 603 | Ga0495640_0020825 | 3300046533 | Bacteria | 4819 |
| 604 | Ga0495640_0157869 | 3300046533 | Bacteria | 1455 |
| 605 | Ga0495586_0000698 | 3300046535 | Bacteria | 19053 |
| 606 | Ga0495587_0012453 | 3300046536 | Bacteria | 5353 |
| 607 | Ga0495587_0028617 | 3300046536 | Bacteria | 3388 |
| 608 | Ga0495587_0398914 | 3300046536 | Bacteria | 764 |
| 609 | Ga0495598_0007922 | 3300046537 | Bacteria | 2457 |
| 610 | Ga0495621_0021020 | 3300046539 | Bacteria | 2148 |
| 611 | Ga0495621_0286167 | 3300046539 | Bacteria | 680 |
| 612 | Ga0495645_0006456 | 3300046543 | Bacteria | 8136 |
| 613 | Ga0495667_0004720 | 3300046559 | Bacteria | 9213 |
| 614 | Ga0495667_0173461 | 3300046559 | Bacteria | 1385 |
| 615 | Ga0495667_0394094 | 3300046559 | Bacteria | 872 |
| 616 | Ga0495656_0007785 | 3300046615 | Bacteria | 3803 |
| 617 | Ga0495656_0037933 | 3300046615 | Bacteria | 1993 |
| 618 | Ga0495668_0372347 | 3300046616 | Unclassified | 784 |
| 619 | Ga0495634_0003402 | 3300046642 | Bacteria | 12776 |
| 620 | Ga0495634_0170024 | 3300046642 | Bacteria | 1370 |
| 621 | Ga0495635_0023563 | 3300046663 | Bacteria | 4287 |
| 622 | Ga0495635_0047563 | 3300046663 | Bacteria | 2958 |
| 623 | Ga0495588_0057887 | 3300046674 | Bacteria | 2003 |
| 624 | Ga0495623_0162624 | 3300046679 | Unclassified | 1311 |
| 625 | Ga0495658_0092228 | 3300046683 | Bacteria | 1795 |
| 626 | Ga0495669_0163967 | 3300046684 | Bacteria | 1055 |
| 627 | Ga0495613_0003488 | 3300046689 | Bacteria | 11768 |
| 628 | Ga0495613_0126616 | 3300046689 | Bacteria | 1831 |
| 629 | Ga0495613_0672666 | 3300046689 | Unclassified | 683 |
| 630 | Ga0495624_0374256 | 3300046690 | Unclassified | 856 |
| 631 | Ga0495600_0071018 | 3300046809 | Bacteria | 2275 |
| 632 | Ga0495600_0078997 | 3300046809 | Bacteria | 2148 |
| 633 | Ga0495581_0000748 | 3300047315 | Bacteria | 17240 |
| 634 | Ga0495604_0005164 | 3300047317 | Bacteria | 10338 |
| 635 | Ga0495636_0014976 | 3300047318 | Bacteria | 3088 |
| 636 | Ga0495636_0390461 | 3300047318 | Bacteria | 662 |
| 637 | Ga0495674_0100401 | 3300047319 | Bacteria | 2463 |
| 638 | Ga0495674_0492754 | 3300047319 | Bacteria | 981 |
| 639 | Ga0495680_0004292 | 3300047322 | Bacteria | 13673 |
| 640 | Ga0495680_0009463 | 3300047322 | Bacteria | 8763 |
| 641 | Ga0495680_0684177 | 3300047322 | Unclassified | 679 |
| 642 | Ga0495675_0309187 | 3300047444 | Bacteria | 937 |
| 643 | Ga0495675_0345641 | 3300047444 | Bacteria | 876 |
| 644 | Ga0495677_0059048 | 3300047445 | Bacteria | 1420 |
| 645 | Ga0495684_0074302 | 3300047471 | Bacteria | 2583 |
| 646 | Ga0495684_0087484 | 3300047471 | Bacteria | 2361 |
| 647 | Ga0495684_0090417 | 3300047471 | Bacteria | 2319 |
| 648 | Ga0495593_0201082 | 3300047673 | Bacteria | 1001 |
| 649 | Ga0496100_0582065 | 3300048903 | Bacteria | 868 |
| 650 | Ga0496102_0146402 | 3300048905 | Bacteria | 2217 |
| 651 | Ga0496102_0316656 | 3300048905 | Bacteria | 1470 |
| 652 | Ga0496103_0079575 | 3300048906 | Bacteria | 2060 |
| 653 | Ga0496104_0351887 | 3300048907 | Unclassified | 1386 |
| 654 | Ga0496104_1201085 | 3300048907 | Bacteria | 662 |
| 655 | Ga0496105_0384267 | 3300048908 | Bacteria | 1117 |
| 656 | Ga0496106_0000002 | 3300048909 | Bacteria | 377020 |
| 657 | Ga0496106_0171325 | 3300048909 | Bacteria | 1721 |
| 658 | Ga0496106_0418544 | 3300048909 | Bacteria | 1077 |
| 659 | Ga0496107_0670060 | 3300048910 | Bacteria | 764 |
| 660 | Ga0496109_0624444 | 3300048912 | Bacteria | 1014 |
| 661 | Ga0496112_0014655 | 3300048915 | Bacteria | 7285 |
| 662 | Ga0496112_0289240 | 3300048915 | Bacteria | 1585 |
| 663 | Ga0496112_0529515 | 3300048915 | Bacteria | 1113 |
| 664 | Ga0496112_0573926 | 3300048915 | Bacteria | 1061 |
| 665 | Ga0496113_0672280 | 3300048916 | Bacteria | 827 |
| 666 | Ga0496113_0845842 | 3300048916 | Bacteria | 725 |
| 667 | Ga0496114_0106711 | 3300048917 | Bacteria | 2396 |
| 668 | Ga0496114_0595426 | 3300048917 | Bacteria | 975 |
| 669 | Ga0496115_0131409 | 3300048918 | Unclassified | 2064 |
| 670 | Ga0496121_0004950 | 3300048924 | Bacteria | 17473 |
| 671 | Ga0501032_0677794 | 3300049569 | Bacteria | 654 |
| 672 | Ga0501034_0126534 | 3300049571 | Bacteria | 2540 |
| 673 | Ga0501034_0315929 | 3300049571 | Bacteria | 1496 |
| 674 | Ga0501041_0685584 | 3300049577 | Bacteria | 655 |
| 675 | Ga0501042_0068598 | 3300049578 | Bacteria | 2536 |
| 676 | Ga0501043_0179933 | 3300049579 | Bacteria | 1648 |
| 677 | Ga0501046_0168402 | 3300049580 | Bacteria | 1645 |
| 678 | Ga0501047_0240369 | 3300049581 | Bacteria | 1662 |
| 679 | Ga0501067_0443892 | 3300049583 | Bacteria | 724 |
| 680 | Ga0501069_0174337 | 3300049585 | Bacteria | 1242 |
| 681 | Ga0501070_0299282 | 3300049586 | Bacteria | 1311 |
| 682 | Ga0501071_0017767 | 3300049587 | Bacteria | 4913 |
| 683 | Ga0501073_0039619 | 3300049589 | Bacteria | 3337 |
| 684 | Ga0501073_0106149 | 3300049589 | Bacteria | 1949 |
| 685 | Ga0501075_0362120 | 3300049591 | Bacteria | 1105 |
| 686 | Ga0501075_0415172 | 3300049591 | Bacteria | 1026 |
| 687 | Ga0501076_0194641 | 3300049592 | Bacteria | 1655 |
| 688 | Ga0501079_0039824 | 3300049741 | Bacteria | 3626 |
| 689 | Ga0501079_1325898 | 3300049741 | Bacteria | 567 |
| 690 | Ga0501080_0176954 | 3300049742 | Bacteria | 1965 |
| 691 | Ga0501080_0290527 | 3300049742 | Bacteria | 1484 |
| 692 | Ga0501081_0127322 | 3300049743 | Bacteria | 1817 |
| 693 | Ga0501083_0044412 | 3300049744 | Bacteria | 3008 |
| 694 | Ga0501035_1114745 | 3300049822 | Bacteria | 616 |
| 695 | Ga0501045_0352526 | 3300049824 | Bacteria | 1095 |
| 696 | nmdc:mga0k408_481208_c1 | 3300050493 | Bacteria | 736 |
| 697 | nmdc:mga0k408_50078_c1 | 3300050493 | Bacteria | 2418 |
| 698 | nmdc:mga06z11_269343_c1 | 3300050494 | Bacteria | 1007 |
| 699 | nmdc:mga05p37_718862_c1 | 3300050507 | Bacteria | 1106 |
| 700 | nmdc:mga05p37_893525_c1 | 3300050507 | Bacteria | 959 |
| 701 | nmdc:mga09592_4118_c1 | 3300050508 | Bacteria | 11745 |
| 702 | nmdc:mga09592_746504_c1 | 3300050508 | Bacteria | 831 |
| 703 | nmdc:mga09592_9052_c1 | 3300050508 | Bacteria | 8093 |
| 704 | nmdc:mga09592_982617_c1 | 3300050508 | Bacteria | 706 |
| 705 | nmdc:mga06r32_180407_c1 | 3300050510 | Bacteria | 2097 |
| 706 | nmdc:mga06r32_308625_c1 | 3300050510 | Bacteria | 1568 |
| 707 | nmdc:mga08y16_206328_c1 | 3300050511 | Bacteria | 2036 |
| 708 | nmdc:mga08y16_334083_c1 | 3300050511 | Bacteria | 1558 |
| 709 | nmdc:mga08y16_4633_c1 | 3300050511 | Bacteria | 14327 |
| 710 | nmdc:mga08y16_92120_c1 | 3300050511 | Bacteria | 3158 |
| 711 | nmdc:mga0n895_390491_c1 | 3300050512 | Bacteria | 1408 |
| 712 | nmdc:mga0n895_431072_c1 | 3300050512 | Bacteria | 1332 |
| 713 | nmdc:mga0n895_458627_c1 | 3300050512 | Bacteria | 1286 |
| 714 | nmdc:mga0n895_720958_c1 | 3300050512 | Bacteria | 992 |
| 715 | nmdc:mga0rr50_795250_c1 | 3300050513 | Bacteria | 807 |
| 716 | nmdc:mga0a205_1196519_c1 | 3300050515 | Bacteria | 608 |
| 717 | Ga0495601_0043782 | 3300053077 | Bacteria | 2811 |
| 718 | Ga0495601_0276660 | 3300053077 | Bacteria | 1095 |
| 719 | Ga0495595_0137343 | 3300053084 | Bacteria | 1198 |
| 720 | Ga0495595_0166901 | 3300053084 | Bacteria | 1088 |
| 721 | Ga0495595_0332930 | 3300053084 | Bacteria | 765 |
| 722 | Ga0495619_0003508 | 3300053085 | Bacteria | 10115 |
| 723 | Ga0495619_0290755 | 3300053085 | Bacteria | 1132 |
| 724 | Ga0500647_0102184 | 3300053091 | Bacteria | 1368 |
| 725 | Ga0500566_0234531 | 3300053094 | Bacteria | 903 |
| 726 | Ga0500658_0078495 | 3300053134 | Bacteria | 1407 |
| 727 | Ga0500658_0452414 | 3300053134 | Bacteria | 584 |
| 728 | Ga0500568_0015816 | 3300053139 | Bacteria | 3368 |
| 729 | Ga0500588_0134871 | 3300053146 | Bacteria | 882 |
| 730 | Ga0501084_0115150 | 3300054114 | Bacteria | 2260 |
| 731 | Ga0501084_0452721 | 3300054114 | Bacteria | 1085 |
| 732 | Ga0587084_012657 | 3300059477 | Bacteria | 1146 |
| 733 | Ga0587066_031447 | 3300059490 | Bacteria | 949 |
| 734 | Ga0587080_045216 | 3300059503 | Bacteria | 815 |
| 735 | Ga0587080_047059 | 3300059503 | Bacteria | 804 |
| 736 | Ga0587090_039217 | 3300059510 | Bacteria | 827 |
| 737 | Ga0587090_068009 | 3300059510 | Bacteria | 690 |
