F478852

General Info

Members Datasets Scaffolds Average Seq Length
746 443 652 231

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1000575|Ga0081540_10005756
Length 239
Sequence MMAANRQMLDQEPSEIEMLLPFHAAGTLSARDARRVEDALAGDPELARQYAVIREEYAETISLNETLGAPSARAMQKLFAAIEAEPERKPSRSVRLSAKVSEFFARMSPRTLAWSASLGAAALLLQAGVIGAVLMSKQTSSFETASLSLNEPSSPAAPITRDLGVSAAPPRALVRFAPEARVADITALLDNYQASIIDGAKGGMFRLQFGNKAMGKDEAASLLSRLQREKIVGLAVATP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
7 2791355199
8 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
9 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
10 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
11 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
12 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
13 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
14 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
15 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
16 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
17 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
18 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
19 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
20 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
21 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
22 2922368715
23 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
24 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
25 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
26 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
27 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
28 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
29 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
30 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
31 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
32 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
33 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
34 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
35 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
36 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
37 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
38 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
39 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
40 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
41 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
42 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
43 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
44 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
45 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
46 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
47 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
48 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
49 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
50 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
51 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
52 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
53 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
54 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
55 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
56 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
57 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
58 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
59 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
60 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
61 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
62 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
63 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
64 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
65 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
66 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
67 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
70 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
74 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
75 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
76 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
77 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
78 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
79 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
80 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
81 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
82 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
83 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
84 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
85 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
86 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
87 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
92 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
93 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
94 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
95 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
99 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
100 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
103 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
106 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
107 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
108 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
109 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
133 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
134 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
135 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
143 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
151 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
152 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
153 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
156 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
157 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
175 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
176 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
230 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
231 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
246 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
255 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
280 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
293 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
294 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
295 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
327 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
333 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
339 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
340 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
341 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
344 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
345 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
346 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
347 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
348 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
360 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
361 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
362 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
386 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
387 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
388 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
389 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
395 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
396 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
401 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
402 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
403 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
404 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
405 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
409 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
410 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
411 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
412 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
413 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
414 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
417 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
418 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
419 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
420 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
421 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
422 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
423 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
424 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
425 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
426 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
427 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
428 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
429 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
430 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
431 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
432 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
433 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
434 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
435 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
436 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
437 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
438 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
439 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
440 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
441 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
442 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
443 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.54
Isolates 12.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.05
Nodule 10.59
Rhizoplane 6.17
Rhizosphere 64.88
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001037 3300001989 Bacteria 10296
2 JGI24737J22298_10001787 3300001990 Bacteria 7698
3 JGI24742J22300_10016348 3300002244 Bacteria 1252
4 JGI25153J46596_10002094 3300003215 Bacteria 11718
5 JGI25153J46596_10016218 3300003215 Bacteria 2996
6 Ga0055542_1023569 3300003762 Bacteria 862
7 Ga0065165_1001679 3300005262 Bacteria 22393
8 Ga0070676_10220090 3300005328 Bacteria 1253
9 Ga0070683_100153824 3300005329 Bacteria 2181
10 Ga0070683_100265873 3300005329 Bacteria 1631
11 Ga0070670_100700020 3300005331 Bacteria 911
12 Ga0070677_10111798 3300005333 Bacteria 1220
13 Ga0068869_100158664 3300005334 Bacteria 1759
14 Ga0070666_10175194 3300005335 Bacteria 1503
15 Ga0070680_100036060 3300005336 Bacteria 3995
