F478854

General Info

Members Datasets Scaffolds Average Seq Length
746 360 1492 109

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10193537|Ga0075433_101935373
Length 129
Sequence MASCCYRKRSAAPAPSNGKVMKITDIPFGTTDWSSIEPTLHKGDSGLATWRTRQFGDIRVRLVDYSPGYVADHWCQKGHILFCVDGELGTDLVDGRSFTLTPGMSYQVADGAEAHRSRTDKGARLFIVD

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
204 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
209 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
319 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
320 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
337 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
338 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
339 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
340 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
341 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
349 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
350 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
351 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
352 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
353 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
354 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
355 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
356 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
357 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
358 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
359 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
360 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 1.21
Isolates 1.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 12.87
Nodule 0.13
Rhizoplane 4.83
Rhizosphere 77.88
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10193537 3300006852 Bacteria 1809
2 Ga0055540_1054584 3300003792 Unclassified 814
3 Ga0070658_10054057 3300005327 Bacteria 3260
4 Ga0070683_100012067 3300005329 Bacteria 7496
5 Ga0070683_100029224 3300005329 Bacteria 4988
6 Ga0070683_100098359 3300005329 Bacteria 2754
7 Ga0070683_100697027 3300005329 Bacteria 972
8 Ga0070690_100785030 3300005330 Bacteria 738
9 Ga0070670_101009318 3300005331 Unclassified 757
10 Ga0068869_101364714 3300005334 Bacteria 627
11 Ga0070680_100035730 3300005336 Bacteria 4012
12 Ga0070680_100547726 3300005336 Unclassified 991
13 Ga0070680_100630773 3300005336 Bacteria 920
14 Ga0070680_101050940 3300005336 Bacteria 704
15 Ga0070682_100473102 3300005337 Bacteria 965
16 Ga0070682_101946403 3300005337 Bacteria 516
17 Ga0070660_100406346 3300005339 Bacteria 1126
18 Ga0070660_100679665 3300005339 Bacteria 863
19 Ga0070689_100503707 3300005340 Bacteria 1038
20 Ga0070691_10251134 3300005341 Bacteria 949
21 Ga0070687_100223940 3300005343 Bacteria 1154
22 Ga0070661_100252817 3300005344 Bacteria 1360
23 Ga0070692_10023303 3300005345 Bacteria 3032
24 Ga0070659_100453985 3300005366 Bacteria 1087
25 Ga0070703_10125273 3300005406 Bacteria 937
26 Ga0070709_10016552 3300005434 Bacteria 4213
27 Ga0070709_10391599 3300005434 Bacteria 1035
28 Ga0070709_10489511 3300005434 Bacteria 932
29 Ga0070709_11037322 3300005434 Bacteria 654
30 Ga0070714_100080604 3300005435 Bacteria 2832
31 Ga0070714_100420651 3300005435 Bacteria 1266
32 Ga0070714_100513046 3300005435 Bacteria 1144
33 Ga0070714_101682644 3300005435 Bacteria 620
34 Ga0070713_100030759 3300005436 Bacteria 4268
35 Ga0070713_100098500 3300005436 Bacteria 2528
36 Ga0070713_100361621 3300005436 Bacteria 1348
37 Ga0070713_101524416 3300005436 Bacteria 649
38 Ga0070710_10011931 3300005437 Bacteria 4306
39 Ga0070710_10042462 3300005437 Bacteria 2514
40 Ga0070710_10513944 3300005437 Bacteria 822
41 Ga0070701_10589426 3300005438 Bacteria 735
42 Ga0070701_10820219 3300005438 Bacteria 636
43 Ga0070711_100064263 3300005439 Bacteria 2564
44 Ga0070711_100157542 3300005439 Bacteria 1718
45 Ga0070662_101689254 3300005457 Bacteria 547
46 Ga0070681_10046609 3300005458 Bacteria 4333
47 Ga0070681_10058638 3300005458 Bacteria 3829
48 Ga0070681_10095398 3300005458 Bacteria 2923
49 Ga0070681_10098990 3300005458 Unclassified 2862
50 Ga0070681_10553237 3300005458 Bacteria 1064
51 Ga0070681_10588767 3300005458 Bacteria 1027
52 Ga0070681_11005570 3300005458 Bacteria 754
53 Ga0070685_10911352 3300005466 Bacteria 655
54 Ga0070699_102180796 3300005518 Bacteria 506
55 Ga0070679_100052349 3300005530 Bacteria 4067
56 Ga0070679_100078568 3300005530 Unclassified 3288
57 Ga0070679_100244218 3300005530 Bacteria 1752
58 Ga0070679_100342564 3300005530 Bacteria 1443
59 Ga0070679_100374546 3300005530 Bacteria 1370
60 Ga0070679_100447967 3300005530 Bacteria 1236
61 Ga0070679_100716202 3300005530 Bacteria 944
62 Ga0070684_100045377 3300005535 Bacteria 3806
63 Ga0070684_100452692 3300005535 Bacteria 1186
64 Ga0070684_100707131 3300005535 Bacteria 939
65 Ga0070684_101388888 3300005535 Bacteria 661
66 Ga0068853_100237770 3300005539 Bacteria 1668
67 Ga0068853_100269390 3300005539 Bacteria 1568
68 Ga0068853_100407436 3300005539 Bacteria 1273
69 Ga0068853_101453528 3300005539 Bacteria 663
70 Ga0070672_101313409 3300005543 Bacteria 646
71 Ga0070693_100060081 3300005547 Bacteria 2206
72 Ga0070665_101629863 3300005548 Bacteria 653
73 Ga0068855_100043632 3300005563 Bacteria 5310
74 Ga0068855_100388835 3300005563 Bacteria 1530
75 Ga0068855_100728082 3300005563 Bacteria 1059
76 Ga0068855_101373711 3300005563 Bacteria 729
77 Ga0070664_100984262 3300005564 Unclassified 792
78 Ga0068857_100322633 3300005577 Bacteria 1426
79 Ga0068857_100449413 3300005577 Bacteria 1205
80 Ga0068857_100869258 3300005577 Bacteria 863
81 Ga0068857_100967050 3300005577 Bacteria 818
82 Ga0068854_100439182 3300005578 Bacteria 1087
83 Ga0068854_100698516 3300005578 Bacteria 875
84 Ga0068856_100417087 3300005614 Bacteria 1362
85 Ga0068856_101389899 3300005614 Bacteria 716
86 Ga0068856_101404774 3300005614 Bacteria 712
87 Ga0068856_101650961 3300005614 Bacteria 654
88 Ga0068856_102713160 3300005614 Bacteria 500
89 Ga0068852_100230984 3300005616 Bacteria 1763
90 Ga0068859_101135870 3300005617 Bacteria 860
91 Ga0068859_101238267 3300005617 Bacteria 822
92 Ga0068859_101939127 3300005617 Bacteria 650
93 Ga0068864_101536850 3300005618 Bacteria 669
94 Ga0068861_101100434 3300005719 Bacteria 764
95 Ga0068870_10421468 3300005840 Bacteria 873
96 Ga0068870_10990816 3300005840 Bacteria 599
97 Ga0068863_100090298 3300005841 Unclassified 2905
98 Ga0068863_101433478 3300005841 Bacteria 699
99 Ga0068860_100792335 3300005843 Bacteria 961
100 Ga0068860_101281047 3300005843 Bacteria 754
101 Ga0068862_100738594 3300005844 Bacteria 957
102 Ga0068862_100898600 3300005844 Bacteria 870
103 Ga0081455_10565504 3300005937 Bacteria 748
104 Ga0081539_10197009 3300005985 Bacteria 933
105 Ga0070717_10186052 3300006028 Bacteria 1813
106 Ga0070717_10720382 3300006028 Bacteria 907
107 Ga0070717_11202703 3300006028 Bacteria 690
108 Ga0070717_11618768 3300006028 Bacteria 587
109 Ga0075368_10134788 3300006042 Bacteria 1027
110 Ga0075368_10298683 3300006042 Bacteria 694
111 Ga0075363_100021984 3300006048 Bacteria 3220