| 738 | Ga0587095_022840 | 3300059514 | Bacteria | 611 |
| 739 | Ga0587101_053164 | 3300059623 | Bacteria | 703 |
| 740 | Ga0587069_052312 | 3300059642 | Bacteria | 730 |
| 741 | Ga0587110_039579 | 3300059654 | Bacteria | 602 |
| 742 | Ga0587071_030440 | 3300060344 | Bacteria | 1037 |
| 743 | Ga0501082_0171616 | 3300060353 | Bacteria | 1886 |
| 744 | Ga0501082_0340263 | 3300060353 | Bacteria | 1307 |
| 745 | Ga0501082_0936510 | 3300060353 | Bacteria | 758 |
| 746 | Ga0530510_0243931 | 3300061734 | Bacteria | 1338 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005549 | Ga0070704_100826432 | Ga0070704_1008264321 | 148 |
| 2 | 3300005844 | Ga0068862_100850609 | Ga0068862_1008506092 | 152 |
| 3 | 3300026095 | Ga0207676_10399000 | Ga0207676_103990002 | 153 |
| 4 | 3300028380 | Ga0268265_11508562 | Ga0268265_115085622 | 154 |
| 5 | 3300003323 | rootH1_10075528 | rootH1_100755282 | 155 |
| 6 | 3300038443 | Ga0395901_0404854 | Ga0395901_0404854_120_596 | 155 |
| 7 | 3300005471 | Ga0070698_100400351 | Ga0070698_1004003513 | 156 |
| 8 | 3300045976 | Ga0466967_0512318 | Ga0466967_0512318_603_1076 | 157 |
| 9 | 3300005336 | Ga0070680_100054427 | Ga0070680_1000544273 | 158 |
| 10 | 3300005530 | Ga0070679_100008815 | Ga0070679_10000881510 | 158 |
| 11 | 3300005981 | Ga0081538_10026343 | Ga0081538_100263436 | 158 |
| 12 | 3300006846 | Ga0075430_100139328 | Ga0075430_1001393283 | 158 |
| 13 | 3300006847 | Ga0075431_100149430 | Ga0075431_1001494303 | 158 |
| 14 | 3300006880 | Ga0075429_100005681 | Ga0075429_1000056813 | 158 |
| 15 | 3300025921 | Ga0207652_10167925 | Ga0207652_101679252 | 158 |
| 16 | 3300050508 | nmdc:mga09592_4118_c1 | nmdc:mga09592_4118_c1_9529_10005 | 158 |
| 17 | 3300050510 | nmdc:mga06r32_180407_c1 | nmdc:mga06r32_180407_c1_779_1255 | 158 |
| 18 | 3300005355 | Ga0070671_100168887 | Ga0070671_1001688872 | 159 |
| 19 | 3300005440 | Ga0070705_100606499 | Ga0070705_1006064991 | 159 |
| 20 | 3300005937 | Ga0081455_10051004 | Ga0081455_100510044 | 159 |
| 21 | 3300006880 | Ga0075429_100028299 | Ga0075429_1000282994 | 159 |
| 22 | 3300009094 | Ga0111539_10001915 | Ga0111539_100019154 | 159 |
| 23 | 3300025934 | Ga0207686_10704516 | Ga0207686_107045162 | 159 |
| 24 | 3300027543 | Ga0209999_1041480 | Ga0209999_10414801 | 159 |
| 25 | 3300027907 | Ga0207428_10004753 | Ga0207428_100047537 | 159 |
| 26 | 3300035241 | Ga0373961_0030097 | Ga0373961_0030097_604_1083 | 159 |
| 27 | 3300046537 | Ga0495598_0007922 | Ga0495598_0007922_523_1002 | 159 |
| 28 | 3300046539 | Ga0495621_0286167 | Ga0495621_0286167_132_611 | 159 |
| 29 | 3300046615 | Ga0495656_0007785 | Ga0495656_0007785_1853_2332 | 159 |
| 30 | 3300050507 | nmdc:mga05p37_893525_c1 | nmdc:mga05p37_893525_c1_237_719 | 159 |
| 31 | 3300050508 | nmdc:mga09592_9052_c1 | nmdc:mga09592_9052_c1_4471_4953 | 159 |
| 32 | 3300050511 | nmdc:mga08y16_4633_c1 | nmdc:mga08y16_4633_c1_7983_8465 | 159 |
| 33 | 3300005577 | Ga0068857_101581863 | Ga0068857_1015818631 | 160 |
| 34 | 3300005844 | Ga0068862_100486305 | Ga0068862_1004863052 | 160 |
| 35 | 3300006173 | Ga0070716_100564865 | Ga0070716_1005648652 | 160 |
| 36 | 3300007076 | Ga0075435_100398110 | Ga0075435_1003981102 | 160 |
| 37 | 3300009093 | Ga0105240_10074462 | Ga0105240_100744626 | 160 |
| 38 | 3300014326 | Ga0157380_11624197 | Ga0157380_116241972 | 160 |
| 39 | 3300025913 | Ga0207695_10181541 | Ga0207695_101815413 | 160 |
| 40 | 3300025933 | Ga0207706_11003956 | Ga0207706_110039562 | 160 |
| 41 | 3300026116 | Ga0207674_11292007 | Ga0207674_112920072 | 160 |
| 42 | 3300046525 | Ga0495663_0087499 | Ga0495663_0087499_225_707 | 160 |
| 43 | 3300046528 | Ga0495642_0079165 | Ga0495642_0079165_590_1072 | 160 |
| 44 | 3300046615 | Ga0495656_0037933 | Ga0495656_0037933_1243_1725 | 160 |
| 45 | 3300046674 | Ga0495588_0057887 | Ga0495588_0057887_184_666 | 160 |
| 46 | 3300046684 | Ga0495669_0163967 | Ga0495669_0163967_558_1040 | 160 |
| 47 | 3300047318 | Ga0495636_0390461 | Ga0495636_0390461_51_533 | 160 |
| 48 | 3300047445 | Ga0495677_0059048 | Ga0495677_0059048_405_887 | 160 |
| 49 | 3300048917 | Ga0496114_0106711 | Ga0496114_0106711_1788_2270 | 160 |
| 50 | 3300050512 | nmdc:mga0n895_458627_c1 | nmdc:mga0n895_458627_c1_101_583 | 160 |
| 51 | 3300053139 | Ga0500568_0015816 | Ga0500568_0015816_1351_1836 | 160 |
| 52 | 3300005327 | Ga0070658_10008608 | Ga0070658_100086089 | 161 |
| 53 | 3300005330 | Ga0070690_100760030 | Ga0070690_1007600302 | 161 |
| 54 | 3300005331 | Ga0070670_100004471 | Ga0070670_1000044714 | 161 |
| 55 | 3300005347 | Ga0070668_100568488 | Ga0070668_1005684881 | 161 |
| 56 | 3300005544 | Ga0070686_100779429 | Ga0070686_1007794292 | 161 |
| 57 | 3300005563 | Ga0068855_100131875 | Ga0068855_1001318753 | 161 |
| 58 | 3300005577 | Ga0068857_100795241 | Ga0068857_1007952412 | 161 |
| 59 | 3300005841 | Ga0068863_100797441 | Ga0068863_1007974412 | 161 |
| 60 | 3300005844 | Ga0068862_100244201 | Ga0068862_1002442012 | 161 |
| 61 | 3300009093 | Ga0105240_10000262 | Ga0105240_1000026268 | 161 |
| 62 | 3300009094 | Ga0111539_10008405 | Ga0111539_1000840510 | 161 |
| 63 | 3300009094 | Ga0111539_10202553 | Ga0111539_102025533 | 161 |
| 64 | 3300009094 | Ga0111539_11890469 | Ga0111539_118904691 | 161 |
| 65 | 3300009147 | Ga0114129_10306609 | Ga0114129_103066092 | 161 |
| 66 | 3300009177 | Ga0105248_11165236 | Ga0105248_111652362 | 161 |
| 67 | 3300009545 | Ga0105237_10000050 | Ga0105237_1000005048 | 161 |
| 68 | 3300009551 | Ga0105238_10006468 | Ga0105238_100064684 | 161 |
| 69 | 3300009553 | Ga0105249_10950003 | Ga0105249_109500031 | 161 |
| 70 | 3300014969 | Ga0157376_11569476 | Ga0157376_115694761 | 161 |
| 71 | 3300017792 | Ga0163161_10610016 | Ga0163161_106100162 | 161 |
| 72 | 3300025909 | Ga0207705_10020349 | Ga0207705_100203493 | 161 |
| 73 | 3300025913 | Ga0207695_10003817 | Ga0207695_100038174 | 161 |
| 74 | 3300025914 | Ga0207671_10019884 | Ga0207671_100198846 | 161 |
| 75 | 3300025921 | Ga0207652_10020675 | Ga0207652_100206753 | 161 |
| 76 | 3300025924 | Ga0207694_10003133 | Ga0207694_100031339 | 161 |
| 77 | 3300025942 | Ga0207689_10757065 | Ga0207689_107570651 | 161 |
| 78 | 3300025960 | Ga0207651_10478385 | Ga0207651_104783852 | 161 |
| 79 | 3300028381 | Ga0268264_10422946 | Ga0268264_104229462 | 161 |
| 80 | 3300031240 | Ga0265320_10111765 | Ga0265320_101117651 | 161 |
| 81 | 3300031595 | Ga0265313_10068272 | Ga0265313_100682722 | 161 |
| 82 | 3300031712 | Ga0265342_10045808 | Ga0265342_100458084 | 161 |
| 83 | 3300035111 | Ga0373923_0184299 | Ga0373923_0184299_252_737 | 161 |
| 84 | 3300035117 | Ga0373953_0043984 | Ga0373953_0043984_712_1197 | 161 |
| 85 | 3300035118 | Ga0373954_0006090 | Ga0373954_0006090_2355_2840 | 161 |
| 86 | 3300035119 | Ga0373956_0017921 | Ga0373956_0017921_329_814 | 161 |
| 87 | 3300035120 | Ga0373957_0002940 | Ga0373957_0002940_3750_4235 | 161 |
| 88 | 3300035172 | Ga0373955_0008584 | Ga0373955_0008584_3265_3750 | 161 |
| 89 | 3300035410 | Ga0373924_0335314 | Ga0373924_0335314_15_500 | 161 |
| 90 | 3300035724 | Ga0373933_0052624 | Ga0373933_0052624_357_842 | 161 |
| 91 | 3300036401 | Ga0373937_0015812 | Ga0373937_0015812_1036_1521 | 161 |
| 92 | 3300037853 | Ga0436364_1477909 | Ga0436364_1477909_543_1028 | 161 |
| 93 | 3300046462 | Ga0495651_0702827 | Ga0495651_0702827_126_611 | 161 |
| 94 | 3300046514 | Ga0495618_0298661 | Ga0495618_0298661_443_928 | 161 |
| 95 | 3300046525 | Ga0495663_0075729 | Ga0495663_0075729_569_1054 | 161 |
| 96 | 3300046529 | Ga0495652_0142094 | Ga0495652_0142094_462_947 | 161 |
| 97 | 3300046559 | Ga0495667_0394094 | Ga0495667_0394094_188_673 | 161 |
| 98 | 3300047444 | Ga0495675_0345641 | Ga0495675_0345641_178_663 | 161 |
| 99 | 3300049571 | Ga0501034_0315929 | Ga0501034_0315929_225_710 | 161 |
| 100 | 3300049589 | Ga0501073_0106149 | Ga0501073_0106149_353_838 | 161 |
| 101 | 3300049591 | Ga0501075_0415172 | Ga0501075_0415172_57_542 | 161 |
| 102 | 3300049742 | Ga0501080_0176954 | Ga0501080_0176954_1306_1791 | 161 |
| 103 | 3300050507 | nmdc:mga05p37_718862_c1 | nmdc:mga05p37_718862_c1_555_1040 | 161 |