16 Ga0070680_100393738 3300005336 Bacteria 1180
17 Ga0070682_100116467 3300005337 Bacteria 1788
18 Ga0070682_100512492 3300005337 Bacteria 932
19 Ga0068868_100284394 3300005338 Bacteria 1401
20 Ga0068868_100287279 3300005338 Bacteria 1394
21 Ga0070689_100235139 3300005340 Bacteria 1507
22 Ga0070689_100308544 3300005340 Bacteria 1319
23 Ga0070691_10116771 3300005341 Bacteria 1340
24 Ga0070691_10260897 3300005341 Bacteria 933
25 Ga0070661_100256092 3300005344 Bacteria 1352
26 Ga0070668_100023792 3300005347 Bacteria 4636
27 Ga0070668_100074203 3300005347 Bacteria 2653
28 Ga0070668_100097490 3300005347 Bacteria 2325
29 Ga0070668_100174605 3300005347 Bacteria 1751
30 Ga0070669_100155575 3300005353 Bacteria 1772
31 Ga0070669_100324730 3300005353 Bacteria 1243
32 Ga0070671_100040143 3300005355 Bacteria 3886
33 Ga0070671_100068060 3300005355 Bacteria 2969
34 Ga0070674_100195147 3300005356 Bacteria 1559
35 Ga0070674_100573592 3300005356 Bacteria 950
36 Ga0070667_100053267 3300005367 Bacteria 3415
37 Ga0070667_100124352 3300005367 Bacteria 2247
38 Ga0070703_10041790 3300005406 Bacteria 1431
39 Ga0070713_100162789 3300005436 Bacteria 1993
40 Ga0070701_10080884 3300005438 Bacteria 1758
41 Ga0070705_100048404 3300005440 Bacteria 2463
42 Ga0070700_100072913 3300005441 Bacteria 2196
43 Ga0070663_100010640 3300005455 Bacteria 5739
44 Ga0070663_100035903 3300005455 Bacteria 3441
45 Ga0070663_100044846 3300005455 Bacteria 3120
46 Ga0070663_100198687 3300005455 Bacteria 1564
47 Ga0070678_100117476 3300005456 Bacteria 2092
48 Ga0070678_100301591 3300005456 Bacteria 1361
49 Ga0070678_100304945 3300005456 Bacteria 1354
50 Ga0070678_100358655 3300005456 Bacteria 1255
51 Ga0070662_100035056 3300005457 Bacteria 3541
52 Ga0070662_100092022 3300005457 Bacteria 2278
53 Ga0070662_100122315 3300005457 Bacteria 1996
54 Ga0070662_100280027 3300005457 Bacteria 1349
55 Ga0070681_10026475 3300005458 Bacteria 5828
56 Ga0070681_10088485 3300005458 Bacteria 3048
57 Ga0068867_100637118 3300005459 Bacteria 934
58 Ga0070698_100496964 3300005471 Bacteria 1158
59 Ga0070679_100332109 3300005530 Bacteria 1469
60 Ga0070679_100681457 3300005530 Bacteria 971
61 Ga0070684_100005320 3300005535 Bacteria 9856
62 Ga0068853_100031622 3300005539 Bacteria 4477
63 Ga0068853_100107416 3300005539 Bacteria 2475
64 Ga0068853_100228520 3300005539 Bacteria 1701
65 Ga0070665_100084978 3300005548 Bacteria 3169
66 Ga0070665_100090409 3300005548 Bacteria 3067
67 Ga0070665_100277043 3300005548 Bacteria 1679
68 Ga0070665_100420931 3300005548 Bacteria 1344
69 Ga0070665_100429234 3300005548 Bacteria 1330
70 Ga0070704_100335799 3300005549 Bacteria 1271
71 Ga0070704_100416330 3300005549 Bacteria 1150
72 Ga0068855_100022161 3300005563 Bacteria 7612
73 Ga0068855_100083223 3300005563 Bacteria 3707
74 Ga0068855_100239207 3300005563 Bacteria 2029
75 Ga0068855_100474313 3300005563 Bacteria 1363
76 Ga0068855_101018964 3300005563 Bacteria 869
77 Ga0070664_100530161 3300005564 Bacteria 1088
78 Ga0070664_100583946 3300005564 Bacteria 1035
79 Ga0068857_100023313 3300005577 Bacteria 5447
80 Ga0068854_100003845 3300005578 Bacteria 9407
81 Ga0068854_100030788 3300005578 Bacteria 3724
82 Ga0068854_100129469 3300005578 Bacteria 1925
83 Ga0068856_100011815 3300005614 Bacteria 8463
84 Ga0068856_100026604 3300005614 Bacteria 5641
85 Ga0068856_100461069 3300005614 Bacteria 1292
86 Ga0068856_101219260 3300005614 Bacteria 769
87 Ga0070702_100198995 3300005615 Bacteria 1325
88 Ga0068852_100002580 3300005616 Bacteria 12500
89 Ga0068852_100017943 3300005616 Bacteria 5565
90 Ga0068852_100538403 3300005616 Bacteria 1167
91 Ga0068852_100626453 3300005616 Bacteria 1082
92 Ga0068859_100039596 3300005617 Bacteria 4728
93 Ga0068859_100116649 3300005617 Bacteria 2735
94 Ga0068864_100012188 3300005618 Bacteria 7106
95 Ga0068864_100321795 3300005618 Bacteria 1453
96 Ga0068864_100344220 3300005618 Bacteria 1405
97 Ga0068866_10146159 3300005718 Bacteria 1363
98 Ga0068866_10326683 3300005718 Bacteria 967
99 Ga0068866_10466703 3300005718 Bacteria 829
100 Ga0068861_100141288 3300005719 Bacteria 1965
101 Ga0068851_10010036 3300005834 Bacteria 4411
102 Ga0068851_10042199 3300005834 Bacteria 2296
103 Ga0068851_10059289 3300005834 Bacteria 1957
104 Ga0068870_10048002 3300005840 Bacteria 2247
105 Ga0068870_10070972 3300005840 Bacteria 1900
106 Ga0068863_100075669 3300005841 Bacteria 3185
107 Ga0068858_100233873 3300005842 Bacteria 1742
108 Ga0068858_100293340 3300005842 Bacteria 1550
109 Ga0068858_100385329 3300005842 Bacteria 1345
110 Ga0068860_100108861 3300005843 Bacteria 2648
111 Ga0068860_100190338 3300005843 Bacteria 1985
112 Ga0068860_100375687 3300005843 Bacteria 1402
113 Ga0068860_100379761 3300005843 Bacteria 1395
114 Ga0068862_100070369 3300005844 Bacteria 3020
115 Ga0068862_100118140 3300005844 Bacteria 2334
116 Ga0068862_100391869 3300005844 Bacteria 1298
117 Ga0068862_100649480 3300005844 Bacteria 1017
118 Ga0081455_10057793 3300005937 Bacteria 3286
119 Ga0081455_10060751 3300005937 Bacteria 3184
120 Ga0081455_10472183 3300005937 Bacteria 851
121 Ga0081540_1000575 3300005983 Bacteria 35551
122 Ga0081540_1008037 3300005983 Bacteria 7421
123 Ga0081540_1012391 3300005983 Bacteria 5623
124 Ga0081540_1018689 3300005983 Bacteria 4243
125 Ga0081540_1023497 3300005983 Bacteria 3603
126 Ga0081540_1034892 3300005983 Bacteria 2704
127 Ga0081540_1074758 3300005983 Bacteria 1551
128 Ga0081539_10000113 3300005985 Bacteria 189418
129 Ga0081539_10039747 3300005985 Bacteria 2772
130 Ga0070717_10825047 3300006028 Bacteria 844
131 Ga0075365_10024932 3300006038 Bacteria 3781
132 Ga0075365_10050581 3300006038 Bacteria 2741
133 Ga0075365_10374404 3300006038 Bacteria 1004
134 Ga0075368_10051916 3300006042 Bacteria 1630
135 Ga0075368_10083503 3300006042 Bacteria 1301
136 Ga0075368_10186359 3300006042 Bacteria 876
137 Ga0075363_100138607 3300006048 Bacteria 1368
138 Ga0075362_10010927 3300006177 Bacteria 3562
139 Ga0075362_10014438 3300006177 Bacteria 3188
140 Ga0075367_10026278 3300006178 Bacteria 3300
141 Ga0075367_10138782 3300006178 Bacteria 1505
142 Ga0075369_10067465 3300006186 Bacteria 1570
143 Ga0075366_10039208 3300006195 Bacteria 2800
144 Ga0075366_10107024 3300006195 Bacteria 1681
145 Ga0075366_10276803 3300006195 Bacteria 1025
146 Ga0097621_100135110 3300006237 Bacteria 2103
147 Ga0068871_100095962 3300006358 Bacteria 2477
148 Ga0068871_100263951 3300006358 Bacteria 1503
149 Ga0075428_100190956 3300006844 Bacteria 2215
150 Ga0075431_100439372 3300006847 Bacteria 1302
151 Ga0068865_100260196 3300006881 Bacteria 1373
152 Ga0075436_100163073 3300006914 Bacteria 1572
153 Ga0097620_100039598 3300006931 Bacteria 4728
154 Ga0097620_100116651 3300006931 Bacteria 2735
155 Ga0099795_10092135 3300007788 Bacteria 1176
156 Ga0105244_10308900 3300009036 Bacteria 731
157 Ga0105250_10097006 3300009092 Bacteria 1202
158 Ga0105240_10016135 3300009093 Bacteria 10123
159 Ga0105240_10082005 3300009093 Bacteria 3962
160 Ga0105240_10141161 3300009093 Bacteria 2880
161 Ga0105245_10126611 3300009098 Bacteria 2392
162 Ga0105245_10209432 3300009098 Bacteria 1876
163 Ga0105247_10088313 3300009101 Bacteria 1964
164 Ga0105247_10123500 3300009101 Bacteria 1680
165 Ga0105247_10197944 3300009101 Bacteria 1348
166 Ga0114129_10631316 3300009147 Bacteria 1384
167 Ga0105243_10088683 3300009148 Bacteria 2541
168 Ga0105243_10120222 3300009148 Bacteria 2213
169 Ga0105241_10001401 3300009174 Bacteria 18447
170 Ga0105241_10046934 3300009174 Bacteria 3282
171 Ga0105241_10292233 3300009174 Bacteria 1396
172 Ga0105242_10225935 3300009176 Bacteria 1675
173 Ga0105248_10184198 3300009177 Bacteria 2353
174 Ga0105248_10232856 3300009177 Bacteria 2074
175 Ga0105237_10008696 3300009545 Bacteria 10967
176 Ga0105237_10058881 3300009545 Bacteria 3845
177 Ga0105237_10102741 3300009545 Bacteria 2850
178 Ga0105237_10131779 3300009545 Bacteria 2494
179 Ga0105237_10439844 3300009545 Bacteria 1310
180 Ga0105237_10598622 3300009545 Bacteria 1109
181 Ga0105238_10006652 3300009551 Bacteria 11526
182 Ga0105238_10008473 3300009551 Bacteria 10294
183 Ga0105238_10011666 3300009551 Bacteria 8855
184 Ga0105249_10196025 3300009553 Bacteria 1974
185 Ga0105249_10314377 3300009553 Bacteria 1576
186 Ga0105249_11088917 3300009553 Bacteria 869
187 Ga0105239_10004659 3300010375 Bacteria 16304
188 Ga0105239_10072318 3300010375 Bacteria 3791
189 Ga0105239_10133836 3300010375 Bacteria 2759
190 Ga0105239_10610254 3300010375 Bacteria 1245
191 Ga0105246_10060031 3300011119 Bacteria 2641
192 Ga0105246_10140977 3300011119 Bacteria 1812
193 Ga0157369_10275996 3300013105 Bacteria 1751
194 Ga0157374_10013080 3300013296 Bacteria 7239
195 Ga0157374_10088341 3300013296 Bacteria 2952
196 Ga0157374_10292096 3300013296 Bacteria 1611
197 Ga0157374_10450379 3300013296 Bacteria 1288
198 Ga0157378_10009387 3300013297 Bacteria 8523
199 Ga0157378_10267217 3300013297 Bacteria 1643
200 Ga0157378_10584210 3300013297 Bacteria 1126
201 Ga0163162_10111361 3300013306 Bacteria 2835
202 Ga0163162_10183755 3300013306 Bacteria 2217
203 Ga0163162_10337595 3300013306 Bacteria 1639
204 Ga0163162_11365129 3300013306 Bacteria 806
205 Ga0157372_10947817 3300013307 Bacteria 998
206 Ga0157375_10581703 3300013308 Bacteria 1280
207 Ga0163163_10310125 3300014325 Bacteria 1631
208 Ga0163163_10494014 3300014325 Bacteria 1285
209 Ga0157377_10082014 3300014745 Bacteria 1887
210 Ga0157379_10109480 3300014968 Bacteria 2481
211 Ga0157379_10298324 3300014968 Bacteria 1468
212 Ga0157379_10365802 3300014968 Bacteria 1322
213 Ga0157379_10431000 3300014968 Bacteria 1215
214 Ga0157376_10008594 3300014969 Bacteria 7379
215 Ga0163161_10022770 3300017792 Bacteria 4414
216 Ga0213876_10146329 3300021384 Bacteria 1256
217 Ga0209148_1000180 3300025254 Bacteria 124830
218 Ga0209233_1032716 3300025261 Bacteria 1200
219 Ga0209455_1002814 3300025272 Bacteria 6473
220 Ga0209455_1018656 3300025272 Bacteria 1419
221 Ga0209564_1001937 3300025295 Bacteria 18414
222 Ga0209758_1004237 3300025297 Bacteria 12139
223 Ga0209758_1007006 3300025297 Bacteria 7841
224 Ga0209758_1012541 3300025297 Bacteria 4729
225 Ga0207426_1000998 3300025302 Bacteria 27598
226 Ga0207426_1021924 3300025302 Bacteria 2200
227 Ga0207656_10008182 3300025321 Bacteria 3838
228 Ga0207653_10004937 3300025885 Bacteria 4166
229 Ga0207642_10119142 3300025899 Bacteria 1358
230 Ga0207688_10018719 3300025901 Bacteria 3766
231 Ga0207688_10047639 3300025901 Bacteria 2393
232 Ga0207688_10059448 3300025901 Bacteria 2153
233 Ga0207688_10127135 3300025901 Bacteria 1491
234 Ga0207647_10000674 3300025904 Bacteria 26753
235 Ga0207643_10045737 3300025908 Bacteria 2472
236 Ga0207705_10081176 3300025909 Bacteria 2364
237 Ga0207654_10000411 3300025911 Bacteria 24726