112 Ga0075363_100188898 3300006048 Bacteria 1174
113 Ga0075363_100326343 3300006048 Bacteria 893
114 Ga0075363_100383324 3300006048 Bacteria 824
115 Ga0075364_10004607 3300006051 Bacteria 7946
116 Ga0075364_10008706 3300006051 Bacteria 6069
117 Ga0075364_10231624 3300006051 Bacteria 1254
118 Ga0075364_10411996 3300006051 Bacteria 922
119 Ga0075364_11172371 3300006051 Bacteria 521
120 Ga0075432_10001643 3300006058 Bacteria 7361
121 Ga0070716_100748219 3300006173 Bacteria 752
122 Ga0070712_100243575 3300006175 Bacteria 1433
123 Ga0070712_100265670 3300006175 Bacteria 1376
124 Ga0070712_100574802 3300006175 Bacteria 952
125 Ga0075362_10016805 3300006177 Bacteria 3003
126 Ga0075362_10021345 3300006177 Bacteria 2715
127 Ga0075362_10183630 3300006177 Bacteria 1014
128 Ga0075362_10488297 3300006177 Unclassified 629
129 Ga0075367_10022590 3300006178 Bacteria 3530
130 Ga0075367_10042800 3300006178 Bacteria 2651
131 Ga0075367_10050154 3300006178 Bacteria 2463
132 Ga0075367_10213901 3300006178 Bacteria 1205
133 Ga0075367_10516557 3300006178 Bacteria 758
134 Ga0075367_10533036 3300006178 Bacteria 745
135 Ga0075367_10657157 3300006178 Bacteria 666
136 Ga0075367_10870074 3300006178 Bacteria 574
137 Ga0075369_10349528 3300006186 Bacteria 693
138 Ga0075369_10376419 3300006186 Bacteria 668
139 Ga0075369_10420562 3300006186 Bacteria 631
140 Ga0075366_10105539 3300006195 Bacteria 1693
141 Ga0075370_10009268 3300006353 Bacteria 5105
142 Ga0075370_10014898 3300006353 Bacteria 4153
143 Ga0075370_10100196 3300006353 Bacteria 1676
144 Ga0075370_10356728 3300006353 Bacteria 874
145 Ga0075370_10494665 3300006353 Bacteria 738
146 Ga0075370_10955195 3300006353 Bacteria 525
147 Ga0068871_101663963 3300006358 Bacteria 605
148 Ga0075428_100011323 3300006844 Bacteria 9923
149 Ga0075428_100421857 3300006844 Bacteria 1429
150 Ga0075428_101067222 3300006844 Bacteria 854
151 Ga0075430_100247618 3300006846 Bacteria 1477
152 Ga0075431_100060621 3300006847 Bacteria 3904
153 Ga0075433_10305103 3300006852 Bacteria 1410
154 Ga0075433_10545327 3300006852 Bacteria 1020
155 Ga0075433_10553528 3300006852 Bacteria 1011
156 Ga0075433_10810593 3300006852 Bacteria 818
157 Ga0075434_100033334 3300006871 Bacteria 5082
158 Ga0075434_100036092 3300006871 Bacteria 4888
159 Ga0075434_100851653 3300006871 Bacteria 927
160 Ga0075429_100361076 3300006880 Bacteria 1272
161 Ga0068865_100324234 3300006881 Bacteria 1240
162 Ga0075436_100080136 3300006914 Bacteria 2262
163 Ga0075436_100526221 3300006914 Bacteria 867
164 Ga0097620_100009061 3300006931 Bacteria 10051
165 Ga0097620_101136039 3300006931 Bacteria 860
166 Ga0097620_101238195 3300006931 Bacteria 822
167 Ga0097620_101938648 3300006931 Bacteria 650
168 Ga0075435_100090674 3300007076 Bacteria 2521
169 Ga0099794_10422390 3300007265 Bacteria 697
170 Ga0099794_10614831 3300007265 Bacteria 576
171 Ga0099795_10093343 3300007788 Bacteria 1170
172 Ga0105251_10006339 3300009011 Bacteria 7560
173 Ga0105244_10002321 3300009036 Bacteria 14469
174 Ga0105240_10142756 3300009093 Bacteria 2861
175 Ga0105240_10686071 3300009093 Bacteria 1119
176 Ga0105240_11027533 3300009093 Bacteria 880
177 Ga0111539_10852667 3300009094 Bacteria 1060
178 Ga0111539_10923655 3300009094 Bacteria 1015
179 Ga0111539_11063208 3300009094 Bacteria 941
180 Ga0105245_11172352 3300009098 Bacteria 816
181 Ga0105245_11595693 3300009098 Bacteria 704
182 Ga0105247_10471471 3300009101 Bacteria 909
183 Ga0105247_10576261 3300009101 Bacteria 831
184 Ga0105247_10582863 3300009101 Bacteria 827
185 Ga0114129_10307738 3300009147 Bacteria 2110
186 Ga0114129_11563380 3300009147 Bacteria 809
187 Ga0114129_13044976 3300009147 Bacteria 550
188 Ga0105243_11330429 3300009148 Bacteria 737
189 Ga0105243_11728214 3300009148 Bacteria 655
190 Ga0105243_12591692 3300009148 Bacteria 547
191 Ga0105242_10479365 3300009176 Bacteria 1179
192 Ga0105248_10040040 3300009177 Bacteria 5252
193 Ga0105248_13387833 3300009177 Bacteria 506
194 Ga0105237_10548545 3300009545 Bacteria 1162
195 Ga0105237_10641915 3300009545 Bacteria 1068
196 Ga0105237_11121341 3300009545 Bacteria 793
197 Ga0105237_11685465 3300009545 Bacteria 641
198 Ga0105238_10583258 3300009551 Bacteria 1125
199 Ga0105238_10830198 3300009551 Bacteria 941
200 Ga0105238_11023374 3300009551 Bacteria 847
201 Ga0105238_11277968 3300009551 Bacteria 759
202 Ga0105238_11522304 3300009551 Bacteria 698
203 Ga0105249_10642749 3300009553 Bacteria 1118
204 Ga0099796_10102155 3300010159 Bacteria 1080
205 Ga0105239_11422316 3300010375 Bacteria 801
206 Ga0105239_11963558 3300010375 Bacteria 679
207 Ga0157373_10854486 3300013100 Bacteria 673
208 Ga0157371_10008545 3300013102 Bacteria 8151
209 Ga0157370_10000942 3300013104 Bacteria 36921
210 Ga0157370_10261786 3300013104 Bacteria 1598
211 Ga0157370_10655015 3300013104 Bacteria 960
212 Ga0157370_10896408 3300013104 Bacteria 805
213 Ga0157369_10008037 3300013105 Bacteria 12098
214 Ga0157369_10011202 3300013105 Bacteria 10192
215 Ga0157369_10104181 3300013105 Bacteria 3022
216 Ga0157369_10323622 3300013105 Bacteria 1603
217 Ga0157369_10586604 3300013105 Bacteria 1151
218 Ga0157369_10822694 3300013105 Bacteria 954
219 Ga0157369_10963554 3300013105 Bacteria 874
220 Ga0157369_11213355 3300013105 Unclassified 770
221 Ga0157378_10880297 3300013297 Bacteria 925
222 Ga0157378_10980479 3300013297 Bacteria 879
223 Ga0163162_10781073 3300013306 Bacteria 1073
224 Ga0163162_11985232 3300013306 Bacteria 666
225 Ga0163162_12437969 3300013306 Bacteria 601
226 Ga0157372_11076241 3300013307 Bacteria 930
227 Ga0157375_10821939 3300013308 Bacteria 1077
228 Ga0157375_11437892 3300013308 Bacteria 813
229 Ga0163163_10888201 3300014325 Bacteria 955
230 Ga0163163_11988378 3300014325 Bacteria 641
231 Ga0163163_12033822 3300014325 Bacteria 634
232 Ga0157380_10842803 3300014326 Bacteria 938
233 Ga0157380_12053311 3300014326 Bacteria 634
234 Ga0157380_12245416 3300014326 Bacteria 610
235 Ga0157380_12701113 3300014326 Bacteria 563
236 Ga0182008_10267871 3300014497 Bacteria 885
237 Ga0157379_10849921 3300014968 Bacteria 863
238 Ga0157379_11742147 3300014968 Bacteria 611
239 Ga0182006_1188511 3300015261 Bacteria 686
240 Ga0197907_10998507 3300020069 Bacteria 704
241 Ga0197907_11482679 3300020069 Bacteria 1168
242 Ga0206356_11170346 3300020070 Bacteria 633
243 Ga0206350_10729085 3300020080 Bacteria 672
244 Ga0206353_11383556 3300020082 Bacteria 772
245 Ga0206353_11504873 3300020082 Bacteria 911
246 Ga0213876_10014986 3300021384 Bacteria 4109
247 Ga0213876_10051088 3300021384 Bacteria 2185
248 Ga0224712_10030270 3300022467 Bacteria 1952
249 Ga0224712_10234422 3300022467 Bacteria 844
250 Ga0224712_10332810 3300022467 Bacteria 715
251 Ga0209051_1007057 3300025303 Bacteria 6213
252 Ga0207697_10082784 3300025315 Bacteria 1353
253 Ga0207655_1005567 3300025728 Bacteria 8536
254 Ga0207713_1026348 3300025735 Bacteria 2666
255 Ga0207692_10477323 3300025898 Bacteria 788
256 Ga0207710_10063659 3300025900 Bacteria 1678
257 Ga0207685_10495882 3300025905 Bacteria 642