| 104 | 3300050508 | nmdc:mga09592_982617_c1 | nmdc:mga09592_982617_c1_178_663 | 161 |
| 105 | 3300050511 | nmdc:mga08y16_206328_c1 | nmdc:mga08y16_206328_c1_445_930 | 161 |
| 106 | 3300053077 | Ga0495601_0276660 | Ga0495601_0276660_274_759 | 161 |
| 107 | 3300053084 | Ga0495595_0332930 | Ga0495595_0332930_101_586 | 161 |
| 108 | 3300054114 | Ga0501084_0452721 | Ga0501084_0452721_299_784 | 161 |
| 109 | 3300005329 | Ga0070683_100478517 | Ga0070683_1004785172 | 162 |
| 110 | 3300005338 | Ga0068868_100070854 | Ga0068868_1000708543 | 162 |
| 111 | 3300005366 | Ga0070659_100281287 | Ga0070659_1002812872 | 162 |
| 112 | 3300005441 | Ga0070700_100114080 | Ga0070700_1001140801 | 162 |
| 113 | 3300005455 | Ga0070663_100027987 | Ga0070663_1000279873 | 162 |
| 114 | 3300005459 | Ga0068867_101249573 | Ga0068867_1012495732 | 162 |
| 115 | 3300005530 | Ga0070679_101262591 | Ga0070679_1012625911 | 162 |
| 116 | 3300005535 | Ga0070684_101128391 | Ga0070684_1011283911 | 162 |
| 117 | 3300005548 | Ga0070665_100433940 | Ga0070665_1004339402 | 162 |
| 118 | 3300005549 | Ga0070704_100052785 | Ga0070704_1000527852 | 162 |
| 119 | 3300005564 | Ga0070664_100811992 | Ga0070664_1008119922 | 162 |
| 120 | 3300005617 | Ga0068859_100063206 | Ga0068859_1000632065 | 162 |
| 121 | 3300005841 | Ga0068863_100071294 | Ga0068863_1000712943 | 162 |
| 122 | 3300005842 | Ga0068858_100071185 | Ga0068858_1000711854 | 162 |
| 123 | 3300006237 | Ga0097621_100558056 | Ga0097621_1005580563 | 162 |
| 124 | 3300006358 | Ga0068871_101462686 | Ga0068871_1014626862 | 162 |
| 125 | 3300006852 | Ga0075433_10255373 | Ga0075433_102553732 | 162 |
| 126 | 3300006931 | Ga0097620_100063209 | Ga0097620_1000632095 | 162 |
| 127 | 3300009176 | Ga0105242_12504600 | Ga0105242_125046001 | 162 |
| 128 | 3300009177 | Ga0105248_10686561 | Ga0105248_106865612 | 162 |
| 129 | 3300009545 | Ga0105237_10226871 | Ga0105237_102268712 | 162 |
| 130 | 3300014325 | Ga0163163_10020582 | Ga0163163_100205825 | 162 |
| 131 | 3300014745 | Ga0157377_10453072 | Ga0157377_104530722 | 162 |
| 132 | 3300017792 | Ga0163161_10382436 | Ga0163161_103824361 | 162 |
| 133 | 3300025932 | Ga0207690_10451017 | Ga0207690_104510172 | 162 |
| 134 | 3300025936 | Ga0207670_10100286 | Ga0207670_101002862 | 162 |
| 135 | 3300025941 | Ga0207711_10362735 | Ga0207711_103627352 | 162 |
| 136 | 3300025972 | Ga0207668_10038683 | Ga0207668_100386834 | 162 |
| 137 | 3300025972 | Ga0207668_10198223 | Ga0207668_101982232 | 162 |
| 138 | 3300025986 | Ga0207658_10799841 | Ga0207658_107998412 | 162 |
| 139 | 3300026035 | Ga0207703_10066974 | Ga0207703_100669743 | 162 |
| 140 | 3300026041 | Ga0207639_11925959 | Ga0207639_119259591 | 162 |
| 141 | 3300026067 | Ga0207678_10011990 | Ga0207678_100119906 | 162 |
| 142 | 3300026075 | Ga0207708_10458748 | Ga0207708_104587482 | 162 |
| 143 | 3300026089 | Ga0207648_10236136 | Ga0207648_102361362 | 162 |
| 144 | 3300026118 | Ga0207675_100008960 | Ga0207675_1000089602 | 162 |
| 145 | 3300031456 | Ga0307513_10363528 | Ga0307513_103635282 | 162 |
| 146 | 3300031616 | Ga0307508_10103265 | Ga0307508_101032651 | 162 |
| 147 | 3300046536 | Ga0495587_0398914 | Ga0495587_0398914_19_507 | 162 |
| 148 | 3300048903 | Ga0496100_0582065 | Ga0496100_0582065_90_578 | 162 |
| 149 | 3300048907 | Ga0496104_1201085 | Ga0496104_1201085_34_522 | 162 |
| 150 | 3300048909 | Ga0496106_0418544 | Ga0496106_0418544_313_804 | 162 |
| 151 | 3300048915 | Ga0496112_0529515 | Ga0496112_0529515_202_690 | 162 |
| 152 | 3300048917 | Ga0496114_0595426 | Ga0496114_0595426_77_568 | 162 |
| 153 | 3300049569 | Ga0501032_0677794 | Ga0501032_0677794_125_613 | 162 |
| 154 | 3300049577 | Ga0501041_0685584 | Ga0501041_0685584_100_588 | 162 |
| 155 | 3300049578 | Ga0501042_0068598 | Ga0501042_0068598_72_560 | 162 |
| 156 | 3300049579 | Ga0501043_0179933 | Ga0501043_0179933_262_750 | 162 |
| 157 | 3300049580 | Ga0501046_0168402 | Ga0501046_0168402_714_1202 | 162 |
| 158 | 3300049583 | Ga0501067_0443892 | Ga0501067_0443892_224_712 | 162 |
| 159 | 3300049585 | Ga0501069_0174337 | Ga0501069_0174337_661_1149 | 162 |
| 160 | 3300049586 | Ga0501070_0299282 | Ga0501070_0299282_355_843 | 162 |
| 161 | 3300049587 | Ga0501071_0017767 | Ga0501071_0017767_4413_4901 | 162 |
| 162 | 3300049589 | Ga0501073_0039619 | Ga0501073_0039619_706_1194 | 162 |
| 163 | 3300049591 | Ga0501075_0362120 | Ga0501075_0362120_565_1053 | 162 |
| 164 | 3300049741 | Ga0501079_0039824 | Ga0501079_0039824_1731_2219 | 162 |
| 165 | 3300049741 | Ga0501079_1325898 | Ga0501079_1325898_31_519 | 162 |
| 166 | 3300049742 | Ga0501080_0290527 | Ga0501080_0290527_504_992 | 162 |
| 167 | 3300049743 | Ga0501081_0127322 | Ga0501081_0127322_183_671 | 162 |
| 168 | 3300049744 | Ga0501083_0044412 | Ga0501083_0044412_372_860 | 162 |
| 169 | 3300049822 | Ga0501035_1114745 | Ga0501035_1114745_79_567 | 162 |
| 170 | 3300053134 | Ga0500658_0078495 | Ga0500658_0078495_193_687 | 162 |
| 171 | 3300053146 | Ga0500588_0134871 | Ga0500588_0134871_134_634 | 162 |
| 172 | 3300054114 | Ga0501084_0115150 | Ga0501084_0115150_767_1255 | 162 |
| 173 | 3300060353 | Ga0501082_0171616 | Ga0501082_0171616_795_1283 | 162 |
| 174 | 3300060353 | Ga0501082_0340263 | Ga0501082_0340263_371_859 | 162 |
| 175 | 3300061734 | Ga0530510_0243931 | Ga0530510_0243931_453_941 | 162 |
| 176 | 3300005340 | Ga0070689_100000001 | Ga0070689_100000001877 | 163 |
| 177 | 3300005340 | Ga0070689_100348852 | Ga0070689_1003488521 | 163 |
| 178 | 3300005345 | Ga0070692_10218759 | Ga0070692_102187592 | 163 |
| 179 | 3300005365 | Ga0070688_100099785 | Ga0070688_1000997852 | 163 |
| 180 | 3300005440 | Ga0070705_100388048 | Ga0070705_1003880481 | 163 |
| 181 | 3300005441 | Ga0070700_100081740 | Ga0070700_1000817403 | 163 |
| 182 | 3300005444 | Ga0070694_100594094 | Ga0070694_1005940942 | 163 |
| 183 | 3300005466 | Ga0070685_10585130 | Ga0070685_105851301 | 163 |
| 184 | 3300005539 | Ga0068853_100009346 | Ga0068853_1000093465 | 163 |
| 185 | 3300005544 | Ga0070686_100400329 | Ga0070686_1004003292 | 163 |
| 186 | 3300005547 | Ga0070693_100165341 | Ga0070693_1001653412 | 163 |
| 187 | 3300005563 | Ga0068855_100029744 | Ga0068855_1000297442 | 163 |
| 188 | 3300005614 | Ga0068856_100067551 | Ga0068856_1000675513 | 163 |
| 189 | 3300005617 | Ga0068859_100009108 | Ga0068859_1000091082 | 163 |
| 190 | 3300005617 | Ga0068859_100016980 | Ga0068859_1000169802 | 163 |
| 191 | 3300005719 | Ga0068861_100279582 | Ga0068861_1002795822 | 163 |
| 192 | 3300005841 | Ga0068863_100274601 | Ga0068863_1002746013 | 163 |
| 193 | 3300005842 | Ga0068858_101058701 | Ga0068858_1010587012 | 163 |
| 194 | 3300005844 | Ga0068862_101649774 | Ga0068862_1016497741 | 163 |
| 195 | 3300006931 | Ga0097620_100009108 | Ga0097620_1000091082 | 163 |
| 196 | 3300006931 | Ga0097620_100016978 | Ga0097620_1000169782 | 163 |
| 197 | 3300009101 | Ga0105247_10892238 | Ga0105247_108922381 | 163 |
| 198 | 3300009147 | Ga0114129_10536455 | Ga0114129_105364551 | 163 |
| 199 | 3300009148 | Ga0105243_12145826 | Ga0105243_121458261 | 163 |
| 200 | 3300009174 | Ga0105241_10123324 | Ga0105241_101233242 | 163 |
| 201 | 3300009551 | Ga0105238_10195374 | Ga0105238_101953742 | 163 |
| 202 | 3300009553 | Ga0105249_10063930 | Ga0105249_100639302 | 163 |
| 203 | 3300020080 | Ga0206350_10936070 | Ga0206350_109360701 | 163 |
| 204 | 3300025924 | Ga0207694_10273682 | Ga0207694_102736822 | 163 |
| 205 | 3300025936 | Ga0207670_10000011 | Ga0207670_1000001162 | 163 |
| 206 | 3300025936 | Ga0207670_10413798 | Ga0207670_104137981 | 163 |
| 207 | 3300025949 | Ga0207667_10104113 | Ga0207667_101041131 | 163 |
| 208 | 3300026023 | Ga0207677_10144882 | Ga0207677_101448822 | 163 |
| 209 | 3300026035 | Ga0207703_11083279 | Ga0207703_110832792 | 163 |
| 210 | 3300026075 | Ga0207708_10122879 | Ga0207708_101228792 | 163 |
| 211 | 3300026088 | Ga0207641_10325624 | Ga0207641_103256242 | 163 |
| 212 | 3300026089 | Ga0207648_10146549 | Ga0207648_101465491 | 163 |
| 213 | 3300026118 | Ga0207675_100799938 | Ga0207675_1007999381 | 163 |
| 214 | 3300027543 | Ga0209999_1011300 | Ga0209999_10113002 | 163 |