238 Ga0207654_10011939 3300025911 Bacteria 4441
239 Ga0207654_10194199 3300025911 Bacteria 1332
240 Ga0207654_10252539 3300025911 Bacteria 1183
241 Ga0207695_10000008 3300025913 Bacteria 1058268
242 Ga0207695_10000424 3300025913 Bacteria 93657
243 Ga0207695_10057665 3300025913 Bacteria 4034
244 Ga0207671_10011774 3300025914 Bacteria 7083
245 Ga0207671_10012559 3300025914 Bacteria 6802
246 Ga0207671_10415587 3300025914 Bacteria 1070
247 Ga0207693_10008179 3300025915 Bacteria 8569
248 Ga0207660_10757170 3300025917 Bacteria 793
249 Ga0207657_10310272 3300025919 Bacteria 1249
250 Ga0207649_10177172 3300025920 Bacteria 1490
251 Ga0207649_10474252 3300025920 Bacteria 948
252 Ga0207649_10561136 3300025920 Bacteria 875
253 Ga0207652_10316470 3300025921 Bacteria 1409
254 Ga0207681_10311617 3300025923 Bacteria 1248
255 Ga0207681_10433971 3300025923 Bacteria 1066
256 Ga0207694_10000347 3300025924 Bacteria 43770
257 Ga0207694_10032322 3300025924 Bacteria 4004
258 Ga0207694_10139322 3300025924 Bacteria 1950
259 Ga0207687_10044667 3300025927 Bacteria 3059
260 Ga0207687_10059786 3300025927 Bacteria 2686
261 Ga0207700_10071868 3300025928 Bacteria 2666
262 Ga0207644_10106269 3300025931 Bacteria 2116
263 Ga0207644_10335423 3300025931 Bacteria 1225
264 Ga0207690_10230331 3300025932 Bacteria 1422
265 Ga0207706_10076024 3300025933 Bacteria 2954
266 Ga0207706_10095998 3300025933 Bacteria 2607
267 Ga0207706_10132071 3300025933 Bacteria 2196
268 Ga0207709_10022516 3300025935 Bacteria 3574
269 Ga0207709_10224329 3300025935 Bacteria 1357
270 Ga0207670_10244497 3300025936 Bacteria 1384
271 Ga0207670_10355988 3300025936 Bacteria 1160
272 Ga0207669_10113998 3300025937 Bacteria 1818
273 Ga0207669_10173836 3300025937 Bacteria 1536
274 Ga0207665_10435643 3300025939 Bacteria 1004
275 Ga0207691_10344280 3300025940 Bacteria 1276
276 Ga0207711_10394178 3300025941 Bacteria 1286
277 Ga0207689_10027970 3300025942 Bacteria 4716
278 Ga0207689_10033587 3300025942 Bacteria 4262
279 Ga0207689_10152292 3300025942 Bacteria 1906
280 Ga0207661_10000647 3300025944 Bacteria 22491
281 Ga0207667_10012216 3300025949 Bacteria 9919
282 Ga0207667_10208918 3300025949 Bacteria 2001
283 Ga0207667_10574287 3300025949 Bacteria 1139
284 Ga0207651_10146138 3300025960 Bacteria 1834
285 Ga0207712_10131060 3300025961 Bacteria 1911
286 Ga0207668_10038842 3300025972 Bacteria 3198
287 Ga0207668_10116812 3300025972 Bacteria 2012
288 Ga0207640_10010275 3300025981 Bacteria 5268
289 Ga0207640_10021552 3300025981 Bacteria 3843
290 Ga0207640_10034597 3300025981 Bacteria 3154
291 Ga0207640_10083049 3300025981 Bacteria 2195
292 Ga0207658_10054061 3300025986 Bacteria 2970
293 Ga0207658_10114458 3300025986 Bacteria 2139
294 Ga0207677_10059246 3300026023 Bacteria 2640
295 Ga0207677_10495634 3300026023 Bacteria 1055
296 Ga0207703_10117760 3300026035 Bacteria 2276
297 Ga0207703_10127478 3300026035 Bacteria 2193
298 Ga0207703_10333448 3300026035 Bacteria 1392
299 Ga0207639_10041076 3300026041 Bacteria 3458
300 Ga0207639_10054143 3300026041 Bacteria 3065
301 Ga0207678_10077729 3300026067 Bacteria 2843
302 Ga0207678_10091798 3300026067 Bacteria 2596
303 Ga0207678_10095176 3300026067 Bacteria 2545
304 Ga0207678_10100719 3300026067 Bacteria 2468
305 Ga0207678_10109551 3300026067 Bacteria 2355
306 Ga0207678_10319696 3300026067 Bacteria 1335
307 Ga0207678_10380464 3300026067 Bacteria 1220
308 Ga0207678_10474669 3300026067 Bacteria 1089
309 Ga0207678_10508965 3300026067 Bacteria 1050
310 Ga0207708_10218688 3300026075 Bacteria 1526
311 Ga0207702_10000002 3300026078 Bacteria 491507
312 Ga0207702_10011407 3300026078 Bacteria 7409
313 Ga0207702_10149452 3300026078 Bacteria 2123
314 Ga0207702_10694435 3300026078 Bacteria 1003
315 Ga0207641_10805848 3300026088 Bacteria 929
316 Ga0207648_10176716 3300026089 Bacteria 1888
317 Ga0207648_10234412 3300026089 Bacteria 1633
318 Ga0207676_10522172 3300026095 Bacteria 1130
319 Ga0207676_10545255 3300026095 Bacteria 1107
320 Ga0207676_10938721 3300026095 Bacteria 850
321 Ga0207674_10009561 3300026116 Bacteria 11063
322 Ga0207674_10168213 3300026116 Bacteria 2146
323 Ga0207675_100187275 3300026118 Bacteria 1984
324 Ga0207683_10055407 3300026121 Bacteria 3476
325 Ga0207683_10327426 3300026121 Bacteria 1404
326 Ga0207683_10606486 3300026121 Bacteria 1013
327 Ga0207698_10003453 3300026142 Bacteria 9514
328 Ga0207698_10028115 3300026142 Bacteria 4005
329 Ga0207698_10143341 3300026142 Bacteria 2062
330 Ga0207698_10258632 3300026142 Bacteria 1598
331 Ga0207698_10930600 3300026142 Bacteria 877
332 Ga0209813_10124070 3300027866 Bacteria 902
333 Ga0268266_10283021 3300028379 Bacteria 1542
334 Ga0268266_10355467 3300028379 Bacteria 1377
335 Ga0268265_10026044 3300028380 Bacteria 4157
336 Ga0268265_10089976 3300028380 Bacteria 2450
337 Ga0268265_10274083 3300028380 Bacteria 1506
338 Ga0268264_10159180 3300028381 Bacteria 2032
339 Ga0307517_10001507 3300028786 Bacteria 38891
340 Ga0307511_10131200 3300030521 Bacteria 1509
341 Ga0265766_1004717 3300030863 Bacteria 841
342 Ga0265339_10002027 3300031249 Bacteria 14869
343 Ga0307513_10160001 3300031456 Bacteria 2146
344 Ga0307513_10202539 3300031456 Bacteria 1824
345 Ga0307508_10000249 3300031616 Bacteria 65482
346 Ga0265314_10014031 3300031711 Bacteria 6439
347 Ga0265314_10048593 3300031711 Bacteria 2977
348 Ga0307413_10026093 3300031824 Bacteria 3215
349 Ga0307413_10197518 3300031824 Bacteria 1450
350 Ga0307406_10170831 3300031901 Bacteria 1573
351 Ga0307407_10186701 3300031903 Bacteria 1378
352 Ga0307412_10025793 3300031911 Bacteria 3645
353 Ga0307412_10199695 3300031911 Bacteria 1518
354 Ga0307409_100170998 3300031995 Bacteria 1912
355 Ga0307416_100080534 3300032002 Bacteria 2749
356 Ga0307411_10076487 3300032005 Bacteria 2288
357 Ga0307415_100139282 3300032126 Bacteria 1850
358 Ga0307415_100628855 3300032126 Bacteria 959
359 Ga0307510_10075034 3300033180 Bacteria 3336
360 Ga0307510_10077445 3300033180 Bacteria 3261
361 Ga0307510_10175299 3300033180 Bacteria 1716
362 Ga0316215_1003920 3300033544 Bacteria 1423
363 Ga0372808_001591 3300036459 Bacteria 2405
364 Ga0395898_0078048 3300037466 Bacteria 3196
365 Ga0395905_0009682 3300037471 Bacteria 9408
366 Ga0395901_0173751 3300038443 Bacteria 2260
367 Ga0436365_0130490 3300039437 Bacteria 923
368 Ga0436365_1407659 3300039437 Bacteria 2118
369 Ga0436365_1588981 3300039437 Bacteria 1140
370 Ga0436360_1009642 3300039438 Bacteria 839
371 Ga0436361_1114452 3300039447 Bacteria 1702
372 Ga0436363_0799159 3300039450 Bacteria 817
373 Ga0439465_0092680 3300041413 Bacteria 1035
374 Ga0451804_0890762 3300041463 Bacteria 904
375 Ga0451853_1779309 3300041512 Bacteria 810
376 Ga0451853_1916674 3300041512 Bacteria 982
377 Ga0439458_0023515 3300042157 Bacteria 1437
378 Ga0466969_0019181 3300044656 Bacteria 3560
379 Ga0466969_0282756 3300044656 Bacteria 751
380 Ga0466972_0000200 3300044658 Bacteria 43953
381 Ga0466966_0001059 3300044684 Bacteria 17577
382 Ga0466961_0000050 3300044693 Bacteria 71289
383 Ga0466959_0026668 3300045049 Bacteria 4283
384 Ga0466958_0367497 3300045836 Bacteria 927
385 Ga0466967_0006745 3300045976 Bacteria 8170
386 Ga0466967_0084624 3300045976 Bacteria 2870
387 Ga0495617_049104 3300046452 Bacteria 1404
388 Ga0495592_0240856 3300046454 Bacteria 1200
389 Ga0495603_0116155 3300046455 Bacteria 1560
390 Ga0495590_0014239 3300046457 Bacteria 2905
391 Ga0495629_0001074 3300046459 Bacteria 21800
392 Ga0495629_0045299 3300046459 Bacteria 3086
393 Ga0495638_0001532 3300046460 Bacteria 20807
394 Ga0495638_0023480 3300046460 Bacteria 4032
395 Ga0495651_0001520 3300046462 Bacteria 17929
396 Ga0495651_0198724 3300046462 Bacteria 1405
397 Ga0495653_0349349 3300046463 Bacteria 951
398 Ga0495650_0051836 3300046471 Bacteria 1688
399 Ga0495650_0055945 3300046471 Bacteria 1603
400 Ga0495580_0284028 3300046472 Bacteria 1129
401 Ga0495582_0199011 3300046473 Bacteria 1144
402 Ga0495605_0062814 3300046474 Bacteria 1773
403 Ga0495605_0087120 3300046474 Bacteria 1452
404 Ga0495639_0143637 3300046475 Bacteria 1148
405 Ga0495664_0009304 3300046477 Bacteria 5493
406 Ga0495584_0035337 3300046491 Bacteria 2526
407 Ga0495585_0049564 3300046492 Bacteria 2331
408 Ga0495585_0064445 3300046492 Bacteria 2009
409 Ga0495594_0120361 3300046499 Bacteria 1484
410 Ga0495594_0214838 3300046499 Bacteria 1097
411 Ga0495594_0221291 3300046499 Bacteria 1079
412 Ga0495596_0017806 3300046500 Bacteria 2936
413 Ga0495607_0083920 3300046501 Bacteria 1744
414 Ga0495583_0113473 3300046506 Bacteria 1146
415 Ga0495606_0012281 3300046507 Bacteria 6889
416 Ga0495606_0038140 3300046507 Bacteria 3253
417 Ga0495606_0322119 3300046507 Bacteria 830
418 Ga0495608_0041927 3300046511 Bacteria 3061
419 Ga0495608_0061400 3300046511 Bacteria 2471
420 Ga0495610_0031329 3300046512 Bacteria 2775
421 Ga0495616_0019622 3300046513 Bacteria 3687
422 Ga0495620_0037367 3300046515 Bacteria 2164
423 Ga0495620_0053252 3300046515 Bacteria 1714
424 Ga0495628_0048546 3300046516 Bacteria 3364
425 Ga0495628_0430925 3300046516 Bacteria 960
426 Ga0495631_0170169 3300046518 Bacteria 934
427 Ga0495631_0177187 3300046518 Bacteria 914
428 Ga0495643_0089804 3300046522 Bacteria 1586
429 Ga0495644_0085417 3300046523 Bacteria 1189
430 Ga0495644_0177550 3300046523 Bacteria 818
431 Ga0495648_0007789 3300046524 Bacteria 8521
432 Ga0495648_0035596 3300046524 Bacteria 3226
433 Ga0495642_0022245 3300046528 Bacteria 2497
434 Ga0495652_0004137 3300046529 Bacteria 13996
435 Ga0495652_0116715 3300046529 Bacteria 2136
436 Ga0495652_0237307 3300046529 Bacteria 1359
437 Ga0495654_0057989 3300046530 Bacteria 1869
438 Ga0495640_0013570 3300046533 Bacteria 6193
439 Ga0495640_0175586 3300046533 Bacteria 1367
440 Ga0495587_0099595 3300046536 Bacteria 1675
441 Ga0495609_0023003 3300046538 Bacteria 2867
442 Ga0495621_0072084 3300046539 Bacteria 1274
443 Ga0495621_0157055 3300046539 Bacteria 898
444 Ga0495645_0052767 3300046543 Bacteria 2957
445 Ga0495622_0029823 3300046557 Bacteria 2548
446 Ga0495633_0031508 3300046558 Bacteria 2569
447 Ga0495633_0168187 3300046558 Bacteria 1011
448 Ga0495633_0177272 3300046558 Bacteria 981
449 Ga0495667_0001954 3300046559 Bacteria 13634
450 Ga0495667_0216481 3300046559 Bacteria 1223
451 Ga0495656_0107535 3300046615 Bacteria 1299
452 Ga0495656_0127132 3300046615 Bacteria 1209
453 Ga0495656_0169119 3300046615 Bacteria 1067
454 Ga0495656_0200272 3300046615 Bacteria 990
455 Ga0495668_0046611 3300046616 Bacteria 2408
456 Ga0495668_0055740 3300046616 Bacteria 2182
457 Ga0495668_0207276 3300046616 Bacteria 1073
458 Ga0495634_0064051 3300046642 Bacteria 2438
459 Ga0495611_0014614 3300046648 Bacteria 3356
460 Ga0495611_0018442 3300046648 Bacteria 2993
461 Ga0495625_0065754 3300046660 Bacteria 2555