258 Ga0207699_10055913 3300025906 Bacteria 2350
259 Ga0207699_10062583 3300025906 Bacteria 2244
260 Ga0207699_10547136 3300025906 Bacteria 839
261 Ga0207699_10610040 3300025906 Bacteria 795
262 Ga0207699_10677317 3300025906 Bacteria 754
263 Ga0207705_10276644 3300025909 Bacteria 1284
264 Ga0207705_10459944 3300025909 Bacteria 987
265 Ga0207707_10003136 3300025912 Bacteria 14679
266 Ga0207707_10951130 3300025912 Bacteria 707
267 Ga0207707_11586825 3300025912 Bacteria 516
268 Ga0207695_10025863 3300025913 Bacteria 6559
269 Ga0207671_10280815 3300025914 Bacteria 1313
270 Ga0207671_10741529 3300025914 Bacteria 780
271 Ga0207693_10022622 3300025915 Bacteria 4994
272 Ga0207693_10094460 3300025915 Bacteria 2343
273 Ga0207693_11238806 3300025915 Bacteria 561
274 Ga0207663_10019053 3300025916 Bacteria 3857
275 Ga0207663_10176085 3300025916 Bacteria 1523
276 Ga0207663_10743999 3300025916 Bacteria 778
277 Ga0207663_11235507 3300025916 Bacteria 602
278 Ga0207663_11738672 3300025916 Bacteria 502
279 Ga0207660_10045107 3300025917 Bacteria 3104
280 Ga0207660_10178326 3300025917 Bacteria 1648
281 Ga0207660_10829213 3300025917 Bacteria 755
282 Ga0207657_10107787 3300025919 Bacteria 2304
283 Ga0207649_10515339 3300025920 Bacteria 911
284 Ga0207649_10785116 3300025920 Bacteria 743
285 Ga0207649_10935386 3300025920 Bacteria 680
286 Ga0207652_10052385 3300025921 Bacteria 3502
287 Ga0207652_10061514 3300025921 Bacteria 3242
288 Ga0207652_10067795 3300025921 Unclassified 3094
289 Ga0207652_10153811 3300025921 Bacteria 2060
290 Ga0207652_10384892 3300025921 Bacteria 1266
291 Ga0207652_10579517 3300025921 Bacteria 1007
292 Ga0207652_10823993 3300025921 Bacteria 823
293 Ga0207694_10612656 3300025924 Bacteria 916
294 Ga0207650_10714712 3300025925 Unclassified 847
295 Ga0207687_11185894 3300025927 Bacteria 656
296 Ga0207700_10000968 3300025928 Bacteria 16567
297 Ga0207700_10040508 3300025928 Bacteria 3401
298 Ga0207664_10107056 3300025929 Bacteria 2319
299 Ga0207664_10407773 3300025929 Bacteria 1209
300 Ga0207664_10655215 3300025929 Bacteria 944
301 Ga0207664_11639989 3300025929 Bacteria 565
302 Ga0207686_10269704 3300025934 Bacteria 1251
303 Ga0207704_10389244 3300025938 Bacteria 1097
304 Ga0207704_10745098 3300025938 Bacteria 814
305 Ga0207665_10367043 3300025939 Bacteria 1090
306 Ga0207665_11124691 3300025939 Bacteria 626
307 Ga0207711_10173445 3300025941 Bacteria 1958
308 Ga0207689_11037739 3300025942 Bacteria 691
309 Ga0207661_10000608 3300025944 Bacteria 22916
310 Ga0207661_10018652 3300025944 Bacteria 5157
311 Ga0207661_10048969 3300025944 Bacteria 3361
312 Ga0207661_11226227 3300025944 Bacteria 690
313 Ga0207661_11658133 3300025944 Bacteria 584
314 Ga0207679_11093799 3300025945 Unclassified 731
315 Ga0207667_10038289 3300025949 Bacteria 5123
316 Ga0207667_10704009 3300025949 Bacteria 1012
317 Ga0207667_11361962 3300025949 Bacteria 684
318 Ga0207668_11916388 3300025972 Bacteria 534
319 Ga0207640_10119188 3300025981 Bacteria 1887
320 Ga0207703_10403669 3300026035 Bacteria 1268
321 Ga0207639_10072365 3300026041 Bacteria 2699
322 Ga0207639_10264223 3300026041 Bacteria 1507
323 Ga0207639_11110591 3300026041 Bacteria 742
324 Ga0207678_10655950 3300026067 Bacteria 922
325 Ga0207708_11059011 3300026075 Bacteria 706
326 Ga0207702_10589279 3300026078 Bacteria 1090
327 Ga0207702_11275939 3300026078 Bacteria 729
328 Ga0207641_10590864 3300026088 Unclassified 1086
329 Ga0207648_11094858 3300026089 Unclassified 747
330 Ga0207674_10122397 3300026116 Bacteria 2568
331 Ga0207674_10212794 3300026116 Bacteria 1882
332 Ga0207674_10381763 3300026116 Bacteria 1362
333 Ga0207674_12241042 3300026116 Bacteria 509
334 Ga0207675_100592869 3300026118 Bacteria 1110
335 Ga0207675_100779064 3300026118 Bacteria 969
336 Ga0207675_101020314 3300026118 Bacteria 846
337 Ga0207698_10157183 3300026142 Bacteria 1983
338 Ga0207698_10428258 3300026142 Bacteria 1271
339 Ga0209179_1014368 3300027512 Bacteria 1453
340 Ga0209179_1020442 3300027512 Bacteria 1284
341 Ga0209588_1024254 3300027671 Bacteria 1915
342 Ga0209813_10002219 3300027866 Bacteria 4434
343 Ga0209813_10115147 3300027866 Bacteria 930
344 Ga0209813_10296745 3300027866 Bacteria 627
345 Ga0209813_10307041 3300027866 Bacteria 618
346 Ga0207428_10592673 3300027907 Bacteria 799
347 Ga0268266_10363705 3300028379 Bacteria 1362
348 Ga0268266_11953914 3300028379 Bacteria 560
349 Ga0268265_10085542 3300028380 Bacteria 2503
350 Ga0268265_10925655 3300028380 Bacteria 857
351 Ga0268264_10412522 3300028381 Bacteria 1301
352 Ga0268264_11679493 3300028381 Bacteria 646
353 Ga0265338_10311385 3300028800 Bacteria 1142
354 Ga0265338_10856173 3300028800 Bacteria 621
355 Ga0307511_10000496 3300030521 Bacteria 42565
356 Ga0265325_10000006 3300031241 Bacteria 255758
357 Ga0265339_10188942 3300031249 Bacteria 1022
358 Ga0307513_10000066 3300031456 Bacteria 141617
359 Ga0307509_10147321 3300031507 Bacteria 2277
360 Ga0307408_101196758 3300031548 Bacteria 709
361 Ga0265313_10005418 3300031595 Bacteria 9399
362 Ga0265313_10009773 3300031595 Bacteria 6181
363 Ga0265314_10138891 3300031711 Bacteria 1505
364 Ga0265342_10001631 3300031712 Bacteria 20687
365 Ga0265342_10389112 3300031712 Bacteria 721
366 Ga0307405_11412371 3300031731 Bacteria 609
367 Ga0307406_11023916 3300031901 Bacteria 709
368 Ga0307406_11840003 3300031901 Bacteria 539
369 Ga0307409_101753214 3300031995 Bacteria 650
370 Ga0307416_100485089 3300032002 Bacteria 1297
371 Ga0307416_101167142 3300032002 Bacteria 875
372 Ga0307510_10055966 3300033180 Bacteria 4114
373 Ga0307510_10400514 3300033180 Bacteria 816
374 Ga0373928_0037249 3300035084 Bacteria 1103
375 Ga0373934_0046494 3300035086 Bacteria 1717
376 Ga0373934_0088927 3300035086 Bacteria 1244
377 Ga0373944_0043350 3300035089 Bacteria 1398
378 Ga0373923_0104822 3300035111 Bacteria 1250
379 Ga0373923_0112273 3300035111 Bacteria 1211
380 Ga0373923_0256848 3300035111 Bacteria 819
381 Ga0373923_0568896 3300035111 Bacteria 556
382 Ga0373923_0634240 3300035111 Bacteria 528
383 Ga0373936_0010756 3300035113 Bacteria 3456
384 Ga0373936_0184373 3300035113 Bacteria 916
385 Ga0373936_0190755 3300035113 Bacteria 902
386 Ga0373939_0261736 3300035114 Bacteria 677
387 Ga0373945_0004868 3300035116 Bacteria 4277
388 Ga0373945_0071359 3300035116 Bacteria 1315
389 Ga0373953_0115908 3300035117 Bacteria 1135
390 Ga0373953_0323743 3300035117 Bacteria 674
391 Ga0373954_0017172 3300035118 Bacteria 3246
392 Ga0373954_0020314 3300035118 Bacteria 3003
393 Ga0373954_0026139 3300035118 Bacteria 2674
394 Ga0373954_0278106 3300035118 Bacteria 825
395 Ga0373956_0021146 3300035119 Bacteria 2774
396 Ga0373956_0206081 3300035119 Bacteria 932
397 Ga0373957_0004774 3300035120 Bacteria 4152
398 Ga0373943_0015255 3300035170 Bacteria 3489
399 Ga0373943_0029550 3300035170 Bacteria 2590
400 Ga0373943_0120903 3300035170 Bacteria 1391
401 Ga0373943_0416034 3300035170 Bacteria 778
402 Ga0373946_0003634 3300035171 Bacteria 5464
403 Ga0373946_0029864 3300035171 Bacteria 2173
404 Ga0373946_0381220 3300035171 Bacteria 709
405 Ga0373946_0385705 3300035171 Bacteria 705