| 215 | 3300027552 | Ga0209982_1014676 | Ga0209982_10146762 | 163 |
| 216 | 3300027614 | Ga0209970_1009340 | Ga0209970_10093402 | 163 |
| 217 | 3300027695 | Ga0209966_1002775 | Ga0209966_10027752 | 163 |
| 218 | 3300028380 | Ga0268265_10696734 | Ga0268265_106967342 | 163 |
| 219 | 3300035119 | Ga0373956_0378562 | Ga0373956_0378562_164_655 | 163 |
| 220 | 3300036401 | Ga0373937_0338733 | Ga0373937_0338733_450_941 | 163 |
| 221 | 3300037068 | Ga0373925_0005479 | Ga0373925_0005479_8695_9186 | 163 |
| 222 | 3300039438 | Ga0436360_0281756 | Ga0436360_0281756_115_609 | 163 |
| 223 | 3300039447 | Ga0436361_1004545 | Ga0436361_1004545_12_506 | 163 |
| 224 | 3300039453 | Ga0436362_0819930 | Ga0436362_0819930_508_1002 | 163 |
| 225 | 3300042003 | Ga0439443_001304 | Ga0439443_001304_1973_2467 | 163 |
| 226 | 3300042436 | Ga0439435_0001712 | Ga0439435_0001712_1127_1621 | 163 |
| 227 | 3300044694 | Ga0466963_0193097 | Ga0466963_0193097_685_1230 | 163 |
| 228 | 3300045836 | Ga0466958_0768647 | Ga0466958_0768647_35_526 | 163 |
| 229 | 3300046616 | Ga0495668_0372347 | Ga0495668_0372347_17_508 | 163 |
| 230 | 3300048908 | Ga0496105_0384267 | Ga0496105_0384267_11_502 | 163 |
| 231 | 3300050508 | nmdc:mga09592_746504_c1 | nmdc:mga09592_746504_c1_144_638 | 163 |
| 232 | 3300050510 | nmdc:mga06r32_308625_c1 | nmdc:mga06r32_308625_c1_297_791 | 163 |
| 233 | 3300050512 | nmdc:mga0n895_431072_c1 | nmdc:mga0n895_431072_c1_359_850 | 163 |
| 234 | 3300050513 | nmdc:mga0rr50_795250_c1 | nmdc:mga0rr50_795250_c1_30_521 | 163 |
| 235 | 3300060353 | Ga0501082_0936510 | Ga0501082_0936510_94_585 | 163 |
| 236 | 3300005343 | Ga0070687_100258947 | Ga0070687_1002589472 | 164 |
| 237 | 3300005347 | Ga0070668_100076494 | Ga0070668_1000764941 | 164 |
| 238 | 3300005353 | Ga0070669_100021986 | Ga0070669_1000219863 | 164 |
| 239 | 3300005356 | Ga0070674_100013861 | Ga0070674_1000138615 | 164 |
| 240 | 3300005356 | Ga0070674_100082001 | Ga0070674_1000820012 | 164 |
| 241 | 3300005367 | Ga0070667_100630537 | Ga0070667_1006305371 | 164 |
| 242 | 3300005437 | Ga0070710_10729193 | Ga0070710_107291931 | 164 |
| 243 | 3300005471 | Ga0070698_100104741 | Ga0070698_1001047413 | 164 |
| 244 | 3300005535 | Ga0070684_100372397 | Ga0070684_1003723971 | 164 |
| 245 | 3300005545 | Ga0070695_100059955 | Ga0070695_1000599552 | 164 |
| 246 | 3300005545 | Ga0070695_100069841 | Ga0070695_1000698413 | 164 |
| 247 | 3300005546 | Ga0070696_101025179 | Ga0070696_1010251791 | 164 |
| 248 | 3300005618 | Ga0068864_100000918 | Ga0068864_10000091811 | 164 |
| 249 | 3300005718 | Ga0068866_10034994 | Ga0068866_100349942 | 164 |
| 250 | 3300005719 | Ga0068861_100032259 | Ga0068861_1000322594 | 164 |
| 251 | 3300006237 | Ga0097621_100087682 | Ga0097621_1000876823 | 164 |
| 252 | 3300006358 | Ga0068871_100106556 | Ga0068871_1001065562 | 164 |
| 253 | 3300006358 | Ga0068871_100208550 | Ga0068871_1002085502 | 164 |
| 254 | 3300006847 | Ga0075431_100449419 | Ga0075431_1004494192 | 164 |
| 255 | 3300006881 | Ga0068865_100032117 | Ga0068865_1000321172 | 164 |
| 256 | 3300009094 | Ga0111539_10226885 | Ga0111539_102268852 | 164 |
| 257 | 3300009176 | Ga0105242_11513231 | Ga0105242_115132312 | 164 |
| 258 | 3300009553 | Ga0105249_11055910 | Ga0105249_110559102 | 164 |
| 259 | 3300013296 | Ga0157374_10198327 | Ga0157374_101983273 | 164 |
| 260 | 3300013306 | Ga0163162_11671577 | Ga0163162_116715772 | 164 |
| 261 | 3300014325 | Ga0163163_10009374 | Ga0163163_1000937412 | 164 |
| 262 | 3300014326 | Ga0157380_10047719 | Ga0157380_100477192 | 164 |
| 263 | 3300025899 | Ga0207642_10173920 | Ga0207642_101739202 | 164 |
| 264 | 3300025926 | Ga0207659_10410620 | Ga0207659_104106203 | 164 |
| 265 | 3300025937 | Ga0207669_10074279 | Ga0207669_100742793 | 164 |
| 266 | 3300025938 | Ga0207704_10028106 | Ga0207704_100281063 | 164 |
| 267 | 3300025961 | Ga0207712_10117038 | Ga0207712_101170384 | 164 |
| 268 | 3300025972 | Ga0207668_10246020 | Ga0207668_102460202 | 164 |
| 269 | 3300025972 | Ga0207668_10497162 | Ga0207668_104971622 | 164 |
| 270 | 3300026075 | Ga0207708_10063137 | Ga0207708_100631372 | 164 |
| 271 | 3300026075 | Ga0207708_10218378 | Ga0207708_102183782 | 164 |
| 272 | 3300026078 | Ga0207702_10174329 | Ga0207702_101743292 | 164 |
| 273 | 3300026089 | Ga0207648_10096629 | Ga0207648_100966292 | 164 |
| 274 | 3300026095 | Ga0207676_10080329 | Ga0207676_100803294 | 164 |
| 275 | 3300026118 | Ga0207675_100100666 | Ga0207675_1001006662 | 164 |
| 276 | 3300028379 | Ga0268266_10305428 | Ga0268266_103054281 | 164 |
| 277 | 3300031548 | Ga0307408_100170733 | Ga0307408_1001707332 | 164 |
| 278 | 3300031911 | Ga0307412_10473369 | Ga0307412_104733692 | 164 |
| 279 | 3300032002 | Ga0307416_100166858 | Ga0307416_1001668582 | 164 |
| 280 | 3300047318 | Ga0495636_0014976 | Ga0495636_0014976_1100_1657 | 164 |
| 281 | 3300048915 | Ga0496112_0289240 | Ga0496112_0289240_51_545 | 164 |
| 282 | 3300050511 | nmdc:mga08y16_92120_c1 | nmdc:mga08y16_92120_c1_2073_2579 | 164 |
| 283 | 3300053134 | Ga0500658_0452414 | Ga0500658_0452414_50_547 | 164 |
| 284 | 3300005293 | Ga0065715_10164226 | Ga0065715_101642261 | 165 |
| 285 | 3300005328 | Ga0070676_10021860 | Ga0070676_100218604 | 165 |
| 286 | 3300005329 | Ga0070683_100676024 | Ga0070683_1006760241 | 165 |
| 287 | 3300005330 | Ga0070690_100402429 | Ga0070690_1004024292 | 165 |
| 288 | 3300005331 | Ga0070670_100001648 | Ga0070670_10000164813 | 165 |
| 289 | 3300005334 | Ga0068869_100054630 | Ga0068869_1000546301 | 165 |
| 290 | 3300005334 | Ga0068869_100156996 | Ga0068869_1001569963 | 165 |
| 291 | 3300005334 | Ga0068869_100360526 | Ga0068869_1003605261 | 165 |
| 292 | 3300005335 | Ga0070666_10005247 | Ga0070666_100052472 | 165 |
| 293 | 3300005335 | Ga0070666_10437788 | Ga0070666_104377881 | 165 |
| 294 | 3300005336 | Ga0070680_100008942 | Ga0070680_1000089429 | 165 |
| 295 | 3300005337 | Ga0070682_100256385 | Ga0070682_1002563852 | 165 |
| 296 | 3300005338 | Ga0068868_100034757 | Ga0068868_1000347575 | 165 |
| 297 | 3300005338 | Ga0068868_100090667 | Ga0068868_1000906672 | 165 |
| 298 | 3300005338 | Ga0068868_101594796 | Ga0068868_1015947961 | 165 |
| 299 | 3300005340 | Ga0070689_100190659 | Ga0070689_1001906592 | 165 |
| 300 | 3300005344 | Ga0070661_100264486 | Ga0070661_1002644861 | 165 |
| 301 | 3300005344 | Ga0070661_100653090 | Ga0070661_1006530902 | 165 |
| 302 | 3300005354 | Ga0070675_100012952 | Ga0070675_1000129525 | 165 |
| 303 | 3300005355 | Ga0070671_100052255 | Ga0070671_1000522552 | 165 |
| 304 | 3300005356 | Ga0070674_100005400 | Ga0070674_1000054005 | 165 |
| 305 | 3300005364 | Ga0070673_100027600 | Ga0070673_1000276003 | 165 |
| 306 | 3300005364 | Ga0070673_100043909 | Ga0070673_1000439093 | 165 |
| 307 | 3300005364 | Ga0070673_100167299 | Ga0070673_1001672992 | 165 |
| 308 | 3300005364 | Ga0070673_101180202 | Ga0070673_1011802021 | 165 |
| 309 | 3300005365 | Ga0070688_100007711 | Ga0070688_1000077113 | 165 |
| 310 | 3300005365 | Ga0070688_100151679 | Ga0070688_1001516791 | 165 |
| 311 | 3300005366 | Ga0070659_100015338 | Ga0070659_1000153387 | 165 |
| 312 | 3300005366 | Ga0070659_100441060 | Ga0070659_1004410601 | 165 |
| 313 | 3300005367 | Ga0070667_100020332 | Ga0070667_1000203324 | 165 |
| 314 | 3300005367 | Ga0070667_100045960 | Ga0070667_1000459604 | 165 |
| 315 | 3300005434 | Ga0070709_10151533 | Ga0070709_101515332 | 165 |
| 316 | 3300005434 | Ga0070709_10256229 | Ga0070709_102562292 | 165 |
| 317 | 3300005436 | Ga0070713_100017271 | Ga0070713_1000172711 | 165 |
| 318 | 3300005437 | Ga0070710_10027580 | Ga0070710_100275804 | 165 |
| 319 | 3300005438 | Ga0070701_10122702 | Ga0070701_101227022 | 165 |
| 320 | 3300005439 | Ga0070711_100008755 | Ga0070711_1000087554 | 165 |
| 321 | 3300005439 | Ga0070711_100247380 | Ga0070711_1002473802 | 165 |
| 322 | 3300005440 | Ga0070705_100009497 | Ga0070705_1000094974 | 165 |
| 323 | 3300005440 | Ga0070705_100304261 | Ga0070705_1003042611 | 165 |
| 324 | 3300005441 | Ga0070700_100074201 | Ga0070700_1000742013 | 165 |
| 325 | 3300005445 | Ga0070708_100071466 | Ga0070708_1000714662 | 165 |