462 Ga0495625_0118546 3300046660 Bacteria 1803
463 Ga0495635_0029484 3300046663 Bacteria 3816
464 Ga0495635_0038884 3300046663 Bacteria 3293
465 Ga0495659_0057282 3300046664 Bacteria 1431
466 Ga0495659_0170113 3300046664 Bacteria 883
467 Ga0495588_0146885 3300046674 Bacteria 1246
468 Ga0495657_0000889 3300046675 Bacteria 26346
469 Ga0495657_0013750 3300046675 Bacteria 5959
470 Ga0495599_0048064 3300046678 Bacteria 2674
471 Ga0495623_0005846 3300046679 Bacteria 8019
472 Ga0495646_0023476 3300046680 Bacteria 3882
473 Ga0495646_0069412 3300046680 Bacteria 2079
474 Ga0495647_0092494 3300046681 Bacteria 1242
475 Ga0495669_0001878 3300046684 Bacteria 8615
476 Ga0495669_0023843 3300046684 Bacteria 2665
477 Ga0495669_0214743 3300046684 Bacteria 921
478 Ga0495613_0010887 3300046689 Bacteria 6750
479 Ga0495613_0012709 3300046689 Bacteria 6261
480 Ga0495624_0036110 3300046690 Bacteria 3188
481 Ga0495670_0081849 3300046691 Bacteria 1645
482 Ga0495670_0283774 3300046691 Bacteria 886
483 Ga0495649_0006966 3300046694 Bacteria 6975
484 Ga0495649_0090648 3300046694 Bacteria 1630
485 Ga0495649_0094642 3300046694 Bacteria 1590
486 Ga0495600_0001856 3300046809 Bacteria 11854
487 Ga0495600_0051569 3300046809 Bacteria 2685
488 Ga0495604_0004282 3300047317 Bacteria 11303
489 Ga0495604_0043497 3300047317 Bacteria 3515
490 Ga0495674_0051435 3300047319 Bacteria 3632
491 Ga0495672_0072363 3300047320 Bacteria 1947
492 Ga0495672_0096380 3300047320 Bacteria 1613
493 Ga0495672_0241082 3300047320 Bacteria 883
494 Ga0495676_0030358 3300047321 Bacteria 4589
495 Ga0495676_0177434 3300047321 Bacteria 1495
496 Ga0495680_0002530 3300047322 Bacteria 18695
497 Ga0495683_0037174 3300047323 Bacteria 2469
498 Ga0495675_0025330 3300047444 Bacteria 3782
499 Ga0495677_0017120 3300047445 Bacteria 2628
500 Ga0495677_0028231 3300047445 Bacteria 2037
501 Ga0495673_0053938 3300047469 Bacteria 1750
502 Ga0495673_0090873 3300047469 Bacteria 1248
503 Ga0495684_0088708 3300047471 Bacteria 2344
504 Ga0495686_0042724 3300047472 Bacteria 2879
505 Ga0495686_0075836 3300047472 Bacteria 2061
506 Ga0495686_0175993 3300047472 Bacteria 1242
507 Ga0495686_0234383 3300047472 Bacteria 1038
508 Ga0495593_0054177 3300047673 Bacteria 2115
509 Ga0495593_0197116 3300047673 Bacteria 1012
510 Ga0495602_0003401 3300048088 Bacteria 16456
511 Ga0495602_0345942 3300048088 Bacteria 1074
512 Ga0495615_0037754 3300048090 Bacteria 1191
513 Ga0495626_0019232 3300048091 Bacteria 3416
514 Ga0496100_0047643 3300048903 Bacteria 2763
515 Ga0496100_0097636 3300048903 Bacteria 2018
516 Ga0496100_0529006 3300048903 Bacteria 910
517 Ga0496101_0006609 3300048904 Bacteria 7470
518 Ga0496101_0163170 3300048904 Bacteria 1710
519 Ga0496101_0252853 3300048904 Bacteria 1373
520 Ga0496102_0013546 3300048905 Bacteria 7067
521 Ga0496102_0083160 3300048905 Bacteria 2953
522 Ga0496102_0105735 3300048905 Bacteria 2619
523 Ga0496102_0133818 3300048905 Bacteria 2322
524 Ga0496103_0127918 3300048906 Bacteria 1621
525 Ga0496104_0000281 3300048907 Bacteria 45166
526 Ga0496104_0008421 3300048907 Bacteria 9169
527 Ga0496104_0037061 3300048907 Bacteria 4560
528 Ga0496104_0143567 3300048907 Bacteria 2293
529 Ga0496104_0480999 3300048907 Bacteria 1153
530 Ga0496105_0011220 3300048908 Bacteria 7069
531 Ga0496105_0038493 3300048908 Bacteria 3939
532 Ga0496105_0061759 3300048908 Bacteria 3092
533 Ga0496106_0006503 3300048909 Bacteria 8654
534 Ga0496106_0107271 3300048909 Bacteria 2172
535 Ga0496107_0019745 3300048910 Bacteria 4756
536 Ga0496107_0043926 3300048910 Bacteria 3211
537 Ga0496107_0364426 3300048910 Bacteria 1075
538 Ga0496108_0067630 3300048911 Bacteria 3014
539 Ga0496108_0277701 3300048911 Bacteria 1458
540 Ga0496110_0117351 3300048913 Bacteria 2396
541 Ga0496110_0238866 3300048913 Bacteria 1653
542 Ga0496110_0243092 3300048913 Bacteria 1638
543 Ga0496111_0058971 3300048914 Bacteria 2780
544 Ga0496111_0061667 3300048914 Bacteria 2718
545 Ga0496111_0530763 3300048914 Bacteria 865
546 Ga0496112_0070807 3300048915 Bacteria 3446
547 Ga0496112_0251739 3300048915 Bacteria 1717
548 Ga0496113_0122738 3300048916 Bacteria 2032
549 Ga0496113_0141201 3300048916 Bacteria 1895
550 Ga0496113_0281929 3300048916 Bacteria 1329
551 Ga0496114_0025621 3300048917 Bacteria 4822
552 Ga0496114_0034287 3300048917 Bacteria 4187
553 Ga0496114_0269795 3300048917 Bacteria 1499
554 Ga0496115_0001082 3300048918 Bacteria 19741
555 Ga0496115_0026056 3300048918 Bacteria 4560
556 Ga0496115_0138877 3300048918 Bacteria 2004
557 Ga0496115_0385966 3300048918 Bacteria 1138
558 Ga0496115_0765900 3300048918 Bacteria 754
559 Ga0496116_0158272 3300048919 Bacteria 1247
560 Ga0496117_0066676 3300048920 Bacteria 2440
561 Ga0496117_0160149 3300048920 Bacteria 1320
562 Ga0496118_0219110 3300048921 Bacteria 1109
563 Ga0496119_0005325 3300048922 Bacteria 12378
564 Ga0496119_0111262 3300048922 Bacteria 1519
565 Ga0496119_0167280 3300048922 Bacteria 1164
566 Ga0496120_0001511 3300048923 Bacteria 27505
567 Ga0496120_0128661 3300048923 Bacteria 1300
568 Ga0496121_0028398 3300048924 Bacteria 5207
569 Ga0496121_0077823 3300048924 Bacteria 2639
570 Ga0496121_0149409 3300048924 Bacteria 1721
571 Ga0496121_0293196 3300048924 Bacteria 1107
572 Ga0496121_0373635 3300048924 Bacteria 942
573 Ga0496122_0014132 3300048925 Bacteria 7742
574 Ga0496122_0024695 3300048925 Bacteria 5251
575 Ga0496123_0267797 3300048926 Bacteria 833
576 Ga0496124_0029888 3300048927 Bacteria 4847
577 Ga0496124_0144905 3300048927 Bacteria 1870
578 Ga0496124_0464134 3300048927 Bacteria 859
579 Ga0496125_0050051 3300048928 Bacteria 3464
580 Ga0496125_0122043 3300048928 Bacteria 1856
581 Ga0496125_0302923 3300048928 Bacteria 978
582 Ga0496126_0002195 3300048929 Bacteria 27094
583 Ga0496126_0038456 3300048929 Bacteria 4452
584 Ga0496126_0088669 3300048929 Bacteria 2724
585 Ga0496126_0141281 3300048929 Bacteria 2072
586 Ga0496126_0246766 3300048929 Bacteria 1489
587 Ga0496126_0411946 3300048929 Bacteria 1094
588 Ga0496126_0433651 3300048929 Bacteria 1060
589 Ga0495682_0009193 3300049460 Bacteria 3866
590 Ga0501039_0313739 3300049575 Bacteria 1233
591 Ga0501067_0029147 3300049583 Bacteria 3059
592 Ga0501070_0614443 3300049586 Bacteria 866
593 Ga0501071_0175580 3300049587 Bacteria 1605
594 Ga0501076_0056326 3300049592 Bacteria 3120
595 Ga0501045_0231428 3300049824 Bacteria 1376
596 nmdc:mga03683_203959_c1 3300050489 Bacteria 908
597 nmdc:mga03n38_45781_c1 3300050490 Bacteria 1928
598 nmdc:mga03n38_72315_c1 3300050490 Bacteria 1598
599 nmdc:mga0yw44_167115_c1 3300050492 Bacteria 1443
600 nmdc:mga0yw44_23741_c1 3300050492 Bacteria 3459
601 nmdc:mga0yw44_30604_c1 3300050492 Bacteria 3122
602 nmdc:mga0yw44_4648_c1 3300050492 Bacteria 6341
603 nmdc:mga0k408_78564_c1 3300050493 Bacteria 1931
604 nmdc:mga0k408_8031_c1 3300050493 Bacteria 5657
605 nmdc:mga06z11_240560_c1 3300050494 Bacteria 1063
606 nmdc:mga09592_183634_c1 3300050508 Bacteria 1809
607 nmdc:mga08y16_492555_c1 3300050511 Bacteria 1246
608 nmdc:mga0n895_197525_c1 3300050512 Bacteria 2043
609 nmdc:mga0rr50_588152_c1 3300050513 Bacteria 949
610 nmdc:mga08x19_201358_c1 3300050514 Bacteria 1365
611 nmdc:mga0sz30_144776_c1 3300050516 Bacteria 1050
612 nmdc:mga0sz30_1617_c1 3300050516 Bacteria 3982
613 Ga0495601_0148205 3300053077 Bacteria 1532
614 Ga0500610_0185895 3300053079 Bacteria 1013
615 Ga0495655_0003619 3300053083 Bacteria 2566
616 Ga0495595_0124545 3300053084 Bacteria 1257
617 Ga0495619_0133418 3300053085 Bacteria 1707
618 Ga0500578_0051516 3300053086 Bacteria 2637
619 Ga0500643_000319 3300053087 Bacteria 38698
620 Ga0500643_034252 3300053087 Bacteria 1531
621 Ga0500583_0058527 3300053092 Bacteria 1812
622 Ga0500566_0004766 3300053094 Bacteria 8084
623 Ga0500641_0023473 3300053096 Bacteria 2372
624 Ga0500641_0216751 3300053096 Bacteria 813
625 Ga0500556_0096440 3300053104 Bacteria 1135
626 Ga0500557_001651 3300053105 Bacteria 3758
627 Ga0500569_051451 3300053109 Bacteria 1244
628 Ga0500595_001406 3300053119 Bacteria 12911
629 Ga0500595_008531 3300053119 Bacteria 4182
630 Ga0500595_009426 3300053119 Bacteria 3940
631 Ga0500642_0000057 3300053130 Bacteria 67011
632 Ga0500559_0187967 3300053136 Bacteria 973
633 Ga0500561_0032027 3300053137 Bacteria 1333
634 Ga0500577_0045176 3300053142 Bacteria 1626
635 Ga0500579_105193 3300053143 Bacteria 1450
636 Ga0500589_085098 3300053147 Bacteria 1404
637 Ga0500590_109946 3300053148 Bacteria 1309
638 Ga0500603_084254 3300053150 Bacteria 925
639 Ga0500622_0007294 3300053156 Bacteria 6294
640 Ga0500627_0053283 3300053158 Bacteria 1767
641 Ga0500638_000402 3300053162 Bacteria 10262
642 Ga0500637_0002381 3300053178 Bacteria 8348
643 Ga0500637_0113806 3300053178 Bacteria 1569
644 Ga0500649_063600 3300053722 Bacteria 1535
645 Ga0500625_002930 3300053729 Bacteria 6580
646 Ga0500656_005620 3300053732 Bacteria 1244
647 Ga0500656_007310 3300053732 Bacteria 1144
648 Ga0500661_000108 3300055283 Bacteria 13387
649 Ga0500661_019746 3300055283 Bacteria 1199
650 Ga0587090_021918 3300059510 Bacteria 1006
651 Ga0587111_0024083 3300060346 Bacteria 1196
652 Ga0530510_0288941 3300061734 Bacteria 1226

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0799159 Ga0436363_0799159_199_807 182
2 3300013297 Ga0157378_10584210 Ga0157378_105842102 187
3 3300048915 Ga0496112_0251739 Ga0496112_0251739_177_866 190
4 3300013296 Ga0157374_10013080 Ga0157374_100130802 191
5 3300005563 Ga0068855_100239207 Ga0068855_1002392072 192
6 3300046455 Ga0495603_0116155 Ga0495603_0116155_342_1052 193
7 3300046492 Ga0495585_0049564 Ga0495585_0049564_224_934 193
8 3300046499 Ga0495594_0221291 Ga0495594_0221291_177_887 193
9 3300046615 Ga0495656_0169119 Ga0495656_0169119_166_876 193
10 3300046664 Ga0495659_0170113 Ga0495659_0170113_43_753 193
11 iso_pu_bacteria 8019678201 8019685383 193
12 3300005535 Ga0070684_100005320 Ga0070684_1000053203 194
13 3300025944 Ga0207661_10000647 Ga0207661_1000064712 194
14 3300041512 Ga0451853_1779309 Ga0451853_1779309_88_789 194
15 3300026142 Ga0207698_10258632 Ga0207698_102586321 195
16 3300037466 Ga0395898_0078048 Ga0395898_0078048_1159_1845 195
17 3300044656 Ga0466969_0282756 Ga0466969_0282756_13_660 195
18 3300005548 Ga0070665_100084978 Ga0070665_1000849782 197
19 3300025939 Ga0207665_10435643 Ga0207665_104356431 197
20 3300028379 Ga0268266_10355467 Ga0268266_103554672 197
21 3300049592 Ga0501076_0056326 Ga0501076_0056326_813_1520 197
22 3300009545 Ga0105237_10102741 Ga0105237_101027412 199
23 3300009551 Ga0105238_10008473 Ga0105238_100084739 199
24 3300005336 Ga0070680_100393738 Ga0070680_1003937382 200
25 3300025924 Ga0207694_10139322 Ga0207694_101393222 200
26 3300047469 Ga0495673_0090873 Ga0495673_0090873_593_1225 200
27 3300046472 Ga0495580_0284028 Ga0495580_0284028_168_878 201