406 Ga0373955_0001781 3300035172 Bacteria 9242
407 Ga0373955_0049339 3300035172 Bacteria 2285
408 Ga0373955_0776184 3300035172 Bacteria 589
409 Ga0373942_0334609 3300035207 Bacteria 532
410 Ga0373961_0130431 3300035241 Bacteria 841
411 Ga0373924_0052244 3300035410 Bacteria 1696
412 Ga0373924_0200928 3300035410 Bacteria 879
413 Ga0373924_0342208 3300035410 Bacteria 666
414 Ga0373931_0005871 3300035691 Bacteria 5711
415 Ga0373931_0550663 3300035691 Bacteria 749
416 Ga0373935_0000758 3300035692 Bacteria 17187
417 Ga0373935_0050947 3300035692 Bacteria 2628
418 Ga0373927_0002965 3300035695 Bacteria 12316
419 Ga0373927_0136973 3300035695 Bacteria 1600
420 Ga0373933_0059462 3300035724 Bacteria 2302
421 Ga0373933_0268610 3300035724 Bacteria 1100
422 Ga0373933_0414531 3300035724 Bacteria 879
423 Ga0373933_0788166 3300035724 Bacteria 625
424 Ga0373947_0004260 3300035725 Bacteria 8395
425 Ga0373947_0019316 3300035725 Bacteria 3928
426 Ga0373937_0035246 3300036401 Bacteria 4554
427 Ga0373937_0039913 3300036401 Bacteria 4278
428 Ga0373937_0076111 3300036401 Bacteria 3099
429 Ga0373937_0161860 3300036401 Bacteria 2098
430 Ga0373937_0222701 3300036401 Bacteria 1776
431 Ga0373925_0002392 3300037068 Bacteria 15047
432 Ga0373925_0027418 3300037068 Bacteria 4169
433 Ga0373925_0032439 3300037068 Bacteria 3844
434 Ga0395899_0122677 3300037312 Bacteria 1860
435 Ga0395900_0037349 3300037418 Bacteria 5009
436 Ga0395898_0013627 3300037466 Bacteria 8367
437 Ga0436364_0241659 3300037853 Bacteria 1039
438 Ga0395901_0855773 3300038443 Bacteria 894
439 Ga0436365_0232830 3300039437 Bacteria 7028
440 Ga0436365_0306056 3300039437 Bacteria 873
441 Ga0436365_0445089 3300039437 Bacteria 1233
442 Ga0436365_0582930 3300039437 Bacteria 1550
443 Ga0436365_1024875 3300039437 Bacteria 1031
444 Ga0436363_1015520 3300039450 Bacteria 751
445 Ga0451797_1483766 3300041453 Bacteria 733
446 Ga0451798_0519614 3300041458 Bacteria 845
447 Ga0451804_0546764 3300041463 Bacteria 741
448 Ga0451807_2370069 3300041486 Bacteria 750
449 Ga0451853_0120830 3300041512 Bacteria 659
450 Ga0451853_1828065 3300041512 Bacteria 868
451 Ga0439441_100781 3300042001 Bacteria 647
452 Ga0439452_000001 3300042010 Bacteria 1725439
453 Ga0450923_102525 3300042125 Bacteria 661
454 Ga0451577_0001841 3300042876 Bacteria 27027
455 Ga0451577_0035569 3300042876 Bacteria 4487
456 Ga0451577_0060913 3300042876 Bacteria 3365
457 Ga0451577_0354854 3300042876 Bacteria 1330
458 Ga0451577_0612821 3300042876 Bacteria 988
459 Ga0466963_0151155 3300044694 Bacteria 1612
460 Ga0466963_0218049 3300044694 Bacteria 1336
461 Ga0466963_1259267 3300044694 Bacteria 519
462 Ga0453684_0004974 3300044712 Bacteria 27048
463 Ga0453684_0203865 3300044712 Bacteria 2303
464 Ga0466971_0394062 3300044719 Bacteria 674
465 Ga0451576_0001292 3300045051 Bacteria 43381
466 Ga0466958_0633113 3300045836 Bacteria 696
467 Ga0466967_0399204 3300045976 Bacteria 1337
468 Ga0466967_1185420 3300045976 Bacteria 761
469 Ga0495592_0003145 3300046454 Bacteria 11808
470 Ga0495592_0006804 3300046454 Bacteria 8533
471 Ga0495592_0108414 3300046454 Bacteria 1968
472 Ga0495592_0672834 3300046454 Bacteria 625
473 Ga0495603_0000027 3300046455 Bacteria 61238
474 Ga0495603_0123279 3300046455 Bacteria 1510
475 Ga0495629_0000290 3300046459 Bacteria 43459
476 Ga0495629_0045096 3300046459 Bacteria 3094
477 Ga0495641_0005129 3300046461 Bacteria 8967
478 Ga0495651_0393280 3300046462 Bacteria 907
479 Ga0495651_0685742 3300046462 Bacteria 640
480 Ga0495653_0173096 3300046463 Bacteria 1488
481 Ga0495653_0414018 3300046463 Bacteria 854
482 Ga0495580_0003356 3300046472 Bacteria 13678
483 Ga0495580_0044822 3300046472 Bacteria 3144
484 Ga0495582_0000157 3300046473 Bacteria 36665
485 Ga0495582_0019831 3300046473 Bacteria 3677
486 Ga0495639_0000048 3300046475 Bacteria 53257
487 Ga0495639_0113035 3300046475 Bacteria 1290
488 Ga0495662_0000814 3300046476 Bacteria 15152
489 Ga0495662_0074567 3300046476 Bacteria 1646
490 Ga0495664_0007669 3300046477 Bacteria 6002
491 Ga0495664_0089917 3300046477 Bacteria 1846
492 Ga0495664_0224664 3300046477 Bacteria 1136
493 Ga0495594_0001217 3300046499 Bacteria 13445
494 Ga0495594_0203461 3300046499 Bacteria 1129
495 Ga0495607_0000282 3300046501 Bacteria 54473
496 Ga0495607_0256358 3300046501 Bacteria 840
497 Ga0495608_0417745 3300046511 Bacteria 819
498 Ga0495610_0145234 3300046512 Bacteria 1017
499 Ga0495618_0018661 3300046514 Bacteria 4260
500 Ga0495618_0176535 3300046514 Bacteria 1358
501 Ga0495618_0338644 3300046514 Bacteria 929
502 Ga0495628_0079335 3300046516 Bacteria 2552
503 Ga0495628_0410695 3300046516 Bacteria 988
504 Ga0495630_0016268 3300046517 Bacteria 5434
505 Ga0495630_0231551 3300046517 Bacteria 1411
506 Ga0495630_0561609 3300046517 Bacteria 875
507 Ga0495630_0598922 3300046517 Bacteria 845
508 Ga0495630_0874337 3300046517 Bacteria 685
509 Ga0495643_0077355 3300046522 Bacteria 1739
510 Ga0495666_0224558 3300046526 Bacteria 859
511 Ga0495666_0243513 3300046526 Bacteria 820
512 Ga0495652_0023266 3300046529 Bacteria 5493
513 Ga0495652_0026434 3300046529 Bacteria 5129
514 Ga0495652_0392015 3300046529 Bacteria 985
515 Ga0495665_0002259 3300046531 Bacteria 10438
516 Ga0495665_0042045 3300046531 Bacteria 2433
517 Ga0495640_0026051 3300046533 Bacteria 4232
518 Ga0495640_0207370 3300046533 Bacteria 1240
519 Ga0495640_0289569 3300046533 Bacteria 1019
520 Ga0495587_0090984 3300046536 Bacteria 1763
521 Ga0495587_0131857 3300046536 Bacteria 1428
522 Ga0495609_0448172 3300046538 Bacteria 513
523 Ga0495645_0081290 3300046543 Bacteria 2325
524 Ga0495645_0159776 3300046543 Bacteria 1559
525 Ga0495622_0009620 3300046557 Bacteria 4469
526 Ga0495667_0007395 3300046559 Bacteria 7447
527 Ga0495667_0051483 3300046559 Bacteria 2717
528 Ga0495667_0290813 3300046559 Bacteria 1036
529 Ga0495667_0613192 3300046559 Bacteria 677
530 Ga0495656_0259087 3300046615 Bacteria 881
531 Ga0495634_0001002 3300046642 Bacteria 26604
532 Ga0495634_0262509 3300046642 Bacteria 1053
533 Ga0495634_0408609 3300046642 Bacteria 805
534 Ga0495635_0001877 3300046663 Bacteria 14243
535 Ga0495635_0070380 3300046663 Bacteria 2398
536 Ga0495659_0089816 3300046664 Bacteria 1178
537 Ga0495588_0013471 3300046674 Bacteria 3897
538 Ga0495657_0061658 3300046675 Bacteria 2480
539 Ga0495657_0231773 3300046675 Bacteria 1117
540 Ga0495657_0638506 3300046675 Bacteria 614
541 Ga0495599_0052645 3300046678 Bacteria 2550
542 Ga0495599_0512967 3300046678 Bacteria 705
543 Ga0495623_0078630 3300046679 Bacteria 2044
544 Ga0495623_0142724 3300046679 Bacteria 1423
545 Ga0495646_0094435 3300046680 Bacteria 1722
546 Ga0495646_0183113 3300046680 Bacteria 1149
547 Ga0495646_0367037 3300046680 Bacteria 752
548 Ga0495647_0092753 3300046681 Bacteria 1240
549 Ga0495647_0253752 3300046681 Bacteria 783
550 Ga0495658_0005587 3300046683 Bacteria 6178
551 Ga0495658_0008281 3300046683 Bacteria 5151
552 Ga0495658_0713812 3300046683 Bacteria 642
553 Ga0495613_0026643 3300046689 Bacteria 4306
554 Ga0495613_0425909 3300046689 Bacteria 902