| 326 | 3300005455 | Ga0070663_100337405 | Ga0070663_1003374052 | 165 |
| 327 | 3300005457 | Ga0070662_100043586 | Ga0070662_1000435864 | 165 |
| 328 | 3300005457 | Ga0070662_101227184 | Ga0070662_1012271841 | 165 |
| 329 | 3300005458 | Ga0070681_10112230 | Ga0070681_101122302 | 165 |
| 330 | 3300005459 | Ga0068867_100009475 | Ga0068867_1000094754 | 165 |
| 331 | 3300005459 | Ga0068867_100100538 | Ga0068867_1001005382 | 165 |
| 332 | 3300005459 | Ga0068867_100405712 | Ga0068867_1004057122 | 165 |
| 333 | 3300005466 | Ga0070685_10008871 | Ga0070685_100088714 | 165 |
| 334 | 3300005467 | Ga0070706_100023816 | Ga0070706_1000238163 | 165 |
| 335 | 3300005467 | Ga0070706_100335196 | Ga0070706_1003351962 | 165 |
| 336 | 3300005468 | Ga0070707_100012864 | Ga0070707_1000128643 | 165 |
| 337 | 3300005468 | Ga0070707_100034532 | Ga0070707_1000345324 | 165 |
| 338 | 3300005468 | Ga0070707_100473545 | Ga0070707_1004735452 | 165 |
| 339 | 3300005471 | Ga0070698_100385728 | Ga0070698_1003857282 | 165 |
| 340 | 3300005518 | Ga0070699_100035398 | Ga0070699_1000353983 | 165 |
| 341 | 3300005530 | Ga0070679_100159253 | Ga0070679_1001592533 | 165 |
| 342 | 3300005530 | Ga0070679_100379975 | Ga0070679_1003799752 | 165 |
| 343 | 3300005535 | Ga0070684_100342925 | Ga0070684_1003429252 | 165 |
| 344 | 3300005536 | Ga0070697_100196093 | Ga0070697_1001960932 | 165 |
| 345 | 3300005536 | Ga0070697_101101454 | Ga0070697_1011014541 | 165 |
| 346 | 3300005539 | Ga0068853_100103460 | Ga0068853_1001034602 | 165 |
| 347 | 3300005539 | Ga0068853_100116101 | Ga0068853_1001161012 | 165 |
| 348 | 3300005539 | Ga0068853_100704304 | Ga0068853_1007043042 | 165 |
| 349 | 3300005543 | Ga0070672_100097994 | Ga0070672_1000979942 | 165 |
| 350 | 3300005543 | Ga0070672_100280352 | Ga0070672_1002803522 | 165 |
| 351 | 3300005544 | Ga0070686_100231182 | Ga0070686_1002311822 | 165 |
| 352 | 3300005545 | Ga0070695_100057718 | Ga0070695_1000577182 | 165 |
| 353 | 3300005546 | Ga0070696_100549765 | Ga0070696_1005497652 | 165 |
| 354 | 3300005546 | Ga0070696_100983667 | Ga0070696_1009836671 | 165 |
| 355 | 3300005547 | Ga0070693_100010214 | Ga0070693_1000102144 | 165 |
| 356 | 3300005547 | Ga0070693_100098545 | Ga0070693_1000985452 | 165 |
| 357 | 3300005547 | Ga0070693_100378553 | Ga0070693_1003785532 | 165 |
| 358 | 3300005549 | Ga0070704_100097687 | Ga0070704_1000976873 | 165 |
| 359 | 3300005549 | Ga0070704_100225977 | Ga0070704_1002259772 | 165 |
| 360 | 3300005563 | Ga0068855_100119530 | Ga0068855_1001195302 | 165 |
| 361 | 3300005577 | Ga0068857_100010399 | Ga0068857_1000103992 | 165 |
| 362 | 3300005578 | Ga0068854_100024272 | Ga0068854_1000242725 | 165 |
| 363 | 3300005578 | Ga0068854_100584982 | Ga0068854_1005849822 | 165 |
| 364 | 3300005614 | Ga0068856_100490020 | Ga0068856_1004900202 | 165 |
| 365 | 3300005614 | Ga0068856_100762411 | Ga0068856_1007624112 | 165 |
| 366 | 3300005615 | Ga0070702_100004222 | Ga0070702_1000042227 | 165 |
| 367 | 3300005615 | Ga0070702_100063146 | Ga0070702_1000631463 | 165 |
| 368 | 3300005615 | Ga0070702_100104733 | Ga0070702_1001047332 | 165 |
| 369 | 3300005615 | Ga0070702_100931185 | Ga0070702_1009311851 | 165 |
| 370 | 3300005616 | Ga0068852_100775206 | Ga0068852_1007752062 | 165 |
| 371 | 3300005617 | Ga0068859_100001347 | Ga0068859_10000134719 | 165 |
| 372 | 3300005617 | Ga0068859_100016297 | Ga0068859_1000162974 | 165 |
| 373 | 3300005617 | Ga0068859_100076147 | Ga0068859_1000761474 | 165 |
| 374 | 3300005617 | Ga0068859_101280555 | Ga0068859_1012805551 | 165 |
| 375 | 3300005618 | Ga0068864_100001786 | Ga0068864_1000017866 | 165 |
| 376 | 3300005618 | Ga0068864_100002127 | Ga0068864_1000021274 | 165 |
| 377 | 3300005618 | Ga0068864_100483635 | Ga0068864_1004836352 | 165 |
| 378 | 3300005718 | Ga0068866_10011885 | Ga0068866_100118853 | 165 |
| 379 | 3300005719 | Ga0068861_100002626 | Ga0068861_10000262618 | 165 |
| 380 | 3300005840 | Ga0068870_10035490 | Ga0068870_100354902 | 165 |
| 381 | 3300005841 | Ga0068863_100039160 | Ga0068863_1000391602 | 165 |
| 382 | 3300005842 | Ga0068858_100000924 | Ga0068858_10000092410 | 165 |
| 383 | 3300005842 | Ga0068858_100005298 | Ga0068858_1000052989 | 165 |
| 384 | 3300005842 | Ga0068858_100708678 | Ga0068858_1007086782 | 165 |
| 385 | 3300005843 | Ga0068860_100006411 | Ga0068860_10000641111 | 165 |
| 386 | 3300005843 | Ga0068860_100056397 | Ga0068860_1000563972 | 165 |
| 387 | 3300005843 | Ga0068860_100077578 | Ga0068860_1000775782 | 165 |
| 388 | 3300005843 | Ga0068860_101090758 | Ga0068860_1010907582 | 165 |
| 389 | 3300005844 | Ga0068862_100108368 | Ga0068862_1001083683 | 165 |
| 390 | 3300005985 | Ga0081539_10077478 | Ga0081539_100774783 | 165 |
| 391 | 3300006173 | Ga0070716_100009552 | Ga0070716_1000095523 | 165 |
| 392 | 3300006175 | Ga0070712_100017504 | Ga0070712_1000175044 | 165 |
| 393 | 3300006175 | Ga0070712_100102871 | Ga0070712_1001028712 | 165 |
| 394 | 3300006195 | Ga0075366_10185611 | Ga0075366_101856112 | 165 |
| 395 | 3300006237 | Ga0097621_100029079 | Ga0097621_1000290795 | 165 |
| 396 | 3300006237 | Ga0097621_100281678 | Ga0097621_1002816782 | 165 |
| 397 | 3300006358 | Ga0068871_100101076 | Ga0068871_1001010762 | 165 |
| 398 | 3300006844 | Ga0075428_100024555 | Ga0075428_1000245553 | 165 |
| 399 | 3300006847 | Ga0075431_100215328 | Ga0075431_1002153282 | 165 |
| 400 | 3300006871 | Ga0075434_100048545 | Ga0075434_1000485451 | 165 |
| 401 | 3300006871 | Ga0075434_100335790 | Ga0075434_1003357902 | 165 |
| 402 | 3300006871 | Ga0075434_100632506 | Ga0075434_1006325062 | 165 |
| 403 | 3300006881 | Ga0068865_100021637 | Ga0068865_1000216372 | 165 |
| 404 | 3300006881 | Ga0068865_100240758 | Ga0068865_1002407582 | 165 |
| 405 | 3300006914 | Ga0075436_100295790 | Ga0075436_1002957901 | 165 |
| 406 | 3300006931 | Ga0097620_100001347 | Ga0097620_10000134719 | 165 |
| 407 | 3300006931 | Ga0097620_100016298 | Ga0097620_1000162984 | 165 |
| 408 | 3300006931 | Ga0097620_100076149 | Ga0097620_1000761494 | 165 |
| 409 | 3300009093 | Ga0105240_10322796 | Ga0105240_103227961 | 165 |
| 410 | 3300009094 | Ga0111539_10272125 | Ga0111539_102721252 | 165 |
| 411 | 3300009094 | Ga0111539_12127390 | Ga0111539_121273902 | 165 |
| 412 | 3300009098 | Ga0105245_10001111 | Ga0105245_100011112 | 165 |
| 413 | 3300009098 | Ga0105245_10203801 | Ga0105245_102038012 | 165 |
| 414 | 3300009098 | Ga0105245_10220818 | Ga0105245_102208182 | 165 |
| 415 | 3300009098 | Ga0105245_10319309 | Ga0105245_103193092 | 165 |
| 416 | 3300009101 | Ga0105247_10062341 | Ga0105247_100623412 | 165 |
| 417 | 3300009101 | Ga0105247_10519944 | Ga0105247_105199442 | 165 |
| 418 | 3300009148 | Ga0105243_10187232 | Ga0105243_101872322 | 165 |
| 419 | 3300009174 | Ga0105241_10860204 | Ga0105241_108602041 | 165 |
| 420 | 3300009176 | Ga0105242_10005080 | Ga0105242_100050802 | 165 |
| 421 | 3300009176 | Ga0105242_10238437 | Ga0105242_102384371 | 165 |
| 422 | 3300009177 | Ga0105248_10044422 | Ga0105248_100444222 | 165 |
| 423 | 3300009551 | Ga0105238_10238650 | Ga0105238_102386502 | 165 |
| 424 | 3300009551 | Ga0105238_10367873 | Ga0105238_103678732 | 165 |
| 425 | 3300009553 | Ga0105249_10232752 | Ga0105249_102327524 | 165 |
| 426 | 3300010375 | Ga0105239_11421605 | Ga0105239_114216051 | 165 |
| 427 | 3300011119 | Ga0105246_10210366 | Ga0105246_102103663 | 165 |
| 428 | 3300011119 | Ga0105246_11039353 | Ga0105246_110393532 | 165 |
| 429 | 3300013104 | Ga0157370_10354958 | Ga0157370_103549581 | 165 |
| 430 | 3300013296 | Ga0157374_10006996 | Ga0157374_100069964 | 165 |
| 431 | 3300013296 | Ga0157374_10120474 | Ga0157374_101204742 | 165 |
| 432 | 3300013297 | Ga0157378_10009382 | Ga0157378_100093822 | 165 |
| 433 | 3300013297 | Ga0157378_10298084 | Ga0157378_102980842 | 165 |
| 434 | 3300013297 | Ga0157378_10452792 | Ga0157378_104527922 | 165 |
| 435 | 3300013307 | Ga0157372_10284909 | Ga0157372_102849093 | 165 |
| 436 | 3300013308 | Ga0157375_10040858 | Ga0157375_100408583 | 165 |
| 437 | 3300013308 | Ga0157375_10347676 | Ga0157375_103476762 | 165 |
| 438 | 3300013308 | Ga0157375_10740154 | Ga0157375_107401541 | 165 |