28 3300046681 Ga0495647_0092494 Ga0495647_0092494_338_1048 201
29 3300047321 Ga0495676_0177434 Ga0495676_0177434_278_988 201
30 3300053094 Ga0500566_0004766 Ga0500566_0004766_4000_4692 201
31 3300053119 Ga0500595_001406 Ga0500595_001406_6487_7179 201
32 3300053162 Ga0500638_000402 Ga0500638_000402_6552_7244 201
33 3300053178 Ga0500637_0002381 Ga0500637_0002381_1135_1827 201
34 3300055283 Ga0500661_000108 Ga0500661_000108_7971_8663 201
35 3300021384 Ga0213876_10146329 Ga0213876_101463292 202
36 3300039437 Ga0436365_1588981 Ga0436365_1588981_80_769 202
37 3300005329 Ga0070683_100153824 Ga0070683_1001538242 204
38 3300005341 Ga0070691_10260897 Ga0070691_102608971 204
39 3300005458 Ga0070681_10088485 Ga0070681_100884852 204
40 3300025272 Ga0209455_1018656 Ga0209455_10186562 205
41 3300046516 Ga0495628_0430925 Ga0495628_0430925_110_817 206
42 3300005336 Ga0070680_100036060 Ga0070680_1000360604 207
43 3300005530 Ga0070679_100332109 Ga0070679_1003321092 207
44 3300025917 Ga0207660_10757170 Ga0207660_107571701 207
45 3300025921 Ga0207652_10316470 Ga0207652_103164702 207
46 3300033180 Ga0307510_10075034 Ga0307510_100750342 207
47 3300044656 Ga0466969_0019181 Ga0466969_0019181_1055_1747 207
48 3300044684 Ga0466966_0001059 Ga0466966_0001059_13574_14266 207
49 3300044693 Ga0466961_0000050 Ga0466961_0000050_9547_10239 207
50 3300045049 Ga0466959_0026668 Ga0466959_0026668_2298_2990 207
51 3300045836 Ga0466958_0367497 Ga0466958_0367497_145_837 207
52 3300046501 Ga0495607_0083920 Ga0495607_0083920_115_807 207
53 3300048918 Ga0496115_0765900 Ga0496115_0765900_16_663 207
54 3300048924 Ga0496121_0293196 Ga0496121_0293196_146_862 207
55 3300053722 Ga0500649_063600 Ga0500649_063600_201_893 207
56 3300055283 Ga0500661_019746 Ga0500661_019746_285_983 207
57 3300038443 Ga0395901_0173751 Ga0395901_0173751_691_1380 209
58 3300045976 Ga0466967_0084624 Ga0466967_0084624_1838_2527 209
59 3300039447 Ga0436361_1114452 Ga0436361_1114452_725_1420 210
60 3300025986 Ga0207658_10054061 Ga0207658_100540612 211
61 3300031824 Ga0307413_10197518 Ga0307413_101975182 211
62 3300025981 Ga0207640_10010275 Ga0207640_100102754 213
63 iso_pu_bacteria 8016603502 8016609402 213
64 iso_pu_bacteria 2528768022 2528849077 214
65 iso_pu_bacteria 2824661429 2824668506 214
66 iso_pu_bacteria 2824753945 2824758460 214
67 iso_pu_bacteria 2824763712 2824770044 214
68 iso_pu_bacteria 2879099564 2879107043 214
69 iso_pu_bacteria 2904711408 2904712073 214
70 iso_pu_bacteria 2922368715 2922372504 214
71 iso_pu_bacteria 2929615660 2929620932 214
72 iso_pu_bacteria 2929624759 2929626237 214
73 iso_pu_bacteria 2932784394 2932784884 214
74 iso_pu_bacteria 2932809354 2932809918 214
75 iso_pu_bacteria 2932818245 2932818339 214
76 iso_pu_bacteria 2932828146 2932828721 214
77 iso_pu_bacteria 2933577622 2933583198 214
78 iso_pu_bacteria 2935616580 2935619859 214
79 iso_pu_bacteria 2935638405 2935638841 214
80 iso_pu_bacteria 2935665750 2935666309 214
81 iso_pu_bacteria 2935675223 2935676646 214
82 iso_pu_bacteria 2935684952 2935685029 214
83 iso_pu_bacteria 2935694250 2935694725 214
84 iso_pu_bacteria 2935703347 2935703846 214
85 iso_pu_bacteria 2935713505 2935713582 214
86 iso_pu_bacteria 2935722832 2935724202 214
87 iso_pu_bacteria 2935732158 2935733440 214
88 iso_pu_bacteria 2935741537 2935742819 214
89 iso_pu_bacteria 2935750917 2935750994 214
90 iso_pu_bacteria 2935760218 2935760477 214
91 iso_pu_bacteria 2935801545 2935801983 214
92 iso_pu_bacteria 2935810662 2935810752 214
93 iso_pu_bacteria 2935827899 2935828335 214
94 iso_pu_bacteria 2935837841 2935839750 214
95 iso_pu_bacteria 2935855204 2935857826 214
96 iso_pu_bacteria 2935864058 2935868832 214
97 iso_pu_bacteria 2935873716 2935874247 214
98 iso_pu_bacteria 2935992306 2935992828 214
99 iso_pu_bacteria 2936002035 2936002741 214
100 iso_pu_bacteria 2936037263 2936037828 214
101 iso_pu_bacteria 2940556831 2940558203 214
102 iso_pu_bacteria 2941538514 2941540909 214
103 iso_pu_bacteria 8016511872 8016520757 214
104 iso_pu_bacteria 8017057580 8017064829 214
105 iso_pu_bacteria 8019576017 8019584202 214
106 iso_pu_bacteria 8019597564 8019599323 214
107 iso_pu_bacteria 8019608314 8019609035 214
108 iso_pu_bacteria 8055742211 8055745205 214
109 3300048927 Ga0496124_0029888 Ga0496124_0029888_37_843 215
110 3300048929 Ga0496126_0411946 Ga0496126_0411946_302_1081 215
111 iso_pu_bacteria 2513237094 2513642883 215
112 iso_pu_bacteria 2844315083 2844319927 215
113 iso_pu_bacteria 2885383462 2885388300 215
114 iso_pu_bacteria 2885409591 2885412281 215
115 iso_pu_bacteria 2903727486 2903730400 215
116 iso_pu_bacteria 2906602504 2906604667 215
117 iso_pu_bacteria 2932794094 2932795243 215
118 iso_pu_bacteria 2932801729 2932805774 215
119 iso_pu_bacteria 2935883170 2935883856 215
120 iso_pu_bacteria 2935959822 2935961321 215
121 iso_pu_bacteria 2941531003 2941531112 215
122 iso_pu_bacteria 3005594810 3005600206 215
123 iso_pu_bacteria 3005718088 3005723066 215
124 iso_pu_bacteria 8019648815 8019649253 215
125 iso_pu_bacteria 8056967851 8056975167 215
126 3300025295 Ga0209564_1001937 Ga0209564_10019374 216
127 3300048925 Ga0496122_0024695 Ga0496122_0024695_2155_2955 216
128 iso_pu_bacteria 2507262055 2507507748 216
129 iso_pu_bacteria 2508501009 2508541871 216
130 iso_pu_bacteria 2876808645 2876814531 216
131 iso_pu_bacteria 2879110137 2879114626 216
132 iso_pu_bacteria 2889033259 2889038111 216
133 iso_pu_bacteria 2935769743 2935772031 216
134 iso_pu_bacteria 2935777560 2935784206 216
135 iso_pu_bacteria 2935785616 2935787581 216
136 iso_pu_bacteria 2935793552 2935796213 216
137 iso_pu_bacteria 2936055302 2936062067 216
138 iso_pu_bacteria 3005710791 3005715718 216
139 iso_pu_bacteria 8016522445 8016528788 216
140 iso_pu_bacteria 8016530956 8016533969 216
141 iso_pu_bacteria 8016539877 8016547197 216
142 iso_pu_bacteria 8016548790 8016554932 216
143 iso_pu_bacteria 8016557553 8016563299 216
144 iso_pu_bacteria 8016566248 8016572312 216
145 iso_pu_bacteria 8016575299 8016576493 216
146 iso_pu_bacteria 8016595262 8016601051 216
147 iso_pu_bacteria 8016613128 8016615507 216
148 iso_pu_bacteria 8016622563 8016625716 216
149 iso_pu_bacteria 8019530166 8019533742 216
150 iso_pu_bacteria 8019538911 8019545927 216
151 iso_pu_bacteria 8019547302 8019552799 216
152 3300009101 Ga0105247_10088313 Ga0105247_100883132 217
153 3300014325 Ga0163163_10310125 Ga0163163_103101252 217
154 3300048920 Ga0496117_0066676 Ga0496117_0066676_1444_2130 217
155 3300049575 Ga0501039_0313739 Ga0501039_0313739_237_923 217
156 3300050492 nmdc:mga0yw44_23741_c1 nmdc:mga0yw44_23741_c1_908_1594 217
157 3300061734 Ga0530510_0288941 Ga0530510_0288941_498_1184 217
158 3300005337 Ga0070682_100512492 Ga0070682_1005124921 218
159 3300005338 Ga0068868_100284394 Ga0068868_1002843942 218
160 3300005347 Ga0070668_100074203 Ga0070668_1000742032 218
161 3300005455 Ga0070663_100035903 Ga0070663_1000359032 218
162 3300005457 Ga0070662_100280027 Ga0070662_1002800272 218
163 3300005539 Ga0068853_100228520 Ga0068853_1002285202 218
164 3300005564 Ga0070664_100530161 Ga0070664_1005301612 218
165 3300005614 Ga0068856_100461069 Ga0068856_1004610692 218
166 3300005618 Ga0068864_100321795 Ga0068864_1003217952 218
167 3300005842 Ga0068858_100293340 Ga0068858_1002933402 218
168 3300005983 Ga0081540_1008037 Ga0081540_10080376 218
169 3300006038 Ga0075365_10374404 Ga0075365_103744042 218
170 3300009036 Ga0105244_10308900 Ga0105244_103089001 218
171 3300009545 Ga0105237_10131779 Ga0105237_101317793 218
172 3300010375 Ga0105239_10610254 Ga0105239_106102542 218
173 3300025909 Ga0207705_10081176 Ga0207705_100811761 218
174 3300025920 Ga0207649_10474252 Ga0207649_104742522 218
175 3300025972 Ga0207668_10038842 Ga0207668_100388422 218
176 3300026035 Ga0207703_10333448 Ga0207703_103334481 218
177 3300026041 Ga0207639_10054143 Ga0207639_100541432 218
178 3300026067 Ga0207678_10380464 Ga0207678_103804642 218
179 3300026078 Ga0207702_10694435 Ga0207702_106944352 218
180 3300026095 Ga0207676_10522172 Ga0207676_105221721 218
181 3300046462 Ga0495651_0001520 Ga0495651_0001520_16969_17658 218
182 3300046477 Ga0495664_0009304 Ga0495664_0009304_4120_4809 218
183 3300046511 Ga0495608_0041927 Ga0495608_0041927_1046_1735 218
184 3300046515 Ga0495620_0037367 Ga0495620_0037367_1014_1703 218
185 3300046516 Ga0495628_0048546 Ga0495628_0048546_1501_2190 218
186 3300046524 Ga0495648_0035596 Ga0495648_0035596_1633_2322 218
187 3300046529 Ga0495652_0004137 Ga0495652_0004137_3726_4415 218
188 3300046533 Ga0495640_0013570 Ga0495640_0013570_1637_2326 218
189 3300046536 Ga0495587_0099595 Ga0495587_0099595_395_1084 218
190 3300046543 Ga0495645_0052767 Ga0495645_0052767_1995_2684 218
191 3300046559 Ga0495667_0001954 Ga0495667_0001954_9748_10437 218
192 3300046648 Ga0495611_0018442 Ga0495611_0018442_12_701 218
193 3300046663 Ga0495635_0029484 Ga0495635_0029484_1749_2438 218
194 3300046674 Ga0495588_0146885 Ga0495588_0146885_491_1180 218
195 3300046675 Ga0495657_0000889 Ga0495657_0000889_5615_6304 218
196 3300046678 Ga0495599_0048064 Ga0495599_0048064_1709_2398 218
197 3300046679 Ga0495623_0005846 Ga0495623_0005846_5411_6100 218
198 3300046680 Ga0495646_0023476 Ga0495646_0023476_2399_3088 218
199 3300046689 Ga0495613_0012709 Ga0495613_0012709_4577_5266 218
200 3300046809 Ga0495600_0051569 Ga0495600_0051569_1911_2600 218
201 3300047317 Ga0495604_0004282 Ga0495604_0004282_6379_7068 218
202 3300047319 Ga0495674_0051435 Ga0495674_0051435_760_1449 218
203 3300048088 Ga0495602_0003401 Ga0495602_0003401_13351_14040 218
204 3300048905 Ga0496102_0013546 Ga0496102_0013546_886_1575 218
205 3300048906 Ga0496103_0127918 Ga0496103_0127918_709_1395 218
206 3300048907 Ga0496104_0037061 Ga0496104_0037061_586_1275 218
207 3300048908 Ga0496105_0038493 Ga0496105_0038493_791_1480 218
208 3300048910 Ga0496107_0043926 Ga0496107_0043926_2009_2698 218
209 3300048914 Ga0496111_0061667 Ga0496111_0061667_919_1608 218
210 3300048915 Ga0496112_0070807 Ga0496112_0070807_795_1484 218
211 3300048917 Ga0496114_0025621 Ga0496114_0025621_2855_3544 218
212 3300048918 Ga0496115_0138877 Ga0496115_0138877_685_1374 218
213 3300048924 Ga0496121_0077823 Ga0496121_0077823_1879_2568 218
214 3300003762 Ga0055542_1023569 Ga0055542_10235691 219
215 3300005262 Ga0065165_1001679 Ga0065165_10016793 219
216 3300005578 Ga0068854_100030788 Ga0068854_1000307884 219
217 3300005614 Ga0068856_101219260 Ga0068856_1012192601 219
218 3300005616 Ga0068852_100017943 Ga0068852_1000179434 219
219 3300009093 Ga0105240_10016135 Ga0105240_100161356 219
220 3300009545 Ga0105237_10008696 Ga0105237_100086962 219
221 3300010375 Ga0105239_10072318 Ga0105239_100723183 219
222 3300025254 Ga0209148_1000180 Ga0209148_10001806 219