555 Ga0495613_0926809 3300046689 Bacteria 563
556 Ga0495624_0000380 3300046690 Bacteria 35436
557 Ga0495624_0097506 3300046690 Bacteria 1811
558 Ga0495600_0047378 3300046809 Bacteria 2803
559 Ga0495600_0458845 3300046809 Bacteria 787
560 Ga0495660_0135178 3300046810 Bacteria 1233
561 Ga0495581_0000233 3300047315 Bacteria 26288
562 Ga0495581_0033227 3300047315 Bacteria 2987
563 Ga0495604_0050376 3300047317 Bacteria 3234
564 Ga0495604_0515659 3300047317 Bacteria 774
565 Ga0495674_0002874 3300047319 Bacteria 16742
566 Ga0495674_0064848 3300047319 Bacteria 3174
567 Ga0495674_0296823 3300047319 Bacteria 1320
568 Ga0495674_0421524 3300047319 Bacteria 1075
569 Ga0495676_0027364 3300047321 Bacteria 4889
570 Ga0495676_0385372 3300047321 Bacteria 932
571 Ga0495680_0006685 3300047322 Bacteria 10678
572 Ga0495680_0343374 3300047322 Bacteria 1041
573 Ga0495673_0023740 3300047469 Bacteria 2977
574 Ga0495684_0006226 3300047471 Bacteria 9272
575 Ga0495684_0249794 3300047471 Bacteria 1291
576 Ga0495684_0291046 3300047471 Bacteria 1176
577 Ga0495593_0003039 3300047673 Bacteria 10111
578 Ga0495593_0027266 3300047673 Bacteria 3145
579 Ga0495593_0434152 3300047673 Bacteria 657
580 Ga0495602_0010516 3300048088 Bacteria 9605
581 Ga0495602_0803866 3300048088 Bacteria 631
582 Ga0495614_0105030 3300048089 Bacteria 1237
583 Ga0495626_0103108 3300048091 Bacteria 1242
584 Ga0496100_0660745 3300048903 Bacteria 814
585 Ga0496101_0140539 3300048904 Bacteria 1840
586 Ga0496101_0435245 3300048904 Bacteria 1034
587 Ga0496102_0162016 3300048905 Bacteria 2104
588 Ga0496102_0523716 3300048905 Bacteria 1108
589 Ga0496103_0177653 3300048906 Bacteria 1368
590 Ga0496104_0000741 3300048907 Bacteria 27998
591 Ga0496104_0004664 3300048907 Bacteria 11928
592 Ga0496104_0420032 3300048907 Bacteria 1249
593 Ga0496104_0548862 3300048907 Bacteria 1066
594 Ga0496105_0011046 3300048908 Bacteria 7119
595 Ga0496105_0206309 3300048908 Bacteria 1603
596 Ga0496106_0397168 3300048909 Bacteria 1108
597 Ga0496106_0724424 3300048909 Bacteria 792
598 Ga0496107_0148243 3300048910 Bacteria 1735
599 Ga0496109_0271360 3300048912 Bacteria 1598
600 Ga0496110_0081261 3300048913 Bacteria 2889
601 Ga0496110_0132285 3300048913 Bacteria 2253
602 Ga0496112_0168997 3300048915 Bacteria 2152
603 Ga0496112_0684973 3300048915 Bacteria 953
604 Ga0496112_1778798 3300048915 Bacteria 528
605 Ga0496113_0111303 3300048916 Bacteria 2132
606 Ga0496113_0713964 3300048916 Bacteria 799
607 Ga0496114_0018559 3300048917 Bacteria 5626
608 Ga0496114_0734121 3300048917 Bacteria 864
609 Ga0496114_0823647 3300048917 Bacteria 807
610 Ga0496115_0036782 3300048918 Bacteria 3877
611 Ga0496115_0042594 3300048918 Bacteria 3617
612 Ga0496115_0088956 3300048918 Bacteria 2521
613 Ga0496115_0746615 3300048918 Bacteria 766
614 Ga0496116_0000268 3300048919 Bacteria 90912
615 Ga0496117_0003133 3300048920 Bacteria 19731
616 Ga0496118_0003712 3300048921 Bacteria 18914
617 Ga0496120_0510790 3300048923 Bacteria 515
618 Ga0496121_0293117 3300048924 Bacteria 1107
619 Ga0496124_0227175 3300048927 Bacteria 1398
620 Ga0496126_0037084 3300048929 Bacteria 4552
621 Ga0496126_1171483 3300048929 Bacteria 567
622 Ga0501031_0409629 3300049568 Bacteria 877
623 Ga0501032_0391824 3300049569 Bacteria 893
624 Ga0501032_0540364 3300049569 Bacteria 743
625 Ga0501033_0119099 3300049570 Bacteria 1917
626 Ga0501034_0081213 3300049571 Bacteria 3244
627 Ga0501036_0286635 3300049572 Bacteria 1378
628 Ga0501036_0474164 3300049572 Bacteria 1042
629 Ga0501038_0163305 3300049574 Bacteria 1808
630 Ga0501043_0046312 3300049579 Bacteria 3420
631 Ga0501043_0536848 3300049579 Bacteria 870
632 Ga0501046_0032199 3300049580 Bacteria 4246
633 Ga0501046_0868029 3300049580 Bacteria 630
634 Ga0501047_0033009 3300049581 Bacteria 4998
635 Ga0501048_0550120 3300049582 Bacteria 828
636 Ga0501069_0877608 3300049585 Bacteria 545
637 Ga0501070_0603341 3300049586 Bacteria 875
638 Ga0501070_1360729 3300049586 Bacteria 540
639 Ga0501073_0065770 3300049589 Bacteria 2528
640 Ga0501073_0120544 3300049589 Bacteria 1818
641 Ga0501073_0394023 3300049589 Bacteria 957
642 Ga0501076_1621405 3300049592 Bacteria 531
643 Ga0501079_0143568 3300049741 Bacteria 1860
644 Ga0501080_1033521 3300049742 Bacteria 711
645 Ga0501044_0192511 3300049823 Bacteria 2001
646 nmdc:mga03683_113367_c1 3300050489 Bacteria 1200
647 nmdc:mga03683_135666_c1 3300050489 Bacteria 1104
648 nmdc:mga03683_31457_c1 3300050489 Bacteria 2129
649 nmdc:mga03683_432192_c1 3300050489 Bacteria 632
650 nmdc:mga03683_438752_c1 3300050489 Unclassified 627
651 nmdc:mga03683_462788_c1 3300050489 Bacteria 611
652 nmdc:mga03683_9387_c2 3300050489 Bacteria 2079
653 nmdc:mga03n38_121696_c1 3300050490 Bacteria 1283
654 nmdc:mga03n38_126932_c1 3300050490 Bacteria 1260
655 nmdc:mga03n38_160520_c1 3300050490 Bacteria 1138
656 nmdc:mga03n38_302280_c1 3300050490 Bacteria 860
657 nmdc:mga03n38_337199_c1 3300050490 Bacteria 818
658 nmdc:mga03n38_35060_c1 3300050490 Bacteria 2147
659 nmdc:mga00v17_187637_c1 3300050491 Bacteria 1335
660 nmdc:mga00v17_342973_c1 3300050491 Bacteria 971
661 nmdc:mga00v17_3897_c1 3300050491 Bacteria 7692
662 nmdc:mga00v17_4583_c1 3300050491 Bacteria 7205
663 nmdc:mga00v17_837885_c1 3300050491 Bacteria 585
664 nmdc:mga0yw44_58062_c1 3300050492 Bacteria 2363
665 nmdc:mga0yw44_65742_c1 3300050492 Bacteria 2236
666 nmdc:mga0k408_299138_c1 3300050493 Bacteria 960
667 nmdc:mga06z11_202406_c1 3300050494 Bacteria 1154
668 nmdc:mga06z11_27237_c1 3300050494 Bacteria 2731
669 nmdc:mga06z11_480945_c1 3300050494 Bacteria 752
670 nmdc:mga06z11_517601_c1 3300050494 Bacteria 723
671 nmdc:mga06z11_538164_c1 3300050494 Bacteria 709
672 nmdc:mga06z11_74517_c1 3300050494 Bacteria 1805
673 nmdc:mga06z11_856206_c1 3300050494 Bacteria 554
674 nmdc:mga06z11_91727_c1 3300050494 Bacteria 1650
675 nmdc:mga06z11_968435_c1 3300050494 Bacteria 519
676 nmdc:mga04h51_105287_c1 3300050495 Bacteria 1033
677 nmdc:mga04h51_277831_c1 3300050495 Bacteria 678
678 nmdc:mga04h51_3910_c1 3300050495 Bacteria 3664
679 nmdc:mga04h51_429894_c1 3300050495 Bacteria 556
680 nmdc:mga07m45_14493_c1 3300050496 Bacteria 4200
681 nmdc:mga07m45_21730_c1 3300050496 Bacteria 3497
682 nmdc:mga07m45_595417_c1 3300050496 Bacteria 639
683 nmdc:mga07m45_674328_c1 3300050496 Bacteria 595
684 nmdc:mga05p37_63155_c1 3300050507 Bacteria 4557
685 nmdc:mga09592_1027734_c1 3300050508 Bacteria 688
686 nmdc:mga0qj67_169553_c1 3300050509 Bacteria 1772
687 nmdc:mga06r32_68188_c1 3300050510 Bacteria 3436
688 nmdc:mga08y16_1053768_c1 3300050511 Bacteria 790
689 nmdc:mga08y16_783058_c1 3300050511 Bacteria 948
690 nmdc:mga0n895_1195717_c1 3300050512 Bacteria 734
691 nmdc:mga0n895_12954_c1 3300050512 Bacteria 6444
692 nmdc:mga0n895_1620207_c1 3300050512 Bacteria 611
693 nmdc:mga0n895_17823_c1 3300050512 Bacteria 6556
694 nmdc:mga0n895_78473_c1 3300050512 Bacteria 3286
695 nmdc:mga0rr50_130965_c1 3300050513 Bacteria 2008
696 nmdc:mga0rr50_1496099_c1 3300050513 Bacteria 571
697 nmdc:mga0rr50_84318_c1 3300050513 Bacteria 2460
698 nmdc:mga08x19_71022_c1 3300050514 Bacteria 2269