| 439 | 3300014325 | Ga0163163_10051526 | Ga0163163_100515264 | 165 |
| 440 | 3300014325 | Ga0163163_10577761 | Ga0163163_105777611 | 165 |
| 441 | 3300014326 | Ga0157380_10052814 | Ga0157380_100528144 | 165 |
| 442 | 3300014326 | Ga0157380_10400827 | Ga0157380_104008272 | 165 |
| 443 | 3300014968 | Ga0157379_10004817 | Ga0157379_100048173 | 165 |
| 444 | 3300014968 | Ga0157379_10258098 | Ga0157379_102580982 | 165 |
| 445 | 3300014969 | Ga0157376_10382483 | Ga0157376_103824832 | 165 |
| 446 | 3300020080 | Ga0206350_11280726 | Ga0206350_112807261 | 165 |
| 447 | 3300020081 | Ga0206354_10692315 | Ga0206354_106923152 | 165 |
| 448 | 3300020610 | Ga0154015_1046432 | Ga0154015_10464322 | 165 |
| 449 | 3300021358 | Ga0213873_10160452 | Ga0213873_101604521 | 165 |
| 450 | 3300021441 | Ga0213871_10001206 | Ga0213871_100012065 | 165 |
| 451 | 3300022467 | Ga0224712_10270614 | Ga0224712_102706142 | 165 |
| 452 | 3300025315 | Ga0207697_10366283 | Ga0207697_103662831 | 165 |
| 453 | 3300025898 | Ga0207692_10082197 | Ga0207692_100821972 | 165 |
| 454 | 3300025899 | Ga0207642_10224331 | Ga0207642_102243312 | 165 |
| 455 | 3300025899 | Ga0207642_10587705 | Ga0207642_105877051 | 165 |
| 456 | 3300025900 | Ga0207710_10015110 | Ga0207710_100151102 | 165 |
| 457 | 3300025901 | Ga0207688_10233703 | Ga0207688_102337032 | 165 |
| 458 | 3300025901 | Ga0207688_10568588 | Ga0207688_105685881 | 165 |
| 459 | 3300025903 | Ga0207680_10023548 | Ga0207680_100235483 | 165 |
| 460 | 3300025903 | Ga0207680_10087485 | Ga0207680_100874853 | 165 |
| 461 | 3300025903 | Ga0207680_10261756 | Ga0207680_102617562 | 165 |
| 462 | 3300025905 | Ga0207685_10013464 | Ga0207685_100134642 | 165 |
| 463 | 3300025906 | Ga0207699_10019156 | Ga0207699_100191562 | 165 |
| 464 | 3300025906 | Ga0207699_10079175 | Ga0207699_100791752 | 165 |
| 465 | 3300025907 | Ga0207645_10019696 | Ga0207645_100196962 | 165 |
| 466 | 3300025907 | Ga0207645_10889148 | Ga0207645_108891481 | 165 |
| 467 | 3300025908 | Ga0207643_10040021 | Ga0207643_100400213 | 165 |
| 468 | 3300025910 | Ga0207684_10020818 | Ga0207684_100208185 | 165 |
| 469 | 3300025910 | Ga0207684_10166713 | Ga0207684_101667132 | 165 |
| 470 | 3300025911 | Ga0207654_10004656 | Ga0207654_100046567 | 165 |
| 471 | 3300025912 | Ga0207707_10192067 | Ga0207707_101920671 | 165 |
| 472 | 3300025912 | Ga0207707_10273001 | Ga0207707_102730012 | 165 |
| 473 | 3300025915 | Ga0207693_10026174 | Ga0207693_100261743 | 165 |
| 474 | 3300025915 | Ga0207693_10101821 | Ga0207693_101018212 | 165 |
| 475 | 3300025916 | Ga0207663_10074486 | Ga0207663_100744863 | 165 |
| 476 | 3300025917 | Ga0207660_10154413 | Ga0207660_101544132 | 165 |
| 477 | 3300025919 | Ga0207657_10012272 | Ga0207657_100122725 | 165 |
| 478 | 3300025920 | Ga0207649_10640605 | Ga0207649_106406052 | 165 |
| 479 | 3300025920 | Ga0207649_11197673 | Ga0207649_111976731 | 165 |
| 480 | 3300025921 | Ga0207652_10015622 | Ga0207652_100156222 | 165 |
| 481 | 3300025921 | Ga0207652_10442788 | Ga0207652_104427882 | 165 |
| 482 | 3300025922 | Ga0207646_10121417 | Ga0207646_101214171 | 165 |
| 483 | 3300025923 | Ga0207681_10140706 | Ga0207681_101407062 | 165 |
| 484 | 3300025923 | Ga0207681_10328691 | Ga0207681_103286912 | 165 |
| 485 | 3300025923 | Ga0207681_10690833 | Ga0207681_106908331 | 165 |
| 486 | 3300025925 | Ga0207650_10015581 | Ga0207650_100155811 | 165 |
| 487 | 3300025925 | Ga0207650_10092270 | Ga0207650_100922702 | 165 |
| 488 | 3300025925 | Ga0207650_10143773 | Ga0207650_101437732 | 165 |
| 489 | 3300025926 | Ga0207659_10165082 | Ga0207659_101650822 | 165 |
| 490 | 3300025927 | Ga0207687_10000792 | Ga0207687_1000079214 | 165 |
| 491 | 3300025927 | Ga0207687_10021109 | Ga0207687_100211094 | 165 |
| 492 | 3300025927 | Ga0207687_10028889 | Ga0207687_100288892 | 165 |
| 493 | 3300025928 | Ga0207700_10009373 | Ga0207700_100093733 | 165 |
| 494 | 3300025929 | Ga0207664_10242129 | Ga0207664_102421293 | 165 |
| 495 | 3300025931 | Ga0207644_10201637 | Ga0207644_102016372 | 165 |
| 496 | 3300025931 | Ga0207644_10369856 | Ga0207644_103698562 | 165 |
| 497 | 3300025933 | Ga0207706_10022997 | Ga0207706_100229975 | 165 |
| 498 | 3300025933 | Ga0207706_10166599 | Ga0207706_101665992 | 165 |
| 499 | 3300025933 | Ga0207706_11122926 | Ga0207706_111229261 | 165 |
| 500 | 3300025934 | Ga0207686_10000643 | Ga0207686_100006437 | 165 |
| 501 | 3300025934 | Ga0207686_10569602 | Ga0207686_105696022 | 165 |
| 502 | 3300025935 | Ga0207709_10114978 | Ga0207709_101149782 | 165 |
| 503 | 3300025935 | Ga0207709_10295624 | Ga0207709_102956242 | 165 |
| 504 | 3300025936 | Ga0207670_10200333 | Ga0207670_102003332 | 165 |
| 505 | 3300025937 | Ga0207669_10030571 | Ga0207669_100305714 | 165 |
| 506 | 3300025938 | Ga0207704_10072463 | Ga0207704_100724632 | 165 |
| 507 | 3300025938 | Ga0207704_10254352 | Ga0207704_102543522 | 165 |
| 508 | 3300025939 | Ga0207665_10006482 | Ga0207665_100064823 | 165 |
| 509 | 3300025939 | Ga0207665_10007475 | Ga0207665_100074756 | 165 |
| 510 | 3300025940 | Ga0207691_10317585 | Ga0207691_103175851 | 165 |
| 511 | 3300025940 | Ga0207691_10375502 | Ga0207691_103755022 | 165 |
| 512 | 3300025941 | Ga0207711_10000841 | Ga0207711_1000084130 | 165 |
| 513 | 3300025941 | Ga0207711_10202967 | Ga0207711_102029672 | 165 |
| 514 | 3300025942 | Ga0207689_10000042 | Ga0207689_100000421 | 165 |
| 515 | 3300025942 | Ga0207689_10098125 | Ga0207689_100981253 | 165 |
| 516 | 3300025942 | Ga0207689_10259163 | Ga0207689_102591632 | 165 |
| 517 | 3300025942 | Ga0207689_10364843 | Ga0207689_103648432 | 165 |
| 518 | 3300025942 | Ga0207689_10647650 | Ga0207689_106476501 | 165 |
| 519 | 3300025944 | Ga0207661_10269918 | Ga0207661_102699181 | 165 |
| 520 | 3300025960 | Ga0207651_10005645 | Ga0207651_100056456 | 165 |
| 521 | 3300025960 | Ga0207651_10028595 | Ga0207651_100285956 | 165 |
| 522 | 3300025960 | Ga0207651_10243783 | Ga0207651_102437832 | 165 |
| 523 | 3300025960 | Ga0207651_10482934 | Ga0207651_104829342 | 165 |
| 524 | 3300025961 | Ga0207712_10146338 | Ga0207712_101463381 | 165 |
| 525 | 3300025972 | Ga0207668_10008926 | Ga0207668_100089262 | 165 |
| 526 | 3300025981 | Ga0207640_10009528 | Ga0207640_100095286 | 165 |
| 527 | 3300025981 | Ga0207640_10674081 | Ga0207640_106740812 | 165 |
| 528 | 3300025986 | Ga0207658_10067312 | Ga0207658_100673123 | 165 |
| 529 | 3300025986 | Ga0207658_10174812 | Ga0207658_101748123 | 165 |
| 530 | 3300026023 | Ga0207677_10000387 | Ga0207677_100003879 | 165 |
| 531 | 3300026023 | Ga0207677_10050315 | Ga0207677_100503152 | 165 |
| 532 | 3300026035 | Ga0207703_10001656 | Ga0207703_100016569 | 165 |
| 533 | 3300026041 | Ga0207639_10175758 | Ga0207639_101757582 | 165 |
| 534 | 3300026041 | Ga0207639_10298956 | Ga0207639_102989562 | 165 |
| 535 | 3300026041 | Ga0207639_10494486 | Ga0207639_104944862 | 165 |
| 536 | 3300026067 | Ga0207678_10047155 | Ga0207678_100471552 | 165 |
| 537 | 3300026078 | Ga0207702_10005967 | Ga0207702_1000596710 | 165 |
| 538 | 3300026078 | Ga0207702_10853379 | Ga0207702_108533792 | 165 |
| 539 | 3300026088 | Ga0207641_10050841 | Ga0207641_100508412 | 165 |
| 540 | 3300026088 | Ga0207641_10122809 | Ga0207641_101228092 | 165 |
| 541 | 3300026089 | Ga0207648_10001802 | Ga0207648_100018029 | 165 |
| 542 | 3300026089 | Ga0207648_10033330 | Ga0207648_100333304 | 165 |
| 543 | 3300026089 | Ga0207648_10479342 | Ga0207648_104793421 | 165 |
| 544 | 3300026095 | Ga0207676_10000321 | Ga0207676_1000032112 | 165 |
| 545 | 3300026095 | Ga0207676_10010216 | Ga0207676_100102165 | 165 |
| 546 | 3300026116 | Ga0207674_10002494 | Ga0207674_1000249421 | 165 |
| 547 | 3300026118 | Ga0207675_100001457 | Ga0207675_10000145717 | 165 |
| 548 | 3300026118 | Ga0207675_100002290 | Ga0207675_1000022907 | 165 |
| 549 | 3300026118 | Ga0207675_100699921 | Ga0207675_1006999212 | 165 |
| 550 | 3300026121 | Ga0207683_10000560 | Ga0207683_1000056020 | 165 |
| 551 | 3300026142 | Ga0207698_10466482 | Ga0207698_104664821 | 165 |
| 552 | 3300028380 | Ga0268265_10615139 | Ga0268265_106151392 | 165 |
| 553 | 3300028381 | Ga0268264_10001973 | Ga0268264_100019738 | 165 |