223 3300025261 Ga0209233_1032716 Ga0209233_10327162 219
224 3300025272 Ga0209455_1002814 Ga0209455_10028142 219
225 3300025297 Ga0209758_1004237 Ga0209758_10042379 219
226 3300025302 Ga0207426_1000998 Ga0207426_10009982 219
227 3300025911 Ga0207654_10011939 Ga0207654_100119394 219
228 3300025913 Ga0207695_10000008 Ga0207695_10000008704 219
229 3300025914 Ga0207671_10011774 Ga0207671_100117746 219
230 3300025981 Ga0207640_10083049 Ga0207640_100830492 219
231 3300026142 Ga0207698_10003453 Ga0207698_100034539 219
232 3300033180 Ga0307510_10077445 Ga0307510_100774452 219
233 3300039437 Ga0436365_0130490 Ga0436365_0130490_153_845 219
234 3300039437 Ga0436365_1407659 Ga0436365_1407659_1058_1750 219
235 3300042157 Ga0439458_0023515 Ga0439458_0023515_501_1190 219
236 3300044658 Ga0466972_0000200 Ga0466972_0000200_93_785 219
237 3300045976 Ga0466967_0006745 Ga0466967_0006745_4487_5179 219
238 3300046454 Ga0495592_0240856 Ga0495592_0240856_70_762 219
239 3300046459 Ga0495629_0001074 Ga0495629_0001074_20232_20924 219
240 3300046460 Ga0495638_0001532 Ga0495638_0001532_2898_3590 219
241 3300046463 Ga0495653_0349349 Ga0495653_0349349_195_887 219
242 3300046474 Ga0495605_0087120 Ga0495605_0087120_214_906 219
243 3300046475 Ga0495639_0143637 Ga0495639_0143637_99_791 219
244 3300046499 Ga0495594_0120361 Ga0495594_0120361_568_1260 219
245 3300046506 Ga0495583_0113473 Ga0495583_0113473_83_775 219
246 3300046507 Ga0495606_0012281 Ga0495606_0012281_3571_4263 219
247 3300046511 Ga0495608_0061400 Ga0495608_0061400_1016_1708 219
248 3300046515 Ga0495620_0053252 Ga0495620_0053252_826_1518 219
249 3300046518 Ga0495631_0177187 Ga0495631_0177187_11_703 219
250 3300046524 Ga0495648_0007789 Ga0495648_0007789_2852_3544 219
251 3300046529 Ga0495652_0116715 Ga0495652_0116715_783_1475 219
252 3300046529 Ga0495652_0237307 Ga0495652_0237307_412_1104 219
253 3300046533 Ga0495640_0175586 Ga0495640_0175586_280_972 219
254 3300046557 Ga0495622_0029823 Ga0495622_0029823_1317_2009 219
255 3300046559 Ga0495667_0216481 Ga0495667_0216481_437_1129 219
256 3300046642 Ga0495634_0064051 Ga0495634_0064051_1651_2343 219
257 3300046660 Ga0495625_0118546 Ga0495625_0118546_924_1616 219
258 3300046663 Ga0495635_0038884 Ga0495635_0038884_2271_2963 219
259 3300046675 Ga0495657_0013750 Ga0495657_0013750_896_1588 219
260 3300046680 Ga0495646_0069412 Ga0495646_0069412_1325_2017 219
261 3300046689 Ga0495613_0010887 Ga0495613_0010887_414_1106 219
262 3300046690 Ga0495624_0036110 Ga0495624_0036110_1923_2615 219
263 3300046694 Ga0495649_0006966 Ga0495649_0006966_3800_4492 219
264 3300046809 Ga0495600_0001856 Ga0495600_0001856_792_1484 219
265 3300047317 Ga0495604_0043497 Ga0495604_0043497_692_1384 219
266 3300047321 Ga0495676_0030358 Ga0495676_0030358_424_1116 219
267 3300047322 Ga0495680_0002530 Ga0495680_0002530_13016_13708 219
268 3300047444 Ga0495675_0025330 Ga0495675_0025330_1989_2681 219
269 3300047471 Ga0495684_0088708 Ga0495684_0088708_1542_2234 219
270 3300047472 Ga0495686_0042724 Ga0495686_0042724_259_951 219
271 3300047472 Ga0495686_0075836 Ga0495686_0075836_332_1024 219
272 3300047673 Ga0495593_0197116 Ga0495593_0197116_107_799 219
273 3300048088 Ga0495602_0345942 Ga0495602_0345942_361_1053 219
274 3300048905 Ga0496102_0105735 Ga0496102_0105735_1878_2570 219
275 3300048907 Ga0496104_0000281 Ga0496104_0000281_20671_21363 219
276 3300048908 Ga0496105_0011220 Ga0496105_0011220_4474_5166 219
277 3300048916 Ga0496113_0141201 Ga0496113_0141201_758_1450 219
278 3300048917 Ga0496114_0269795 Ga0496114_0269795_477_1169 219
279 3300048918 Ga0496115_0026056 Ga0496115_0026056_3637_4329 219
280 3300048921 Ga0496118_0219110 Ga0496118_0219110_145_837 219
281 3300048922 Ga0496119_0005325 Ga0496119_0005325_575_1267 219
282 3300048923 Ga0496120_0001511 Ga0496120_0001511_19175_19867 219
283 3300048924 Ga0496121_0373635 Ga0496121_0373635_30_722 219
284 3300048926 Ga0496123_0267797 Ga0496123_0267797_117_809 219
285 3300048929 Ga0496126_0088669 Ga0496126_0088669_1136_1828 219
286 3300049460 Ga0495682_0009193 Ga0495682_0009193_770_1462 219
287 3300053084 Ga0495595_0124545 Ga0495595_0124545_70_762 219
288 3300053085 Ga0495619_0133418 Ga0495619_0133418_940_1632 219
289 3300053087 Ga0500643_000319 Ga0500643_000319_16188_16880 219
290 3300053096 Ga0500641_0216751 Ga0500641_0216751_110_802 219
291 3300053119 Ga0500595_008531 Ga0500595_008531_2692_3384 219
292 3300053136 Ga0500559_0187967 Ga0500559_0187967_19_711 219
293 3300053156 Ga0500622_0007294 Ga0500622_0007294_344_1036 219
294 3300053732 Ga0500656_005620 Ga0500656_005620_157_849 219
295 iso_pu_bacteria 2508501128 2509149395 219
296 3300003215 JGI25153J46596_10016218 JGI25153J46596_100162182 220
297 3300014325 Ga0163163_10494014 Ga0163163_104940142 220
298 3300025302 Ga0207426_1021924 Ga0207426_10219241 220
299 3300037471 Ga0395905_0009682 Ga0395905_0009682_5953_6648 220
300 3300048907 Ga0496104_0143567 Ga0496104_0143567_108_800 220
301 3300048909 Ga0496106_0107271 Ga0496106_0107271_258_950 220
302 3300048916 Ga0496113_0281929 Ga0496113_0281929_128_820 220
303 3300048919 Ga0496116_0158272 Ga0496116_0158272_240_932 220
304 3300048929 Ga0496126_0141281 Ga0496126_0141281_408_1103 220
305 3300050513 nmdc:mga0rr50_588152_c1 nmdc:mga0rr50_588152_c1_14_706 220
306 3300053105 Ga0500557_001651 Ga0500557_001651_1933_2628 220
307 3300053130 Ga0500642_0000057 Ga0500642_0000057_18097_18792 220
308 3300053729 Ga0500625_002930 Ga0500625_002930_3942_4637 220
309 iso_pu_bacteria 2791355199 2793084134 220
310 iso_pu_bacteria 8056673599 8056681018 220
311 3300033544 Ga0316215_1003920 Ga0316215_10039201 221
312 3300036459 Ga0372808_001591 Ga0372808_001591_633_1346 221
313 iso_pu_bacteria 2513237101 2513695809 221
314 iso_pu_bacteria 2874604998 2874607294 221
315 iso_pu_bacteria 8006994254 8006994810 221
316 3300005985 Ga0081539_10000113 Ga0081539_1000011353 222
317 3300031249 Ga0265339_10002027 Ga0265339_1000202711 222
318 3300031616 Ga0307508_10000249 Ga0307508_1000024916 222
319 3300046507 Ga0495606_0322119 Ga0495606_0322119_49_726 222
320 3300053077 Ga0495601_0148205 Ga0495601_0148205_375_1079 222
321 iso_pu_bacteria 8006964411 8006968362 222
322 iso_pu_bacteria 8006984368 8006989198 222
323 3300005331 Ga0070670_100700020 Ga0070670_1007000201 223
324 3300005341 Ga0070691_10116771 Ga0070691_101167712 223
325 3300005548 Ga0070665_100420931 Ga0070665_1004209312 223
326 3300005563 Ga0068855_101018964 Ga0068855_1010189641 223
327 3300009148 Ga0105243_10088683 Ga0105243_100886831 223
328 3300009553 Ga0105249_10196025 Ga0105249_101960251 223
329 3300013105 Ga0157369_10275996 Ga0157369_102759962 223
330 3300014968 Ga0157379_10365802 Ga0157379_103658022 223
331 3300025935 Ga0207709_10022516 Ga0207709_100225163 223
332 3300030863 Ga0265766_1004717 Ga0265766_10047171 223
333 3300031711 Ga0265314_10014031 Ga0265314_100140313 223
334 3300039438 Ga0436360_1009642 Ga0436360_1009642_107_811 223
335 3300046558 Ga0495633_0168187 Ga0495633_0168187_242_946 223
336 3300046684 Ga0495669_0001878 Ga0495669_0001878_7512_8216 223
337 3300046694 Ga0495649_0094642 Ga0495649_0094642_643_1347 223
338 3300047445 Ga0495677_0017120 Ga0495677_0017120_447_1151 223
339 3300048903 Ga0496100_0097636 Ga0496100_0097636_1184_1888 223
340 3300048904 Ga0496101_0163170 Ga0496101_0163170_626_1330 223
341 3300048905 Ga0496102_0133818 Ga0496102_0133818_313_1017 223
342 3300049586 Ga0501070_0614443 Ga0501070_0614443_52_759 223
343 3300050490 nmdc:mga03n38_45781_c1 nmdc:mga03n38_45781_c1_642_1346 223
344 3300002244 JGI24742J22300_10016348 JGI24742J22300_100163481 224
345 3300005328 Ga0070676_10220090 Ga0070676_102200901 224
346 3300005329 Ga0070683_100265873 Ga0070683_1002658732 224
347 3300005333 Ga0070677_10111798 Ga0070677_101117981 224
348 3300005338 Ga0068868_100287279 Ga0068868_1002872791 224
349 3300005340 Ga0070689_100235139 Ga0070689_1002351391 224
350 3300005344 Ga0070661_100256092 Ga0070661_1002560922 224
351 3300005347 Ga0070668_100097490 Ga0070668_1000974902 224
352 3300005355 Ga0070671_100040143 Ga0070671_1000401434 224
353 3300005356 Ga0070674_100195147 Ga0070674_1001951472 224
354 3300005367 Ga0070667_100053267 Ga0070667_1000532673 224
355 3300005456 Ga0070678_100117476 Ga0070678_1001174762 224
356 3300005456 Ga0070678_100301591 Ga0070678_1003015912 224
357 3300005457 Ga0070662_100035056 Ga0070662_1000350562 224
358 3300005530 Ga0070679_100681457 Ga0070679_1006814571 224
359 3300005563 Ga0068855_100474313 Ga0068855_1004743132 224
360 3300005564 Ga0070664_100583946 Ga0070664_1005839462 224
361 3300005578 Ga0068854_100129469 Ga0068854_1001294692 224
362 3300005616 Ga0068852_100626453 Ga0068852_1006264532 224
363 3300005718 Ga0068866_10146159 Ga0068866_101461592 224
364 3300005718 Ga0068866_10326683 Ga0068866_103266832 224
365 3300005834 Ga0068851_10042199 Ga0068851_100421992 224
366 3300005840 Ga0068870_10070972 Ga0068870_100709722 224
367 3300005843 Ga0068860_100190338 Ga0068860_1001903382 224
368 3300005844 Ga0068862_100391869 Ga0068862_1003918692 224
369 3300005937 Ga0081455_10060751 Ga0081455_100607511 224
370 3300005983 Ga0081540_1018689 Ga0081540_10186894 224
371 3300006042 Ga0075368_10051916 Ga0075368_100519162 224
372 3300006178 Ga0075367_10026278 Ga0075367_100262783 224
373 3300006186 Ga0075369_10067465 Ga0075369_100674652 224
374 3300006237 Ga0097621_100135110 Ga0097621_1001351102 224
375 3300006358 Ga0068871_100263951 Ga0068871_1002639512 224
376 3300006881 Ga0068865_100260196 Ga0068865_1002601962 224
377 3300009092 Ga0105250_10097006 Ga0105250_100970062 224
378 3300009098 Ga0105245_10209432 Ga0105245_102094322 224
379 3300009174 Ga0105241_10292233 Ga0105241_102922332 224
380 3300009176 Ga0105242_10225935 Ga0105242_102259352 224
381 3300009177 Ga0105248_10232856 Ga0105248_102328562 224
382 3300009545 Ga0105237_10439844 Ga0105237_104398442 224
383 3300011119 Ga0105246_10060031 Ga0105246_100600312 224
384 3300013296 Ga0157374_10088341 Ga0157374_100883412 224
385 3300013306 Ga0163162_10111361 Ga0163162_101113612 224
386 3300013306 Ga0163162_10337595 Ga0163162_103375952 224
387 3300013307 Ga0157372_10947817 Ga0157372_109478172 224
388 3300013308 Ga0157375_10581703 Ga0157375_105817031 224
389 3300014968 Ga0157379_10298324 Ga0157379_102983242 224
390 3300014969 Ga0157376_10008594 Ga0157376_100085947 224
391 3300017792 Ga0163161_10022770 Ga0163161_100227705 224
392 3300025899 Ga0207642_10119142 Ga0207642_101191421 224
393 3300025901 Ga0207688_10047639 Ga0207688_100476392 224
394 3300025901 Ga0207688_10127135 Ga0207688_101271352 224
395 3300025911 Ga0207654_10194199 Ga0207654_101941992 224
396 3300025919 Ga0207657_10310272 Ga0207657_103102722 224
397 3300025920 Ga0207649_10177172 Ga0207649_101771722 224
398 3300025927 Ga0207687_10044667 Ga0207687_100446672 224