699 nmdc:mga08x19_999457_c1 3300050514 Bacteria 594
700 nmdc:mga0a205_329617_c1 3300050515 Bacteria 1396
701 nmdc:mga0a205_490233_c1 3300050515 Bacteria 1086
702 nmdc:mga0a205_648229_c1 3300050515 Bacteria 907
703 nmdc:mga0sz30_151760_c1 3300050516 Bacteria 697
704 nmdc:mga0sz30_25922_c1 3300050516 Bacteria 1950
705 Ga0495601_0001598 3300053077 Bacteria 12496
706 Ga0495601_0092183 3300053077 Bacteria 1951
707 Ga0495601_0802660 3300053077 Bacteria 597
708 Ga0495601_0887790 3300053077 Bacteria 563
709 Ga0495612_0001478 3300053078 Bacteria 9675
710 Ga0500635_0067948 3300053080 Bacteria 1258
711 Ga0495595_0000948 3300053084 Bacteria 11166
712 Ga0495595_0021358 3300053084 Bacteria 2828
713 Ga0495619_0022784 3300053085 Bacteria 4010
714 Ga0495619_0366842 3300053085 Bacteria 995
715 Ga0500643_038742 3300053087 Bacteria 1411
716 Ga0500647_0242655 3300053091 Bacteria 796
717 Ga0500566_0388534 3300053094 Bacteria 628
718 Ga0500641_0105016 3300053096 Bacteria 1213
719 Ga0500554_011956 3300053102 Bacteria 2168
720 Ga0500642_0073119 3300053130 Bacteria 1563
721 Ga0500642_0165175 3300053130 Bacteria 1037
722 Ga0500568_0071409 3300053139 Bacteria 1329
723 Ga0500577_0258235 3300053142 Bacteria 758
724 Ga0500603_002092 3300053150 Bacteria 4419
725 Ga0500616_0038531 3300053153 Bacteria 2581
726 Ga0500636_0039980 3300053177 Bacteria 2774
727 Ga0500636_0440081 3300053177 Bacteria 593
728 Ga0500637_0082951 3300053178 Bacteria 1852
729 Ga0500637_0410729 3300053178 Bacteria 700
730 Ga0500637_0551828 3300053178 Bacteria 558
731 Ga0501084_0533778 3300054114 Bacteria 992
732 Ga0590071_037719 3300059421 Bacteria 1160
733 Ga0501082_0431020 3300060353 Bacteria 1152
734 2513589687 2513237087 Bacteria 5817514
735 2599925329 2599185299 Bacteria 4854625
736 2650900298 2648501693 Bacteria 5069560
737 2686353057 2684622997 Bacteria 4624240
738 2847800185 2847797336 Bacteria 5176640
739 2857577882 2857576091 Bacteria 5465855
740 2919504565 2919501602 Bacteria 5286340
741 2926064862 2926063275 Bacteria 5285848
742 2928130948 2928130867 Bacteria 5467269
743 2974321750 2974320154 Bacteria 4571377
744 2984496317 2984494565 Bacteria 5000175
745 2990262993 2990261002 Bacteria 4919493
746 8055227338 8055225921 Bacteria 3341787
747 Ga0075433_10193537
748 Ga0055540_1054584
749 Ga0070658_10054057
750 Ga0070683_100012067
751 Ga0070683_100029224
752 Ga0070683_100098359
753 Ga0070683_100697027
754 Ga0070690_100785030
755 Ga0070670_101009318
756 Ga0068869_101364714
757 Ga0070680_100035730
758 Ga0070680_100547726
759 Ga0070680_100630773
760 Ga0070680_101050940
761 Ga0070682_100473102
762 Ga0070682_101946403
763 Ga0070660_100406346
764 Ga0070660_100679665
765 Ga0070689_100503707
766 Ga0070691_10251134
767 Ga0070687_100223940
768 Ga0070661_100252817
769 Ga0070692_10023303
770 Ga0070659_100453985
771 Ga0070703_10125273
772 Ga0070709_10016552
773 Ga0070709_10391599
774 Ga0070709_10489511
775 Ga0070709_11037322
776 Ga0070714_100080604
777 Ga0070714_100420651
778 Ga0070714_100513046
779 Ga0070714_101682644
780 Ga0070713_100030759
781 Ga0070713_100098500
782 Ga0070713_100361621
783 Ga0070713_101524416
784 Ga0070710_10011931
785 Ga0070710_10042462
786 Ga0070710_10513944
787 Ga0070701_10589426
788 Ga0070701_10820219
789 Ga0070711_100064263
790 Ga0070711_100157542
791 Ga0070662_101689254
792 Ga0070681_10046609
793 Ga0070681_10058638
794 Ga0070681_10095398
795 Ga0070681_10098990
796 Ga0070681_10553237
797 Ga0070681_10588767
798 Ga0070681_11005570
799 Ga0070685_10911352
800 Ga0070699_102180796
801 Ga0070679_100052349
802 Ga0070679_100078568
803 Ga0070679_100244218
804 Ga0070679_100342564
805 Ga0070679_100374546
806 Ga0070679_100447967
807 Ga0070679_100716202
808 Ga0070684_100045377
809 Ga0070684_100452692
810 Ga0070684_100707131
811 Ga0070684_101388888
812 Ga0068853_100237770
813 Ga0068853_100269390
814 Ga0068853_100407436
815 Ga0068853_101453528
816 Ga0070672_101313409
817 Ga0070693_100060081
818 Ga0070665_101629863
819 Ga0068855_100043632
820 Ga0068855_100388835
821 Ga0068855_100728082
822 Ga0068855_101373711
823 Ga0070664_100984262
824 Ga0068857_100322633
825 Ga0068857_100449413
826 Ga0068857_100869258
827 Ga0068857_100967050
828 Ga0068854_100439182
829 Ga0068854_100698516
830 Ga0068856_100417087
831 Ga0068856_101389899
832 Ga0068856_101404774
833 Ga0068856_101650961
834 Ga0068856_102713160
835 Ga0068852_100230984
836 Ga0068859_101135870
837 Ga0068859_101238267
838 Ga0068859_101939127
839 Ga0068864_101536850
840 Ga0068861_101100434
841 Ga0068870_10421468
842 Ga0068870_10990816
843 Ga0068863_100090298
844 Ga0068863_101433478
845 Ga0068860_100792335
846 Ga0068860_101281047
847 Ga0068862_100738594
848 Ga0068862_100898600
849 Ga0081455_10565504
850 Ga0081539_10197009
851 Ga0070717_10186052
852 Ga0070717_10720382
853 Ga0070717_11202703
854 Ga0070717_11618768
855 Ga0075368_10134788
856 Ga0075368_10298683
857 Ga0075363_100021984
858 Ga0075363_100188898
859 Ga0075363_100326343
860 Ga0075363_100383324
861 Ga0075364_10004607
862 Ga0075364_10008706
863 Ga0075364_10231624
864 Ga0075364_10411996
865 Ga0075364_11172371
866 Ga0075432_10001643
867 Ga0070716_100748219
868 Ga0070712_100243575
869 Ga0070712_100265670
870 Ga0070712_100574802
871 Ga0075362_10016805
872 Ga0075362_10021345
873 Ga0075362_10183630
874 Ga0075362_10488297
875 Ga0075367_10022590
876 Ga0075367_10042800
877 Ga0075367_10050154
878 Ga0075367_10213901
879 Ga0075367_10516557
880 Ga0075367_10533036
881 Ga0075367_10657157
882 Ga0075367_10870074
883 Ga0075369_10349528
884 Ga0075369_10376419
885 Ga0075369_10420562
886 Ga0075366_10105539
887 Ga0075370_10009268
888 Ga0075370_10014898
889 Ga0075370_10100196
890 Ga0075370_10356728
891 Ga0075370_10494665
892 Ga0075370_10955195
893 Ga0068871_101663963
894 Ga0075428_100011323
895 Ga0075428_100421857
896 Ga0075428_101067222
897 Ga0075430_100247618
898 Ga0075431_100060621
899 Ga0075433_10305103
900 Ga0075433_10545327
901 Ga0075433_10553528
902 Ga0075433_10810593
903 Ga0075434_100033334
904 Ga0075434_100036092
905 Ga0075434_100851653
906 Ga0075429_100361076
907 Ga0068865_100324234
908 Ga0075436_100080136
909 Ga0075436_100526221
910 Ga0097620_100009061
911 Ga0097620_101136039
912 Ga0097620_101238195
913 Ga0097620_101938648
914 Ga0075435_100090674
915 Ga0099794_10422390
916 Ga0099794_10614831
917 Ga0099795_10093343
918 Ga0105251_10006339
919 Ga0105244_10002321
920 Ga0105240_10142756
921 Ga0105240_10686071
922 Ga0105240_11027533
923 Ga0111539_10852667
924 Ga0111539_10923655
925 Ga0111539_11063208
926 Ga0105245_11172352
927 Ga0105245_11595693
928 Ga0105247_10471471
929 Ga0105247_10576261
930 Ga0105247_10582863
931 Ga0114129_10307738
932 Ga0114129_11563380
933 Ga0114129_13044976
934 Ga0105243_11330429
935 Ga0105243_11728214
936 Ga0105243_12591692
937 Ga0105242_10479365
938 Ga0105248_10040040
939 Ga0105248_13387833
940 Ga0105237_10548545
941 Ga0105237_10641915
942 Ga0105237_11121341
943 Ga0105237_11685465
944 Ga0105238_10583258
945 Ga0105238_10830198
946 Ga0105238_11023374
947 Ga0105238_11277968
948 Ga0105238_11522304
949 Ga0105249_10642749