| 554 | 3300028381 | Ga0268264_10242666 | Ga0268264_102426662 | 165 |
| 555 | 3300028381 | Ga0268264_10277121 | Ga0268264_102771211 | 165 |
| 556 | 3300031238 | Ga0265332_10021647 | Ga0265332_100216473 | 165 |
| 557 | 3300031249 | Ga0265339_10000248 | Ga0265339_1000024836 | 165 |
| 558 | 3300031344 | Ga0265316_10002854 | Ga0265316_100028543 | 165 |
| 559 | 3300031595 | Ga0265313_10015875 | Ga0265313_100158753 | 165 |
| 560 | 3300031711 | Ga0265314_10000001 | Ga0265314_10000001962 | 165 |
| 561 | 3300031711 | Ga0265314_10581360 | Ga0265314_105813601 | 165 |
| 562 | 3300035083 | Ga0373926_0031384 | Ga0373926_0031384_1232_1732 | 165 |
| 563 | 3300035086 | Ga0373934_0010133 | Ga0373934_0010133_872_1372 | 165 |
| 564 | 3300035086 | Ga0373934_0158597 | Ga0373934_0158597_247_750 | 165 |
| 565 | 3300035089 | Ga0373944_0075636 | Ga0373944_0075636_429_929 | 165 |
| 566 | 3300035116 | Ga0373945_0018850 | Ga0373945_0018850_995_1498 | 165 |
| 567 | 3300035119 | Ga0373956_0166267 | Ga0373956_0166267_133_633 | 165 |
| 568 | 3300035120 | Ga0373957_0030865 | Ga0373957_0030865_1301_1801 | 165 |
| 569 | 3300035120 | Ga0373957_0069706 | Ga0373957_0069706_638_1138 | 165 |
| 570 | 3300035170 | Ga0373943_0052145 | Ga0373943_0052145_84_584 | 165 |
| 571 | 3300035170 | Ga0373943_0127206 | Ga0373943_0127206_154_654 | 165 |
| 572 | 3300035171 | Ga0373946_0007519 | Ga0373946_0007519_1113_1613 | 165 |
| 573 | 3300035172 | Ga0373955_0005891 | Ga0373955_0005891_1705_2205 | 165 |
| 574 | 3300035410 | Ga0373924_0108093 | Ga0373924_0108093_448_948 | 165 |
| 575 | 3300035692 | Ga0373935_0044421 | Ga0373935_0044421_1791_2291 | 165 |
| 576 | 3300035692 | Ga0373935_0288218 | Ga0373935_0288218_43_543 | 165 |
| 577 | 3300035695 | Ga0373927_0044913 | Ga0373927_0044913_2245_2748 | 165 |
| 578 | 3300035695 | Ga0373927_0297729 | Ga0373927_0297729_353_856 | 165 |
| 579 | 3300035695 | Ga0373927_0331556 | Ga0373927_0331556_483_983 | 165 |
| 580 | 3300035724 | Ga0373933_0022005 | Ga0373933_0022005_3057_3557 | 165 |
| 581 | 3300035725 | Ga0373947_0016734 | Ga0373947_0016734_1458_1958 | 165 |
| 582 | 3300035725 | Ga0373947_0017986 | Ga0373947_0017986_774_1274 | 165 |
| 583 | 3300036401 | Ga0373937_0041017 | Ga0373937_0041017_645_1148 | 165 |
| 584 | 3300036401 | Ga0373937_0074317 | Ga0373937_0074317_1148_1717 | 165 |
| 585 | 3300036401 | Ga0373937_0107371 | Ga0373937_0107371_166_666 | 165 |
| 586 | 3300037068 | Ga0373925_0000590 | Ga0373925_0000590_9222_9725 | 165 |
| 587 | 3300037068 | Ga0373925_0049162 | Ga0373925_0049162_1155_1655 | 165 |
| 588 | 3300039438 | Ga0436360_0945100 | Ga0436360_0945100_166_669 | 165 |
| 589 | 3300039438 | Ga0436360_1348452 | Ga0436360_1348452_362_865 | 165 |
| 590 | 3300039450 | Ga0436363_1459367 | Ga0436363_1459367_303_806 | 165 |
| 591 | 3300041452 | Ga0451793_0235094 | Ga0451793_0235094_73_573 | 165 |
| 592 | 3300041486 | Ga0451807_2295206 | Ga0451807_2295206_78_578 | 165 |
| 593 | 3300044673 | Ga0453683_0251882 | Ga0453683_0251882_230_736 | 165 |
| 594 | 3300045051 | Ga0451576_0004811 | Ga0451576_0004811_1435_1941 | 165 |
| 595 | 3300046454 | Ga0495592_0029324 | Ga0495592_0029324_1232_1801 | 165 |
| 596 | 3300046459 | Ga0495629_0004517 | Ga0495629_0004517_127_630 | 165 |
| 597 | 3300046459 | Ga0495629_0346996 | Ga0495629_0346996_217_717 | 165 |
| 598 | 3300046461 | Ga0495641_0175688 | Ga0495641_0175688_212_781 | 165 |
| 599 | 3300046463 | Ga0495653_0105774 | Ga0495653_0105774_1336_1905 | 165 |
| 600 | 3300046472 | Ga0495580_0010020 | Ga0495580_0010020_786_1289 | 165 |
| 601 | 3300046472 | Ga0495580_0344231 | Ga0495580_0344231_425_925 | 165 |
| 602 | 3300046472 | Ga0495580_0389717 | Ga0495580_0389717_260_760 | 165 |
| 603 | 3300046473 | Ga0495582_0002001 | Ga0495582_0002001_10131_10631 | 165 |
| 604 | 3300046473 | Ga0495582_0169587 | Ga0495582_0169587_225_722 | 165 |
| 605 | 3300046473 | Ga0495582_0373482 | Ga0495582_0373482_163_732 | 165 |
| 606 | 3300046475 | Ga0495639_0096816 | Ga0495639_0096816_882_1379 | 165 |
| 607 | 3300046475 | Ga0495639_0125472 | Ga0495639_0125472_331_831 | 165 |
| 608 | 3300046476 | Ga0495662_0011736 | Ga0495662_0011736_1437_1940 | 165 |
| 609 | 3300046476 | Ga0495662_0023697 | Ga0495662_0023697_1072_1641 | 165 |
| 610 | 3300046477 | Ga0495664_0005933 | Ga0495664_0005933_472_972 | 165 |
| 611 | 3300046477 | Ga0495664_0262644 | Ga0495664_0262644_69_638 | 165 |
| 612 | 3300046477 | Ga0495664_0425006 | Ga0495664_0425006_122_622 | 165 |
| 613 | 3300046511 | Ga0495608_0004898 | Ga0495608_0004898_8163_8732 | 165 |
| 614 | 3300046514 | Ga0495618_0070203 | Ga0495618_0070203_930_1499 | 165 |
| 615 | 3300046516 | Ga0495628_0000915 | Ga0495628_0000915_19610_20179 | 165 |
| 616 | 3300046517 | Ga0495630_0007486 | Ga0495630_0007486_1256_1825 | 165 |
| 617 | 3300046529 | Ga0495652_0221040 | Ga0495652_0221040_321_890 | 165 |
| 618 | 3300046531 | Ga0495665_0127698 | Ga0495665_0127698_531_1034 | 165 |
| 619 | 3300046533 | Ga0495640_0020825 | Ga0495640_0020825_2541_3110 | 165 |
| 620 | 3300046533 | Ga0495640_0157869 | Ga0495640_0157869_615_1112 | 165 |
| 621 | 3300046535 | Ga0495586_0000698 | Ga0495586_0000698_10469_11038 | 165 |
| 622 | 3300046536 | Ga0495587_0012453 | Ga0495587_0012453_1960_2529 | 165 |
| 623 | 3300046536 | Ga0495587_0028617 | Ga0495587_0028617_2549_3049 | 165 |
| 624 | 3300046539 | Ga0495621_0021020 | Ga0495621_0021020_1318_1818 | 165 |
| 625 | 3300046543 | Ga0495645_0006456 | Ga0495645_0006456_1831_2331 | 165 |
| 626 | 3300046559 | Ga0495667_0004720 | Ga0495667_0004720_5219_5788 | 165 |
| 627 | 3300046559 | Ga0495667_0173461 | Ga0495667_0173461_482_985 | 165 |
| 628 | 3300046642 | Ga0495634_0003402 | Ga0495634_0003402_3926_4495 | 165 |
| 629 | 3300046642 | Ga0495634_0170024 | Ga0495634_0170024_791_1291 | 165 |
| 630 | 3300046663 | Ga0495635_0023563 | Ga0495635_0023563_784_1287 | 165 |
| 631 | 3300046663 | Ga0495635_0047563 | Ga0495635_0047563_1144_1713 | 165 |
| 632 | 3300046679 | Ga0495623_0162624 | Ga0495623_0162624_590_1090 | 165 |
| 633 | 3300046683 | Ga0495658_0092228 | Ga0495658_0092228_225_794 | 165 |
| 634 | 3300046689 | Ga0495613_0003488 | Ga0495613_0003488_8823_9392 | 165 |
| 635 | 3300046689 | Ga0495613_0126616 | Ga0495613_0126616_925_1428 | 165 |
| 636 | 3300046689 | Ga0495613_0672666 | Ga0495613_0672666_148_645 | 165 |
| 637 | 3300046690 | Ga0495624_0374256 | Ga0495624_0374256_344_844 | 165 |
| 638 | 3300046809 | Ga0495600_0071018 | Ga0495600_0071018_1260_1829 | 165 |
| 639 | 3300046809 | Ga0495600_0078997 | Ga0495600_0078997_14_517 | 165 |
| 640 | 3300047315 | Ga0495581_0000748 | Ga0495581_0000748_15785_16288 | 165 |
| 641 | 3300047317 | Ga0495604_0005164 | Ga0495604_0005164_3078_3647 | 165 |
| 642 | 3300047319 | Ga0495674_0100401 | Ga0495674_0100401_1637_2137 | 165 |
| 643 | 3300047319 | Ga0495674_0492754 | Ga0495674_0492754_304_873 | 165 |
| 644 | 3300047322 | Ga0495680_0004292 | Ga0495680_0004292_6583_7152 | 165 |
| 645 | 3300047322 | Ga0495680_0009463 | Ga0495680_0009463_3814_4314 | 165 |
| 646 | 3300047322 | Ga0495680_0684177 | Ga0495680_0684177_26_526 | 165 |
| 647 | 3300047444 | Ga0495675_0309187 | Ga0495675_0309187_297_797 | 165 |
| 648 | 3300047471 | Ga0495684_0074302 | Ga0495684_0074302_1233_1802 | 165 |
| 649 | 3300047471 | Ga0495684_0087484 | Ga0495684_0087484_1077_1577 | 165 |
| 650 | 3300047471 | Ga0495684_0090417 | Ga0495684_0090417_292_792 | 165 |
| 651 | 3300047673 | Ga0495593_0201082 | Ga0495593_0201082_242_811 | 165 |
| 652 | 3300048905 | Ga0496102_0146402 | Ga0496102_0146402_1631_2128 | 165 |
| 653 | 3300048905 | Ga0496102_0316656 | Ga0496102_0316656_708_1208 | 165 |
| 654 | 3300048906 | Ga0496103_0079575 | Ga0496103_0079575_16_513 | 165 |
| 655 | 3300048907 | Ga0496104_0351887 | Ga0496104_0351887_208_708 | 165 |
| 656 | 3300048909 | Ga0496106_0000002 | Ga0496106_0000002_93614_94138 | 165 |
| 657 | 3300048909 | Ga0496106_0171325 | Ga0496106_0171325_746_1246 | 165 |
| 658 | 3300048910 | Ga0496107_0670060 | Ga0496107_0670060_177_677 | 165 |
| 659 | 3300048912 | Ga0496109_0624444 | Ga0496109_0624444_382_882 | 165 |