399 3300025931 Ga0207644_10106269 Ga0207644_101062691 224
400 3300025932 Ga0207690_10230331 Ga0207690_102303312 224
401 3300025933 Ga0207706_10076024 Ga0207706_100760242 224
402 3300025936 Ga0207670_10244497 Ga0207670_102444972 224
403 3300025937 Ga0207669_10113998 Ga0207669_101139982 224
404 3300025940 Ga0207691_10344280 Ga0207691_103442802 224
405 3300025941 Ga0207711_10394178 Ga0207711_103941782 224
406 3300025949 Ga0207667_10574287 Ga0207667_105742872 224
407 3300025961 Ga0207712_10131060 Ga0207712_101310602 224
408 3300025972 Ga0207668_10116812 Ga0207668_101168122 224
409 3300026023 Ga0207677_10495634 Ga0207677_104956342 224
410 3300026067 Ga0207678_10077729 Ga0207678_100777292 224
411 3300026067 Ga0207678_10474669 Ga0207678_104746692 224
412 3300026067 Ga0207678_10508965 Ga0207678_105089652 224
413 3300026088 Ga0207641_10805848 Ga0207641_108058482 224
414 3300026089 Ga0207648_10234412 Ga0207648_102344122 224
415 3300026095 Ga0207676_10938721 Ga0207676_109387211 224
416 3300026121 Ga0207683_10055407 Ga0207683_100554072 224
417 3300026121 Ga0207683_10606486 Ga0207683_106064862 224
418 3300031456 Ga0307513_10160001 Ga0307513_101600012 224
419 3300032126 Ga0307415_100628855 Ga0307415_1006288552 224
420 3300041413 Ga0439465_0092680 Ga0439465_0092680_121_828 224
421 3300041512 Ga0451853_1916674 Ga0451853_1916674_174_878 224
422 3300046462 Ga0495651_0198724 Ga0495651_0198724_548_1252 224
423 3300046539 Ga0495621_0072084 Ga0495621_0072084_500_1207 224
424 3300046558 Ga0495633_0177272 Ga0495633_0177272_204_911 224
425 3300046615 Ga0495656_0127132 Ga0495656_0127132_462_1169 224
426 3300046616 Ga0495668_0046611 Ga0495668_0046611_309_1016 224
427 3300046616 Ga0495668_0207276 Ga0495668_0207276_235_939 224
428 3300046684 Ga0495669_0214743 Ga0495669_0214743_94_801 224
429 3300046691 Ga0495670_0283774 Ga0495670_0283774_65_772 224
430 3300047320 Ga0495672_0072363 Ga0495672_0072363_374_1081 224
431 3300047320 Ga0495672_0096380 Ga0495672_0096380_899_1603 224
432 3300047472 Ga0495686_0234383 Ga0495686_0234383_110_817 224
433 3300047673 Ga0495593_0054177 Ga0495593_0054177_872_1579 224
434 3300048090 Ga0495615_0037754 Ga0495615_0037754_368_1075 224
435 3300048903 Ga0496100_0047643 Ga0496100_0047643_746_1456 224
436 3300048903 Ga0496100_0529006 Ga0496100_0529006_16_723 224
437 3300048904 Ga0496101_0006609 Ga0496101_0006609_1158_1868 224
438 3300048904 Ga0496101_0252853 Ga0496101_0252853_468_1175 224
439 3300048905 Ga0496102_0083160 Ga0496102_0083160_1986_2696 224
440 3300048907 Ga0496104_0008421 Ga0496104_0008421_3291_4001 224
441 3300048908 Ga0496105_0061759 Ga0496105_0061759_507_1217 224
442 3300048909 Ga0496106_0006503 Ga0496106_0006503_7622_8332 224
443 3300048910 Ga0496107_0019745 Ga0496107_0019745_3145_3855 224
444 3300048910 Ga0496107_0364426 Ga0496107_0364426_38_745 224
445 3300048911 Ga0496108_0277701 Ga0496108_0277701_357_1067 224
446 3300048913 Ga0496110_0117351 Ga0496110_0117351_1367_2077 224
447 3300048913 Ga0496110_0238866 Ga0496110_0238866_187_894 224
448 3300048914 Ga0496111_0058971 Ga0496111_0058971_88_798 224
449 3300048916 Ga0496113_0122738 Ga0496113_0122738_347_1057 224
450 3300048917 Ga0496114_0034287 Ga0496114_0034287_3278_3988 224
451 3300048918 Ga0496115_0001082 Ga0496115_0001082_1720_2430 224
452 3300048925 Ga0496122_0014132 Ga0496122_0014132_6912_7622 224
453 3300048929 Ga0496126_0038456 Ga0496126_0038456_120_830 224
454 3300048929 Ga0496126_0433651 Ga0496126_0433651_237_944 224
455 3300049824 Ga0501045_0231428 Ga0501045_0231428_230_937 224
456 3300050490 nmdc:mga03n38_72315_c1 nmdc:mga03n38_72315_c1_469_1176 224
457 3300050494 nmdc:mga06z11_240560_c1 nmdc:mga06z11_240560_c1_200_907 224
458 3300050511 nmdc:mga08y16_492555_c1 nmdc:mga08y16_492555_c1_185_895 224
459 3300050516 nmdc:mga0sz30_144776_c1 nmdc:mga0sz30_144776_c1_132_839 224
460 3300053096 Ga0500641_0023473 Ga0500641_0023473_213_920 224
461 3300003215 JGI25153J46596_10002094 JGI25153J46596_100020944 225
462 3300005436 Ga0070713_100162789 Ga0070713_1001627892 225
463 3300005548 Ga0070665_100090409 Ga0070665_1000904093 225
464 3300005718 Ga0068866_10466703 Ga0068866_104667031 225
465 3300005937 Ga0081455_10057793 Ga0081455_100577932 225
466 3300005937 Ga0081455_10472183 Ga0081455_104721831 225
467 3300005985 Ga0081539_10039747 Ga0081539_100397473 225
468 3300006028 Ga0070717_10825047 Ga0070717_108250471 225
469 3300006042 Ga0075368_10186359 Ga0075368_101863591 225
470 3300006048 Ga0075363_100138607 Ga0075363_1001386072 225
471 3300006177 Ga0075362_10010927 Ga0075362_100109274 225
472 3300006195 Ga0075366_10276803 Ga0075366_102768032 225
473 3300013297 Ga0157378_10009387 Ga0157378_100093876 225
474 3300025297 Ga0209758_1007006 Ga0209758_10070065 225
475 3300025915 Ga0207693_10008179 Ga0207693_100081796 225
476 3300025928 Ga0207700_10071868 Ga0207700_100718683 225
477 3300026067 Ga0207678_10095176 Ga0207678_100951762 225
478 3300026067 Ga0207678_10109551 Ga0207678_101095512 225
479 3300026142 Ga0207698_10930600 Ga0207698_109306001 225
480 3300027866 Ga0209813_10124070 Ga0209813_101240702 225
481 3300028379 Ga0268266_10283021 Ga0268266_102830212 225
482 3300028786 Ga0307517_10001507 Ga0307517_1000150711 225
483 3300031711 Ga0265314_10048593 Ga0265314_100485932 225
484 3300046459 Ga0495629_0045299 Ga0495629_0045299_1939_2649 225
485 3300046471 Ga0495650_0055945 Ga0495650_0055945_217_924 225
486 3300046518 Ga0495631_0170169 Ga0495631_0170169_93_803 225
487 3300046615 Ga0495656_0107535 Ga0495656_0107535_413_1123 225
488 3300048907 Ga0496104_0480999 Ga0496104_0480999_388_1098 225
489 3300048918 Ga0496115_0385966 Ga0496115_0385966_273_983 225
490 3300048922 Ga0496119_0111262 Ga0496119_0111262_226_933 225
491 3300049583 Ga0501067_0029147 Ga0501067_0029147_128_838 225
492 3300049587 Ga0501071_0175580 Ga0501071_0175580_775_1485 225
493 3300053147 Ga0500589_085098 Ga0500589_085098_187_897 225
494 3300060346 Ga0587111_0024083 Ga0587111_0024083_178_888 225
495 3300001989 JGI24739J22299_10001037 JGI24739J22299_100010374 226
496 3300001990 JGI24737J22298_10001787 JGI24737J22298_100017878 226
497 3300005334 Ga0068869_100158664 Ga0068869_1001586642 226
498 3300005335 Ga0070666_10175194 Ga0070666_101751942 226
499 3300005337 Ga0070682_100116467 Ga0070682_1001164672 226
500 3300005340 Ga0070689_100308544 Ga0070689_1003085442 226
501 3300005347 Ga0070668_100023792 Ga0070668_1000237922 226
502 3300005347 Ga0070668_100174605 Ga0070668_1001746052 226
503 3300005353 Ga0070669_100155575 Ga0070669_1001555752 226
504 3300005353 Ga0070669_100324730 Ga0070669_1003247302 226
505 3300005355 Ga0070671_100068060 Ga0070671_1000680602 226
506 3300005356 Ga0070674_100573592 Ga0070674_1005735922 226
507 3300005367 Ga0070667_100124352 Ga0070667_1001243522 226
508 3300005406 Ga0070703_10041790 Ga0070703_100417902 226
509 3300005438 Ga0070701_10080884 Ga0070701_100808842 226
510 3300005440 Ga0070705_100048404 Ga0070705_1000484042 226
511 3300005441 Ga0070700_100072913 Ga0070700_1000729132 226
512 3300005455 Ga0070663_100010640 Ga0070663_1000106405 226
513 3300005455 Ga0070663_100044846 Ga0070663_1000448462 226
514 3300005455 Ga0070663_100198687 Ga0070663_1001986872 226
515 3300005456 Ga0070678_100304945 Ga0070678_1003049452 226
516 3300005456 Ga0070678_100358655 Ga0070678_1003586552 226
517 3300005457 Ga0070662_100092022 Ga0070662_1000920222 226
518 3300005457 Ga0070662_100122315 Ga0070662_1001223152 226
519 3300005458 Ga0070681_10026475 Ga0070681_100264753 226
520 3300005459 Ga0068867_100637118 Ga0068867_1006371181 226
521 3300005471 Ga0070698_100496964 Ga0070698_1004969642 226
522 3300005539 Ga0068853_100031622 Ga0068853_1000316222 226
523 3300005539 Ga0068853_100107416 Ga0068853_1001074162 226
524 3300005548 Ga0070665_100277043 Ga0070665_1002770432 226
525 3300005548 Ga0070665_100429234 Ga0070665_1004292342 226
526 3300005549 Ga0070704_100335799 Ga0070704_1003357992 226
527 3300005549 Ga0070704_100416330 Ga0070704_1004163302 226
528 3300005563 Ga0068855_100022161 Ga0068855_1000221615 226
529 3300005563 Ga0068855_100083223 Ga0068855_1000832233 226
530 3300005577 Ga0068857_100023313 Ga0068857_1000233132 226
531 3300005578 Ga0068854_100003845 Ga0068854_1000038454 226
532 3300005614 Ga0068856_100011815 Ga0068856_1000118154 226
533 3300005614 Ga0068856_100026604 Ga0068856_1000266042 226
534 3300005615 Ga0070702_100198995 Ga0070702_1001989952 226
535 3300005616 Ga0068852_100002580 Ga0068852_1000025809 226
536 3300005616 Ga0068852_100538403 Ga0068852_1005384032 226
537 3300005617 Ga0068859_100039596 Ga0068859_1000395964 226
538 3300005617 Ga0068859_100116649 Ga0068859_1001166494 226
539 3300005618 Ga0068864_100012188 Ga0068864_1000121882 226
540 3300005618 Ga0068864_100344220 Ga0068864_1003442202 226
541 3300005719 Ga0068861_100141288 Ga0068861_1001412882 226
542 3300005834 Ga0068851_10010036 Ga0068851_100100365 226
543 3300005834 Ga0068851_10059289 Ga0068851_100592892 226
544 3300005840 Ga0068870_10048002 Ga0068870_100480022 226
545 3300005841 Ga0068863_100075669 Ga0068863_1000756694 226
546 3300005842 Ga0068858_100233873 Ga0068858_1002338732 226
547 3300005842 Ga0068858_100385329 Ga0068858_1003853291 226
548 3300005843 Ga0068860_100108861 Ga0068860_1001088612 226
549 3300005843 Ga0068860_100375687 Ga0068860_1003756872 226
550 3300005843 Ga0068860_100379761 Ga0068860_1003797612 226
551 3300005844 Ga0068862_100070369 Ga0068862_1000703692 226
552 3300005844 Ga0068862_100118140 Ga0068862_1001181402 226
553 3300005844 Ga0068862_100649480 Ga0068862_1006494802 226
554 3300005983 Ga0081540_1000575 Ga0081540_10005756 226
555 3300005983 Ga0081540_1012391 Ga0081540_10123915 226
556 3300005983 Ga0081540_1023497 Ga0081540_10234973 226
557 3300005983 Ga0081540_1034892 Ga0081540_10348922 226
558 3300005983 Ga0081540_1074758 Ga0081540_10747582 226
559 3300006038 Ga0075365_10024932 Ga0075365_100249322 226
560 3300006038 Ga0075365_10050581 Ga0075365_100505814 226
561 3300006042 Ga0075368_10083503 Ga0075368_100835032 226
562 3300006177 Ga0075362_10014438 Ga0075362_100144384 226
563 3300006178 Ga0075367_10138782 Ga0075367_101387822 226
564 3300006195 Ga0075366_10039208 Ga0075366_100392082 226
565 3300006195 Ga0075366_10107024 Ga0075366_101070242 226
566 3300006358 Ga0068871_100095962 Ga0068871_1000959622 226
567 3300006844 Ga0075428_100190956 Ga0075428_1001909562 226
568 3300006847 Ga0075431_100439372 Ga0075431_1004393722 226
569 3300006914 Ga0075436_100163073 Ga0075436_1001630732 226
570 3300006931 Ga0097620_100039598 Ga0097620_1000395984 226
571 3300006931 Ga0097620_100116651 Ga0097620_1001166514 226
572 3300007788 Ga0099795_10092135 Ga0099795_100921352 226
573 3300009093 Ga0105240_10082005 Ga0105240_100820054 226
574 3300009093 Ga0105240_10141161 Ga0105240_101411612 226
575 3300009098 Ga0105245_10126611 Ga0105245_101266113 226
576 3300009101 Ga0105247_10123500 Ga0105247_101235002 226
577 3300009101 Ga0105247_10197944 Ga0105247_101979442 226
578 3300009147 Ga0114129_10631316 Ga0114129_106313162 226
579 3300009148 Ga0105243_10120222 Ga0105243_101202222 226
580 3300009174 Ga0105241_10001401 Ga0105241_1000140114 226
581 3300009174 Ga0105241_10046934 Ga0105241_100469342 226
582 3300009177 Ga0105248_10184198 Ga0105248_101841982 226
583 3300009545 Ga0105237_10058881 Ga0105237_100588813 226
584 3300009545 Ga0105237_10598622 Ga0105237_105986222 226
585 3300009551 Ga0105238_10006652 Ga0105238_100066525 226
586 3300009551 Ga0105238_10011666 Ga0105238_100116666 226
587 3300009553 Ga0105249_10314377 Ga0105249_103143772 226
588 3300009553 Ga0105249_11088917 Ga0105249_110889172 226
589 3300010375 Ga0105239_10004659 Ga0105239_100046592 226
590 3300010375 Ga0105239_10133836 Ga0105239_101338362 226
591 3300011119 Ga0105246_10140977 Ga0105246_101409772 226
592 3300013296 Ga0157374_10292096 Ga0157374_102920962 226
593 3300013296 Ga0157374_10450379 Ga0157374_104503792 226
594 3300013297 Ga0157378_10267217 Ga0157378_102672172 226
595 3300013306 Ga0163162_10183755 Ga0163162_101837552 226
596 3300013306 Ga0163162_11365129 Ga0163162_113651292 226
597 3300014745 Ga0157377_10082014 Ga0157377_100820142 226
598 3300014968 Ga0157379_10109480 Ga0157379_101094802 226
599 3300014968 Ga0157379_10431000 Ga0157379_104310001 226
600 3300025297 Ga0209758_1012541 Ga0209758_10125412 226
601 3300025321 Ga0207656_10008182 Ga0207656_100081823 226
602 3300025885 Ga0207653_10004937 Ga0207653_100049372 226
603 3300025901 Ga0207688_10018719 Ga0207688_100187192 226
604 3300025901 Ga0207688_10059448 Ga0207688_100594482 226
605 3300025904 Ga0207647_10000674 Ga0207647_1000067422 226
606 3300025908 Ga0207643_10045737 Ga0207643_100457372 226
607 3300025911 Ga0207654_10000411 Ga0207654_1000041118 226
608 3300025911 Ga0207654_10252539 Ga0207654_102525392 226
609 3300025913 Ga0207695_10000424 Ga0207695_1000042452 226
610 3300025913 Ga0207695_10057665 Ga0207695_100576652 226
611 3300025914 Ga0207671_10012559 Ga0207671_100125592 226
612 3300025914 Ga0207671_10415587 Ga0207671_104155872 226
613 3300025920 Ga0207649_10561136 Ga0207649_105611362 226
614 3300025923 Ga0207681_10311617 Ga0207681_103116172 226
615 3300025923 Ga0207681_10433971 Ga0207681_104339712 226
616 3300025924 Ga0207694_10000347 Ga0207694_1000034719 226
617 3300025924 Ga0207694_10032322 Ga0207694_100323224 226
618 3300025927 Ga0207687_10059786 Ga0207687_100597863 226
619 3300025931 Ga0207644_10335423 Ga0207644_103354232 226
620 3300025933 Ga0207706_10095998 Ga0207706_100959982 226
621 3300025933 Ga0207706_10132071 Ga0207706_101320712 226
622 3300025935 Ga0207709_10224329 Ga0207709_102243292 226
623 3300025936 Ga0207670_10355988 Ga0207670_103559882 226
624 3300025937 Ga0207669_10173836 Ga0207669_101738362 226
625 3300025942 Ga0207689_10027970 Ga0207689_100279702 226
626 3300025942 Ga0207689_10033587 Ga0207689_100335872 226
627 3300025942 Ga0207689_10152292 Ga0207689_101522922 226
628 3300025949 Ga0207667_10012216 Ga0207667_100122168 226
629 3300025949 Ga0207667_10208918 Ga0207667_102089183 226
630 3300025960 Ga0207651_10146138 Ga0207651_101461382 226
631 3300025981 Ga0207640_10021552 Ga0207640_100215521 226
632 3300025981 Ga0207640_10034597 Ga0207640_100345972 226
633 3300025986 Ga0207658_10114458 Ga0207658_101144582 226
634 3300026023 Ga0207677_10059246 Ga0207677_100592462 226
635 3300026035 Ga0207703_10117760 Ga0207703_101177602 226
636 3300026035 Ga0207703_10127478 Ga0207703_101274782 226
637 3300026041 Ga0207639_10041076 Ga0207639_100410763 226
638 3300026067 Ga0207678_10091798 Ga0207678_100917982 226
639 3300026067 Ga0207678_10100719 Ga0207678_101007192 226
640 3300026067 Ga0207678_10319696 Ga0207678_103196962 226
641 3300026075 Ga0207708_10218688 Ga0207708_102186882 226
642 3300026078 Ga0207702_10000002 Ga0207702_1000000286 226
643 3300026078 Ga0207702_10011407 Ga0207702_100114074 226
644 3300026078 Ga0207702_10149452 Ga0207702_101494522 226
645 3300026089 Ga0207648_10176716 Ga0207648_101767162 226
646 3300026095 Ga0207676_10545255 Ga0207676_105452551 226
647 3300026116 Ga0207674_10009561 Ga0207674_100095616 226
648 3300026116 Ga0207674_10168213 Ga0207674_101682132 226
649 3300026118 Ga0207675_100187275 Ga0207675_1001872752 226
650 3300026121 Ga0207683_10327426 Ga0207683_103274262 226
651 3300026142 Ga0207698_10028115 Ga0207698_100281152 226
652 3300026142 Ga0207698_10143341 Ga0207698_101433412 226
653 3300028380 Ga0268265_10026044 Ga0268265_100260442 226
654 3300028380 Ga0268265_10089976 Ga0268265_100899762 226
655 3300028380 Ga0268265_10274083 Ga0268265_102740832 226
656 3300028381 Ga0268264_10159180 Ga0268264_101591802 226
657 3300030521 Ga0307511_10131200 Ga0307511_101312002 226
658 3300031456 Ga0307513_10202539 Ga0307513_102025392 226
659 3300031824 Ga0307413_10026093 Ga0307413_100260933 226
660 3300031901 Ga0307406_10170831 Ga0307406_101708312 226
661 3300031903 Ga0307407_10186701 Ga0307407_101867012 226
662 3300031911 Ga0307412_10025793 Ga0307412_100257934 226
663 3300031911 Ga0307412_10199695 Ga0307412_101996952 226
664 3300031995 Ga0307409_100170998 Ga0307409_1001709982 226
665 3300032002 Ga0307416_100080534 Ga0307416_1000805343 226
666 3300032005 Ga0307411_10076487 Ga0307411_100764873 226
667 3300032126 Ga0307415_100139282 Ga0307415_1001392822 226
668 3300033180 Ga0307510_10175299 Ga0307510_101752992 226
669 3300041463 Ga0451804_0890762 Ga0451804_0890762_57_770 226
670 3300046452 Ga0495617_049104 Ga0495617_049104_210_923 226
671 3300046457 Ga0495590_0014239 Ga0495590_0014239_887_1600 226
672 3300046460 Ga0495638_0023480 Ga0495638_0023480_2213_2926 226
673 3300046471 Ga0495650_0051836 Ga0495650_0051836_583_1296 226
674 3300046473 Ga0495582_0199011 Ga0495582_0199011_192_905 226
675 3300046474 Ga0495605_0062814 Ga0495605_0062814_603_1316 226
676 3300046491 Ga0495584_0035337 Ga0495584_0035337_1305_2018 226
677 3300046492 Ga0495585_0064445 Ga0495585_0064445_213_926 226
678 3300046499 Ga0495594_0214838 Ga0495594_0214838_193_903 226
679 3300046500 Ga0495596_0017806 Ga0495596_0017806_803_1516 226
680 3300046507 Ga0495606_0038140 Ga0495606_0038140_1932_2645 226
681 3300046512 Ga0495610_0031329 Ga0495610_0031329_747_1460 226
682 3300046513 Ga0495616_0019622 Ga0495616_0019622_1287_2000 226
683 3300046522 Ga0495643_0089804 Ga0495643_0089804_409_1122 226
684 3300046523 Ga0495644_0085417 Ga0495644_0085417_271_981 226
685 3300046523 Ga0495644_0177550 Ga0495644_0177550_25_738 226
686 3300046528 Ga0495642_0022245 Ga0495642_0022245_601_1314 226
687 3300046530 Ga0495654_0057989 Ga0495654_0057989_632_1345 226
688 3300046538 Ga0495609_0023003 Ga0495609_0023003_761_1474 226
689 3300046539 Ga0495621_0157055 Ga0495621_0157055_167_877 226
690 3300046558 Ga0495633_0031508 Ga0495633_0031508_804_1517 226
691 3300046615 Ga0495656_0200272 Ga0495656_0200272_249_959 226
692 3300046616 Ga0495668_0055740 Ga0495668_0055740_426_1139 226
693 3300046648 Ga0495611_0014614 Ga0495611_0014614_2180_2893 226
694 3300046660 Ga0495625_0065754 Ga0495625_0065754_1001_1714 226
695 3300046664 Ga0495659_0057282 Ga0495659_0057282_342_1052 226
696 3300046684 Ga0495669_0023843 Ga0495669_0023843_837_1550 226
697 3300046691 Ga0495670_0081849 Ga0495670_0081849_874_1584 226
698 3300046694 Ga0495649_0090648 Ga0495649_0090648_532_1245 226
699 3300047320 Ga0495672_0241082 Ga0495672_0241082_92_805 226
700 3300047323 Ga0495683_0037174 Ga0495683_0037174_611_1324 226
701 3300047445 Ga0495677_0028231 Ga0495677_0028231_302_1015 226
702 3300047469 Ga0495673_0053938 Ga0495673_0053938_118_831 226
703 3300047472 Ga0495686_0175993 Ga0495686_0175993_133_846 226
704 3300048091 Ga0495626_0019232 Ga0495626_0019232_1932_2645 226
705 3300048911 Ga0496108_0067630 Ga0496108_0067630_963_1676 226
706 3300048913 Ga0496110_0243092 Ga0496110_0243092_495_1208 226
707 3300048914 Ga0496111_0530763 Ga0496111_0530763_125_838 226
708 3300048920 Ga0496117_0160149 Ga0496117_0160149_452_1165 226
709 3300048922 Ga0496119_0167280 Ga0496119_0167280_32_745 226
710 3300048923 Ga0496120_0128661 Ga0496120_0128661_110_823 226
711 3300048924 Ga0496121_0028398 Ga0496121_0028398_417_1130 226
712 3300048924 Ga0496121_0149409 Ga0496121_0149409_331_1044 226
713 3300048927 Ga0496124_0144905 Ga0496124_0144905_989_1702 226
714 3300048927 Ga0496124_0464134 Ga0496124_0464134_33_746 226
715 3300048928 Ga0496125_0050051 Ga0496125_0050051_1044_1757 226
716 3300048928 Ga0496125_0122043 Ga0496125_0122043_1104_1817 226
717 3300048928 Ga0496125_0302923 Ga0496125_0302923_32_745 226
718 3300048929 Ga0496126_0002195 Ga0496126_0002195_440_1153 226
719 3300048929 Ga0496126_0246766 Ga0496126_0246766_529_1242 226
720 3300050489 nmdc:mga03683_203959_c1 nmdc:mga03683_203959_c1_155_868 226
721 3300050492 nmdc:mga0yw44_167115_c1 nmdc:mga0yw44_167115_c1_563_1276 226
722 3300050492 nmdc:mga0yw44_30604_c1 nmdc:mga0yw44_30604_c1_1927_2640 226
723 3300050492 nmdc:mga0yw44_4648_c1 nmdc:mga0yw44_4648_c1_2772_3485 226
724 3300050493 nmdc:mga0k408_78564_c1 nmdc:mga0k408_78564_c1_508_1221 226
725 3300050493 nmdc:mga0k408_8031_c1 nmdc:mga0k408_8031_c1_1585_2298 226
726 3300050508 nmdc:mga09592_183634_c1 nmdc:mga09592_183634_c1_59_772 226
727 3300050512 nmdc:mga0n895_197525_c1 nmdc:mga0n895_197525_c1_163_876 226
728 3300050514 nmdc:mga08x19_201358_c1 nmdc:mga08x19_201358_c1_46_759 226
729 3300050516 nmdc:mga0sz30_1617_c1 nmdc:mga0sz30_1617_c1_2538_3251 226
730 3300053079 Ga0500610_0185895 Ga0500610_0185895_155_868 226
731 3300053083 Ga0495655_0003619 Ga0495655_0003619_706_1419 226
732 3300053086 Ga0500578_0051516 Ga0500578_0051516_227_940 226
733 3300053087 Ga0500643_034252 Ga0500643_034252_460_1173 226
734 3300053092 Ga0500583_0058527 Ga0500583_0058527_250_963 226
735 3300053104 Ga0500556_0096440 Ga0500556_0096440_139_852 226
736 3300053109 Ga0500569_051451 Ga0500569_051451_388_1101 226
737 3300053119 Ga0500595_009426 Ga0500595_009426_1757_2470 226
738 3300053137 Ga0500561_0032027 Ga0500561_0032027_161_874 226
739 3300053142 Ga0500577_0045176 Ga0500577_0045176_703_1416 226
740 3300053143 Ga0500579_105193 Ga0500579_105193_144_857 226
741 3300053148 Ga0500590_109946 Ga0500590_109946_170_883 226
742 3300053150 Ga0500603_084254 Ga0500603_084254_70_783 226
743 3300053158 Ga0500627_0053283 Ga0500627_0053283_206_919 226
744 3300053178 Ga0500637_0113806 Ga0500637_0113806_561_1274 226
745 3300053732 Ga0500656_007310 Ga0500656_007310_209_922 226
746 3300059510 Ga0587090_021918 Ga0587090_021918_177_890 226

Feature Viewer

pLDDT pTM Quality
67.87 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map