950 Ga0099796_10102155
951 Ga0105239_11422316
952 Ga0105239_11963558
953 Ga0157373_10854486
954 Ga0157371_10008545
955 Ga0157370_10000942
956 Ga0157370_10261786
957 Ga0157370_10655015
958 Ga0157370_10896408
959 Ga0157369_10008037
960 Ga0157369_10011202
961 Ga0157369_10104181
962 Ga0157369_10323622
963 Ga0157369_10586604
964 Ga0157369_10822694
965 Ga0157369_10963554
966 Ga0157369_11213355
967 Ga0157378_10880297
968 Ga0157378_10980479
969 Ga0163162_10781073
970 Ga0163162_11985232
971 Ga0163162_12437969
972 Ga0157372_11076241
973 Ga0157375_10821939
974 Ga0157375_11437892
975 Ga0163163_10888201
976 Ga0163163_11988378
977 Ga0163163_12033822
978 Ga0157380_10842803
979 Ga0157380_12053311
980 Ga0157380_12245416
981 Ga0157380_12701113
982 Ga0182008_10267871
983 Ga0157379_10849921
984 Ga0157379_11742147
985 Ga0182006_1188511
986 Ga0197907_10998507
987 Ga0197907_11482679
988 Ga0206356_11170346
989 Ga0206350_10729085
990 Ga0206353_11383556
991 Ga0206353_11504873
992 Ga0213876_10014986
993 Ga0213876_10051088
994 Ga0224712_10030270
995 Ga0224712_10234422
996 Ga0224712_10332810
997 Ga0209051_1007057
998 Ga0207697_10082784
999 Ga0207655_1005567
1000 Ga0207713_1026348
1001 Ga0207692_10477323
1002 Ga0207710_10063659
1003 Ga0207685_10495882
1004 Ga0207699_10055913
1005 Ga0207699_10062583
1006 Ga0207699_10547136
1007 Ga0207699_10610040
1008 Ga0207699_10677317
1009 Ga0207705_10276644
1010 Ga0207705_10459944
1011 Ga0207707_10003136
1012 Ga0207707_10951130
1013 Ga0207707_11586825
1014 Ga0207695_10025863
1015 Ga0207671_10280815
1016 Ga0207671_10741529
1017 Ga0207693_10022622
1018 Ga0207693_10094460
1019 Ga0207693_11238806
1020 Ga0207663_10019053
1021 Ga0207663_10176085
1022 Ga0207663_10743999
1023 Ga0207663_11235507
1024 Ga0207663_11738672
1025 Ga0207660_10045107
1026 Ga0207660_10178326
1027 Ga0207660_10829213
1028 Ga0207657_10107787
1029 Ga0207649_10515339
1030 Ga0207649_10785116
1031 Ga0207649_10935386
1032 Ga0207652_10052385
1033 Ga0207652_10061514
1034 Ga0207652_10067795
1035 Ga0207652_10153811
1036 Ga0207652_10384892
1037 Ga0207652_10579517
1038 Ga0207652_10823993
1039 Ga0207694_10612656
1040 Ga0207650_10714712
1041 Ga0207687_11185894
1042 Ga0207700_10000968
1043 Ga0207700_10040508
1044 Ga0207664_10107056
1045 Ga0207664_10407773
1046 Ga0207664_10655215
1047 Ga0207664_11639989
1048 Ga0207686_10269704
1049 Ga0207704_10389244
1050 Ga0207704_10745098
1051 Ga0207665_10367043
1052 Ga0207665_11124691
1053 Ga0207711_10173445
1054 Ga0207689_11037739
1055 Ga0207661_10000608
1056 Ga0207661_10018652
1057 Ga0207661_10048969
1058 Ga0207661_11226227
1059 Ga0207661_11658133
1060 Ga0207679_11093799
1061 Ga0207667_10038289
1062 Ga0207667_10704009
1063 Ga0207667_11361962
1064 Ga0207668_11916388
1065 Ga0207640_10119188
1066 Ga0207703_10403669
1067 Ga0207639_10072365
1068 Ga0207639_10264223
1069 Ga0207639_11110591
1070 Ga0207678_10655950
1071 Ga0207708_11059011
1072 Ga0207702_10589279
1073 Ga0207702_11275939
1074 Ga0207641_10590864
1075 Ga0207648_11094858
1076 Ga0207674_10122397
1077 Ga0207674_10212794
1078 Ga0207674_10381763
1079 Ga0207674_12241042
1080 Ga0207675_100592869
1081 Ga0207675_100779064
1082 Ga0207675_101020314
1083 Ga0207698_10157183
1084 Ga0207698_10428258
1085 Ga0209179_1014368
1086 Ga0209179_1020442
1087 Ga0209588_1024254
1088 Ga0209813_10002219
1089 Ga0209813_10115147
1090 Ga0209813_10296745
1091 Ga0209813_10307041
1092 Ga0207428_10592673
1093 Ga0268266_10363705
1094 Ga0268266_11953914
1095 Ga0268265_10085542
1096 Ga0268265_10925655
1097 Ga0268264_10412522
1098 Ga0268264_11679493
1099 Ga0265338_10311385
1100 Ga0265338_10856173
1101 Ga0307511_10000496
1102 Ga0265325_10000006
1103 Ga0265339_10188942
1104 Ga0307513_10000066
1105 Ga0307509_10147321
1106 Ga0307408_101196758
1107 Ga0265313_10005418
1108 Ga0265313_10009773
1109 Ga0265314_10138891
1110 Ga0265342_10001631
1111 Ga0265342_10389112
1112 Ga0307405_11412371
1113 Ga0307406_11023916
1114 Ga0307406_11840003
1115 Ga0307409_101753214
1116 Ga0307416_100485089
1117 Ga0307416_101167142
1118 Ga0307510_10055966
1119 Ga0307510_10400514
1120 Ga0373928_0037249
1121 Ga0373934_0046494
1122 Ga0373934_0088927
1123 Ga0373944_0043350
1124 Ga0373923_0104822
1125 Ga0373923_0112273
1126 Ga0373923_0256848
1127 Ga0373923_0568896
1128 Ga0373923_0634240
1129 Ga0373936_0010756
1130 Ga0373936_0184373
1131 Ga0373936_0190755
1132 Ga0373939_0261736
1133 Ga0373945_0004868
1134 Ga0373945_0071359
1135 Ga0373953_0115908
1136 Ga0373953_0323743
1137 Ga0373954_0017172
1138 Ga0373954_0020314
1139 Ga0373954_0026139
1140 Ga0373954_0278106
1141 Ga0373956_0021146
1142 Ga0373956_0206081
1143 Ga0373957_0004774
1144 Ga0373943_0015255
1145 Ga0373943_0029550
1146 Ga0373943_0120903
1147 Ga0373943_0416034
1148 Ga0373946_0003634
1149 Ga0373946_0029864
1150 Ga0373946_0381220
1151 Ga0373946_0385705
1152 Ga0373955_0001781
1153 Ga0373955_0049339
1154 Ga0373955_0776184
1155 Ga0373942_0334609
1156 Ga0373961_0130431
1157 Ga0373924_0052244
1158 Ga0373924_0200928
1159 Ga0373924_0342208
1160 Ga0373931_0005871
1161 Ga0373931_0550663
1162 Ga0373935_0000758
1163 Ga0373935_0050947
1164 Ga0373927_0002965
1165 Ga0373927_0136973
1166 Ga0373933_0059462
1167 Ga0373933_0268610
1168 Ga0373933_0414531
1169 Ga0373933_0788166
1170 Ga0373947_0004260
1171 Ga0373947_0019316
1172 Ga0373937_0035246
1173 Ga0373937_0039913
1174 Ga0373937_0076111
1175 Ga0373937_0161860
1176 Ga0373937_0222701
1177 Ga0373925_0002392
1178 Ga0373925_0027418
1179 Ga0373925_0032439
1180 Ga0395899_0122677
1181 Ga0395900_0037349
1182 Ga0395898_0013627
1183 Ga0436364_0241659
1184 Ga0395901_0855773
1185 Ga0436365_0232830
1186 Ga0436365_0306056
1187 Ga0436365_0445089
1188 Ga0436365_0582930
1189 Ga0436365_1024875
1190 Ga0436363_1015520
1191 Ga0451797_1483766
1192 Ga0451798_0519614
1193 Ga0451804_0546764
1194 Ga0451807_2370069
1195 Ga0451853_0120830
1196 Ga0451853_1828065
1197 Ga0439441_100781
1198 Ga0439452_000001
1199 Ga0450923_102525
1200 Ga0451577_0001841
1201 Ga0451577_0035569
1202 Ga0451577_0060913
1203 Ga0451577_0354854
1204 Ga0451577_0612821
1205 Ga0466963_0151155
1206 Ga0466963_0218049
1207 Ga0466963_1259267
1208 Ga0453684_0004974
1209 Ga0453684_0203865
1210 Ga0466971_0394062
1211 Ga0451576_0001292
1212 Ga0466958_0633113
1213 Ga0466967_0399204
1214 Ga0466967_1185420
1215 Ga0495592_0003145
1216 Ga0495592_0006804
1217 Ga0495592_0108414
1218 Ga0495592_0672834
1219 Ga0495603_0000027
1220 Ga0495603_0123279
1221 Ga0495629_0000290
1222 Ga0495629_0045096
1223 Ga0495641_0005129
1224 Ga0495651_0393280
1225 Ga0495651_0685742
1226 Ga0495653_0173096
1227 Ga0495653_0414018
1228 Ga0495580_0003356
1229 Ga0495580_0044822
1230 Ga0495582_0000157
1231 Ga0495582_0019831
1232 Ga0495639_0000048
1233 Ga0495639_0113035
1234 Ga0495662_0000814
1235 Ga0495662_0074567
1236 Ga0495664_0007669
1237 Ga0495664_0089917
1238 Ga0495664_0224664
1239 Ga0495594_0001217
1240 Ga0495594_0203461
1241 Ga0495607_0000282
1242 Ga0495607_0256358
1243 Ga0495608_0417745
1244 Ga0495610_0145234
1245 Ga0495618_0018661
1246 Ga0495618_0176535
1247 Ga0495618_0338644
1248 Ga0495628_0079335
1249 Ga0495628_0410695
1250 Ga0495630_0016268
1251 Ga0495630_0231551
1252 Ga0495630_0561609
1253 Ga0495630_0598922
1254 Ga0495630_0874337
1255 Ga0495643_0077355
1256 Ga0495666_0224558
1257 Ga0495666_0243513
1258 Ga0495652_0023266
1259 Ga0495652_0026434
1260 Ga0495652_0392015
1261 Ga0495665_0002259
1262 Ga0495665_0042045
1263 Ga0495640_0026051
1264 Ga0495640_0207370
1265 Ga0495640_0289569
1266 Ga0495587_0090984
1267 Ga0495587_0131857
1268 Ga0495609_0448172
1269 Ga0495645_0081290
1270 Ga0495645_0159776
1271 Ga0495622_0009620
1272 Ga0495667_0007395
1273 Ga0495667_0051483
1274 Ga0495667_0290813
1275 Ga0495667_0613192
1276 Ga0495656_0259087
1277 Ga0495634_0001002
1278 Ga0495634_0262509
1279 Ga0495634_0408609
1280 Ga0495635_0001877
1281 Ga0495635_0070380
1282 Ga0495659_0089816
1283 Ga0495588_0013471
1284 Ga0495657_0061658
1285 Ga0495657_0231773
1286 Ga0495657_0638506
1287 Ga0495599_0052645
1288 Ga0495599_0512967
1289 Ga0495623_0078630
1290 Ga0495623_0142724
1291 Ga0495646_0094435
1292 Ga0495646_0183113
1293 Ga0495646_0367037
1294 Ga0495647_0092753
1295 Ga0495647_0253752
1296 Ga0495658_0005587
1297 Ga0495658_0008281
1298 Ga0495658_0713812
1299 Ga0495613_0026643
1300 Ga0495613_0425909
1301 Ga0495613_0926809
1302 Ga0495624_0000380
1303 Ga0495624_0097506
1304 Ga0495600_0047378
1305 Ga0495600_0458845
1306 Ga0495660_0135178
1307 Ga0495581_0000233
1308 Ga0495581_0033227
1309 Ga0495604_0050376
1310 Ga0495604_0515659
1311 Ga0495674_0002874
1312 Ga0495674_0064848
1313 Ga0495674_0296823
1314 Ga0495674_0421524
1315 Ga0495676_0027364
1316 Ga0495676_0385372
1317 Ga0495680_0006685
1318 Ga0495680_0343374
1319 Ga0495673_0023740
1320 Ga0495684_0006226
1321 Ga0495684_0249794
1322 Ga0495684_0291046
1323 Ga0495593_0003039
1324 Ga0495593_0027266
1325 Ga0495593_0434152
1326 Ga0495602_0010516
1327 Ga0495602_0803866
1328 Ga0495614_0105030
1329 Ga0495626_0103108
1330 Ga0496100_0660745
1331 Ga0496101_0140539
1332 Ga0496101_0435245
1333 Ga0496102_0162016
1334 Ga0496102_0523716
1335 Ga0496103_0177653
1336 Ga0496104_0000741
1337 Ga0496104_0004664
1338 Ga0496104_0420032
1339 Ga0496104_0548862
1340 Ga0496105_0011046
1341 Ga0496105_0206309
1342 Ga0496106_0397168
1343 Ga0496106_0724424
1344 Ga0496107_0148243
1345 Ga0496109_0271360
1346 Ga0496110_0081261
1347 Ga0496110_0132285
1348 Ga0496112_0168997
1349 Ga0496112_0684973
1350 Ga0496112_1778798
1351 Ga0496113_0111303
1352 Ga0496113_0713964
1353 Ga0496114_0018559
1354 Ga0496114_0734121
1355 Ga0496114_0823647
1356 Ga0496115_0036782
1357 Ga0496115_0042594
1358 Ga0496115_0088956
1359 Ga0496115_0746615
1360 Ga0496116_0000268
1361 Ga0496117_0003133
1362 Ga0496118_0003712
1363 Ga0496120_0510790
1364 Ga0496121_0293117
1365 Ga0496124_0227175
1366 Ga0496126_0037084
1367 Ga0496126_1171483
1368 Ga0501031_0409629
1369 Ga0501032_0391824
1370 Ga0501032_0540364
1371 Ga0501033_0119099
1372 Ga0501034_0081213
1373 Ga0501036_0286635
1374 Ga0501036_0474164
1375 Ga0501038_0163305
1376 Ga0501043_0046312
1377 Ga0501043_0536848
1378 Ga0501046_0032199
1379 Ga0501046_0868029
1380 Ga0501047_0033009
1381 Ga0501048_0550120
1382 Ga0501069_0877608
1383 Ga0501070_0603341
1384 Ga0501070_1360729
1385 Ga0501073_0065770
1386 Ga0501073_0120544
1387 Ga0501073_0394023
1388 Ga0501076_1621405
1389 Ga0501079_0143568
1390 Ga0501080_1033521
1391 Ga0501044_0192511
1392 nmdc:mga03683_113367_c1
1393 nmdc:mga03683_135666_c1
1394 nmdc:mga03683_31457_c1
1395 nmdc:mga03683_432192_c1
1396 nmdc:mga03683_438752_c1
1397 nmdc:mga03683_462788_c1
1398 nmdc:mga03683_9387_c2
1399 nmdc:mga03n38_121696_c1
1400 nmdc:mga03n38_126932_c1
1401 nmdc:mga03n38_160520_c1
1402 nmdc:mga03n38_302280_c1
1403 nmdc:mga03n38_337199_c1
1404 nmdc:mga03n38_35060_c1
1405 nmdc:mga00v17_187637_c1
1406 nmdc:mga00v17_342973_c1
1407 nmdc:mga00v17_3897_c1
1408 nmdc:mga00v17_4583_c1
1409 nmdc:mga00v17_837885_c1
1410 nmdc:mga0yw44_58062_c1
1411 nmdc:mga0yw44_65742_c1
1412 nmdc:mga0k408_299138_c1
1413 nmdc:mga06z11_202406_c1
1414 nmdc:mga06z11_27237_c1
1415 nmdc:mga06z11_480945_c1
1416 nmdc:mga06z11_517601_c1
1417 nmdc:mga06z11_538164_c1
1418 nmdc:mga06z11_74517_c1
1419 nmdc:mga06z11_856206_c1
1420 nmdc:mga06z11_91727_c1
1421 nmdc:mga06z11_968435_c1
1422 nmdc:mga04h51_105287_c1
1423 nmdc:mga04h51_277831_c1
1424 nmdc:mga04h51_3910_c1
1425 nmdc:mga04h51_429894_c1
1426 nmdc:mga07m45_14493_c1
1427 nmdc:mga07m45_21730_c1
1428 nmdc:mga07m45_595417_c1
1429 nmdc:mga07m45_674328_c1
1430 nmdc:mga05p37_63155_c1
1431 nmdc:mga09592_1027734_c1
1432 nmdc:mga0qj67_169553_c1
1433 nmdc:mga06r32_68188_c1
1434 nmdc:mga08y16_1053768_c1
1435 nmdc:mga08y16_783058_c1
1436 nmdc:mga0n895_1195717_c1
1437 nmdc:mga0n895_12954_c1
1438 nmdc:mga0n895_1620207_c1
1439 nmdc:mga0n895_17823_c1
1440 nmdc:mga0n895_78473_c1
1441 nmdc:mga0rr50_130965_c1
1442 nmdc:mga0rr50_1496099_c1
1443 nmdc:mga0rr50_84318_c1
1444 nmdc:mga08x19_71022_c1
1445 nmdc:mga08x19_999457_c1
1446 nmdc:mga0a205_329617_c1
1447 nmdc:mga0a205_490233_c1
1448 nmdc:mga0a205_648229_c1
1449 nmdc:mga0sz30_151760_c1
1450 nmdc:mga0sz30_25922_c1
1451 Ga0495601_0001598
1452 Ga0495601_0092183
1453 Ga0495601_0802660
1454 Ga0495601_0887790
1455 Ga0495612_0001478
1456 Ga0500635_0067948
1457 Ga0495595_0000948
1458 Ga0495595_0021358
1459 Ga0495619_0022784
1460 Ga0495619_0366842
1461 Ga0500643_038742
1462 Ga0500647_0242655
1463 Ga0500566_0388534
1464 Ga0500641_0105016
1465 Ga0500554_011956
1466 Ga0500642_0073119
1467 Ga0500642_0165175
1468 Ga0500568_0071409
1469 Ga0500577_0258235
1470 Ga0500603_002092
1471 Ga0500616_0038531
1472 Ga0500636_0039980
1473 Ga0500636_0440081
1474 Ga0500637_0082951
1475 Ga0500637_0410729
1476 Ga0500637_0551828
1477 Ga0501084_0533778
1478 Ga0590071_037719
1479 Ga0501082_0431020
1480 2513589687
1481 2599925329
1482 2650900298
1483 2686353057
1484 2847800185
1485 2857577882
1486 2919504565
1487 2926064862
1488 2928130948
1489 2974321750
1490 2984496317
1491 2990262993
1492 8055227338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u4l-assembly1.cif.gz_A cysteine dioxygenase variant - c93e 0.8762 28 108
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.874 38 108
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.8728 38 108
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8725 38 108
4fah-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans a85h mutant 0.8717 38 108
ID Description Score Start End Superfamily
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8639 28 108 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8629 30 108 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8529 38 108 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8527 28 108 2.60.120.10
af_Q8IL40_451_571_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8491 28 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A8B6KSK9-F1-model_v4 deleted 1.005 44 109
AF-A0A176XVP2-F1-model_v4 DHCW motif cupin fold protein 0.9998 1 109
AF-A0A0R0MLI8-F1-model_v4 DHCW motif cupin fold protein 0.9988 1 109
AF-A0A6P2U8L4-F1-model_v4 deleted 0.9987 1 109
AF-F2KBD5-F1-model_v4 DHCW motif cupin fold protein 0.9985 1 109

Map