| 660 | 3300048915 | Ga0496112_0014655 | Ga0496112_0014655_1502_2002 | 165 |
| 661 | 3300048916 | Ga0496113_0672280 | Ga0496113_0672280_243_740 | 165 |
| 662 | 3300048916 | Ga0496113_0845842 | Ga0496113_0845842_154_654 | 165 |
| 663 | 3300048918 | Ga0496115_0131409 | Ga0496115_0131409_488_988 | 165 |
| 664 | 3300048924 | Ga0496121_0004950 | Ga0496121_0004950_14996_15520 | 165 |
| 665 | 3300049581 | Ga0501047_0240369 | Ga0501047_0240369_1086_1589 | 165 |
| 666 | 3300049592 | Ga0501076_0194641 | Ga0501076_0194641_779_1279 | 165 |
| 667 | 3300049824 | Ga0501045_0352526 | Ga0501045_0352526_488_988 | 165 |
| 668 | 3300050493 | nmdc:mga0k408_481208_c1 | nmdc:mga0k408_481208_c1_205_705 | 165 |
| 669 | 3300050493 | nmdc:mga0k408_50078_c1 | nmdc:mga0k408_50078_c1_245_748 | 165 |
| 670 | 3300050494 | nmdc:mga06z11_269343_c1 | nmdc:mga06z11_269343_c1_447_950 | 165 |
| 671 | 3300050511 | nmdc:mga08y16_334083_c1 | nmdc:mga08y16_334083_c1_321_818 | 165 |
| 672 | 3300050512 | nmdc:mga0n895_390491_c1 | nmdc:mga0n895_390491_c1_309_809 | 165 |
| 673 | 3300050512 | nmdc:mga0n895_720958_c1 | nmdc:mga0n895_720958_c1_219_719 | 165 |
| 674 | 3300050515 | nmdc:mga0a205_1196519_c1 | nmdc:mga0a205_1196519_c1_94_594 | 165 |
| 675 | 3300053077 | Ga0495601_0043782 | Ga0495601_0043782_855_1424 | 165 |
| 676 | 3300053084 | Ga0495595_0137343 | Ga0495595_0137343_215_715 | 165 |
| 677 | 3300053084 | Ga0495595_0166901 | Ga0495595_0166901_78_647 | 165 |
| 678 | 3300053085 | Ga0495619_0003508 | Ga0495619_0003508_5970_6473 | 165 |
| 679 | 3300053085 | Ga0495619_0290755 | Ga0495619_0290755_349_849 | 165 |
| 680 | 3300053091 | Ga0500647_0102184 | Ga0500647_0102184_431_934 | 165 |
| 681 | 3300053094 | Ga0500566_0234531 | Ga0500566_0234531_101_670 | 165 |
| 682 | 2162886006 | SwRhRL3b_contig_3151609 | SwRhRL3b_0432.00001760 | 166 |
| 683 | 3300005329 | Ga0070683_100011148 | Ga0070683_1000111484 | 166 |
| 684 | 3300005333 | Ga0070677_10158455 | Ga0070677_101584552 | 166 |
| 685 | 3300005340 | Ga0070689_100317734 | Ga0070689_1003177342 | 166 |
| 686 | 3300005353 | Ga0070669_100167790 | Ga0070669_1001677902 | 166 |
| 687 | 3300005366 | Ga0070659_100985038 | Ga0070659_1009850381 | 166 |
| 688 | 3300005458 | Ga0070681_10135171 | Ga0070681_101351712 | 166 |
| 689 | 3300005535 | Ga0070684_100244053 | Ga0070684_1002440531 | 166 |
| 690 | 3300005563 | Ga0068855_100160365 | Ga0068855_1001603653 | 166 |
| 691 | 3300005564 | Ga0070664_100073970 | Ga0070664_1000739702 | 166 |
| 692 | 3300005577 | Ga0068857_100444337 | Ga0068857_1004443372 | 166 |
| 693 | 3300005614 | Ga0068856_101442375 | Ga0068856_1014423752 | 166 |
| 694 | 3300005616 | Ga0068852_101620937 | Ga0068852_1016209372 | 166 |
| 695 | 3300005617 | Ga0068859_100498096 | Ga0068859_1004980962 | 166 |
| 696 | 3300006931 | Ga0097620_100498100 | Ga0097620_1004981002 | 166 |
| 697 | 3300009093 | Ga0105240_10064488 | Ga0105240_100644884 | 166 |
| 698 | 3300009093 | Ga0105240_10960933 | Ga0105240_109609331 | 166 |
| 699 | 3300009094 | Ga0111539_10277642 | Ga0111539_102776422 | 166 |
| 700 | 3300009174 | Ga0105241_10317902 | Ga0105241_103179022 | 166 |
| 701 | 3300009545 | Ga0105237_10218975 | Ga0105237_102189753 | 166 |
| 702 | 3300009551 | Ga0105238_10048067 | Ga0105238_100480675 | 166 |
| 703 | 3300013100 | Ga0157373_10184595 | Ga0157373_101845952 | 166 |
| 704 | 3300013102 | Ga0157371_10066746 | Ga0157371_100667462 | 166 |
| 705 | 3300013105 | Ga0157369_10036715 | Ga0157369_100367156 | 166 |
| 706 | 3300020070 | Ga0206356_10789639 | Ga0206356_107896392 | 166 |
| 707 | 3300020078 | Ga0206352_10103059 | Ga0206352_101030592 | 166 |
| 708 | 3300020082 | Ga0206353_11834576 | Ga0206353_118345762 | 166 |
| 709 | 3300025909 | Ga0207705_10675545 | Ga0207705_106755452 | 166 |
| 710 | 3300025911 | Ga0207654_10258994 | Ga0207654_102589941 | 166 |
| 711 | 3300025912 | Ga0207707_10243331 | Ga0207707_102433312 | 166 |
| 712 | 3300025913 | Ga0207695_10149233 | Ga0207695_101492333 | 166 |
| 713 | 3300025913 | Ga0207695_10913973 | Ga0207695_109139731 | 166 |
| 714 | 3300025920 | Ga0207649_10142508 | Ga0207649_101425082 | 166 |
| 715 | 3300025926 | Ga0207659_10012688 | Ga0207659_100126882 | 166 |
| 716 | 3300025932 | Ga0207690_10537734 | Ga0207690_105377342 | 166 |
| 717 | 3300025936 | Ga0207670_10659490 | Ga0207670_106594902 | 166 |
| 718 | 3300025944 | Ga0207661_10318953 | Ga0207661_103189532 | 166 |
| 719 | 3300025945 | Ga0207679_10428914 | Ga0207679_104289142 | 166 |
| 720 | 3300025949 | Ga0207667_10049086 | Ga0207667_100490863 | 166 |
| 721 | 3300025949 | Ga0207667_10629151 | Ga0207667_106291512 | 166 |
| 722 | 3300026041 | Ga0207639_10094355 | Ga0207639_100943553 | 166 |
| 723 | 3300026095 | Ga0207676_10763772 | Ga0207676_107637722 | 166 |
| 724 | 3300026116 | Ga0207674_10085917 | Ga0207674_100859174 | 166 |
| 725 | 3300028379 | Ga0268266_10144234 | Ga0268266_101442342 | 166 |
| 726 | 3300037312 | Ga0395899_0030853 | Ga0395899_0030853_2583_3095 | 166 |
| 727 | 3300037418 | Ga0395900_0022094 | Ga0395900_0022094_5134_5649 | 166 |
| 728 | 3300037418 | Ga0395900_0046752 | Ga0395900_0046752_2585_3097 | 166 |
| 729 | 3300037466 | Ga0395898_0057947 | Ga0395898_0057947_2601_3113 | 166 |
| 730 | 3300038443 | Ga0395901_0013320 | Ga0395901_0013320_2693_3205 | 166 |
| 731 | 3300038443 | Ga0395901_0018343 | Ga0395901_0018343_6132_6647 | 166 |
| 732 | 3300039437 | Ga0436365_1399826 | Ga0436365_1399826_30_530 | 166 |
| 733 | 3300045051 | Ga0451576_0353048 | Ga0451576_0353048_416_916 | 166 |
| 734 | 3300048915 | Ga0496112_0573926 | Ga0496112_0573926_221_736 | 166 |
| 735 | 3300049571 | Ga0501034_0126534 | Ga0501034_0126534_1634_2146 | 166 |
| 736 | 3300059477 | Ga0587084_012657 | Ga0587084_012657_449_964 | 166 |
| 737 | 3300059490 | Ga0587066_031447 | Ga0587066_031447_358_873 | 166 |
| 738 | 3300059503 | Ga0587080_045216 | Ga0587080_045216_229_795 | 166 |
| 739 | 3300059503 | Ga0587080_047059 | Ga0587080_047059_272_784 | 166 |
| 740 | 3300059510 | Ga0587090_039217 | Ga0587090_039217_83_598 | 166 |
| 741 | 3300059510 | Ga0587090_068009 | Ga0587090_068009_68_580 | 166 |
| 742 | 3300059514 | Ga0587095_022840 | Ga0587095_022840_89_601 | 166 |
| 743 | 3300059623 | Ga0587101_053164 | Ga0587101_053164_98_610 | 166 |
| 744 | 3300059642 | Ga0587069_052312 | Ga0587069_052312_141_656 | 166 |
| 745 | 3300059654 | Ga0587110_039579 | Ga0587110_039579_77_592 | 166 |
| 746 | 3300060344 | Ga0587071_030440 | Ga0587071_030440_238_753 | 166 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e5d-assembly1.cif.gz_A-2 | crystal structure of a putative glyoxalase i (lmof2365_0426) from listeria monocytogenes str. 4b f2365 at 2.70 a resolution | 0.8338 | 5 | 130 |
| 2p7p-assembly2.cif.gz_D | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion | 0.8303 | 1 | 136 |
| 2p7q-assembly4.cif.gz_D-2 | crystal structure of e126q mutant of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and 1s,2s-dihydroxypropylphosphonic acid | 0.8199 | 1 | 136 |
| 2p7l-assembly4.cif.gz_A | crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 5.75 | 0.8157 | 1 | 137 |
| 2p7p-assembly4.cif.gz_B | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion | 0.811 | 1 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ81_10_141_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8299 | 5 | 133 | 3.10.180.10 |
| af_Q2FVA5_9_134_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8226 | 3 | 135 | 3.10.180.10 |
| 3e5dA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8164 | 4 | 130 | 3.10.180.10 |
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8132 | 1 | 64 | 3.10.180.10 |
| 2rk0B01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8123 | 6 | 129 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523JZR9-F1-model_v4 | VOC family protein | 0.9727 | 1 | 134 |
|
| AF-A0A537MQR2-F1-model_v4 | VOC family protein | 0.9702 | 1 | 120 |
|
| AF-A0A523JZR9-F1-model_v4 | VOC family protein | 0.9657 | 1 | 134 |
|
| AF-A0A3D5I989-F1-model_v4 | VOC family protein | 0.9622 | 1 | 148 |
|
| AF-A0A537MQR2-F1-model_v4 | VOC family protein | 0.9547 | 1 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar