F478852
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 443 | 652 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1000575|Ga0081540_10005756 |
| Length | 239 |
| Sequence | MMAANRQMLDQEPSEIEMLLPFHAAGTLSARDARRVEDALAGDPELARQYAVIREEYAETISLNETLGAPSARAMQKLFAAIEAEPERKPSRSVRLSAKVSEFFARMSPRTLAWSASLGAAALLLQAGVIGAVLMSKQTSSFETASLSLNEPSSPAAPITRDLGVSAAPPRALVRFAPEARVADITALLDNYQASIIDGAKGGMFRLQFGNKAMGKDEAASLLSRLQREKIVGLAVATP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 6 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 7 | 2791355199 | |||
| 8 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 9 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 10 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 11 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 12 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 13 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 14 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 15 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 16 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 17 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 18 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 19 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 20 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 21 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 22 | 2922368715 | |||
| 23 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 24 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 25 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 26 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 27 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 28 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 29 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 30 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 31 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 32 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 33 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 34 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 35 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 36 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 37 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 38 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 39 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 40 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 41 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 42 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 43 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 44 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 45 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 46 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 47 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 48 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 49 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 50 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 51 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 52 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 53 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 54 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 55 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 56 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 57 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 58 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 59 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 60 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 61 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 62 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 63 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 64 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 65 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 66 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 67 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 68 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 69 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 70 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 74 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 79 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 83 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 101 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 108 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 110 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 111 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 112 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 114 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 115 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 116 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 117 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 118 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 119 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 120 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 127 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 129 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 130 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 131 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 132 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 133 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 134 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 135 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 139 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 140 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 143 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 170 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 230 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 231 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 241 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 246 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 252 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 255 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 257 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 344 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 345 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 346 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 347 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 348 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 360 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 361 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 362 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 391 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 392 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 396 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 401 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 402 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 403 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 404 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 410 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 412 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 413 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 414 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 417 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 418 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 419 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 420 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 421 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 422 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 423 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 424 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 425 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 426 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 427 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 428 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 429 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 430 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 431 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 432 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 433 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 434 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 435 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 436 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 437 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 438 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 439 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 440 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 441 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 442 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 443 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.1 |
| Metatranscriptomes | 0.54 |
| Isolates | 12.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.05 |
| Nodule | 10.59 |
| Rhizoplane | 6.17 |
| Rhizosphere | 64.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001037 | 3300001989 | Bacteria | 10296 |
| 2 | JGI24737J22298_10001787 | 3300001990 | Bacteria | 7698 |
| 3 | JGI24742J22300_10016348 | 3300002244 | Bacteria | 1252 |
| 4 | JGI25153J46596_10002094 | 3300003215 | Bacteria | 11718 |
| 5 | JGI25153J46596_10016218 | 3300003215 | Bacteria | 2996 |
| 6 | Ga0055542_1023569 | 3300003762 | Bacteria | 862 |
| 7 | Ga0065165_1001679 | 3300005262 | Bacteria | 22393 |
| 8 | Ga0070676_10220090 | 3300005328 | Bacteria | 1253 |
| 9 | Ga0070683_100153824 | 3300005329 | Bacteria | 2181 |
| 10 | Ga0070683_100265873 | 3300005329 | Bacteria | 1631 |
| 11 | Ga0070670_100700020 | 3300005331 | Bacteria | 911 |
| 12 | Ga0070677_10111798 | 3300005333 | Bacteria | 1220 |
| 13 | Ga0068869_100158664 | 3300005334 | Bacteria | 1759 |
| 14 | Ga0070666_10175194 | 3300005335 | Bacteria | 1503 |
| 15 | Ga0070680_100036060 | 3300005336 | Bacteria | 3995 |
| 16 | Ga0070680_100393738 | 3300005336 | Bacteria | 1180 |
| 17 | Ga0070682_100116467 | 3300005337 | Bacteria | 1788 |
| 18 | Ga0070682_100512492 | 3300005337 | Bacteria | 932 |
| 19 | Ga0068868_100284394 | 3300005338 | Bacteria | 1401 |
| 20 | Ga0068868_100287279 | 3300005338 | Bacteria | 1394 |
| 21 | Ga0070689_100235139 | 3300005340 | Bacteria | 1507 |
| 22 | Ga0070689_100308544 | 3300005340 | Bacteria | 1319 |
| 23 | Ga0070691_10116771 | 3300005341 | Bacteria | 1340 |
| 24 | Ga0070691_10260897 | 3300005341 | Bacteria | 933 |
| 25 | Ga0070661_100256092 | 3300005344 | Bacteria | 1352 |
| 26 | Ga0070668_100023792 | 3300005347 | Bacteria | 4636 |
| 27 | Ga0070668_100074203 | 3300005347 | Bacteria | 2653 |
| 28 | Ga0070668_100097490 | 3300005347 | Bacteria | 2325 |
| 29 | Ga0070668_100174605 | 3300005347 | Bacteria | 1751 |
| 30 | Ga0070669_100155575 | 3300005353 | Bacteria | 1772 |
| 31 | Ga0070669_100324730 | 3300005353 | Bacteria | 1243 |
| 32 | Ga0070671_100040143 | 3300005355 | Bacteria | 3886 |
| 33 | Ga0070671_100068060 | 3300005355 | Bacteria | 2969 |
| 34 | Ga0070674_100195147 | 3300005356 | Bacteria | 1559 |
| 35 | Ga0070674_100573592 | 3300005356 | Bacteria | 950 |
| 36 | Ga0070667_100053267 | 3300005367 | Bacteria | 3415 |
| 37 | Ga0070667_100124352 | 3300005367 | Bacteria | 2247 |
| 38 | Ga0070703_10041790 | 3300005406 | Bacteria | 1431 |
| 39 | Ga0070713_100162789 | 3300005436 | Bacteria | 1993 |
| 40 | Ga0070701_10080884 | 3300005438 | Bacteria | 1758 |
| 41 | Ga0070705_100048404 | 3300005440 | Bacteria | 2463 |
| 42 | Ga0070700_100072913 | 3300005441 | Bacteria | 2196 |
| 43 | Ga0070663_100010640 | 3300005455 | Bacteria | 5739 |
| 44 | Ga0070663_100035903 | 3300005455 | Bacteria | 3441 |
| 45 | Ga0070663_100044846 | 3300005455 | Bacteria | 3120 |
| 46 | Ga0070663_100198687 | 3300005455 | Bacteria | 1564 |
| 47 | Ga0070678_100117476 | 3300005456 | Bacteria | 2092 |
| 48 | Ga0070678_100301591 | 3300005456 | Bacteria | 1361 |
| 49 | Ga0070678_100304945 | 3300005456 | Bacteria | 1354 |
| 50 | Ga0070678_100358655 | 3300005456 | Bacteria | 1255 |
| 51 | Ga0070662_100035056 | 3300005457 | Bacteria | 3541 |
| 52 | Ga0070662_100092022 | 3300005457 | Bacteria | 2278 |
| 53 | Ga0070662_100122315 | 3300005457 | Bacteria | 1996 |
| 54 | Ga0070662_100280027 | 3300005457 | Bacteria | 1349 |
| 55 | Ga0070681_10026475 | 3300005458 | Bacteria | 5828 |
| 56 | Ga0070681_10088485 | 3300005458 | Bacteria | 3048 |
| 57 | Ga0068867_100637118 | 3300005459 | Bacteria | 934 |
| 58 | Ga0070698_100496964 | 3300005471 | Bacteria | 1158 |
| 59 | Ga0070679_100332109 | 3300005530 | Bacteria | 1469 |
| 60 | Ga0070679_100681457 | 3300005530 | Bacteria | 971 |
| 61 | Ga0070684_100005320 | 3300005535 | Bacteria | 9856 |
| 62 | Ga0068853_100031622 | 3300005539 | Bacteria | 4477 |
| 63 | Ga0068853_100107416 | 3300005539 | Bacteria | 2475 |
| 64 | Ga0068853_100228520 | 3300005539 | Bacteria | 1701 |
| 65 | Ga0070665_100084978 | 3300005548 | Bacteria | 3169 |
| 66 | Ga0070665_100090409 | 3300005548 | Bacteria | 3067 |
| 67 | Ga0070665_100277043 | 3300005548 | Bacteria | 1679 |
| 68 | Ga0070665_100420931 | 3300005548 | Bacteria | 1344 |
| 69 | Ga0070665_100429234 | 3300005548 | Bacteria | 1330 |
| 70 | Ga0070704_100335799 | 3300005549 | Bacteria | 1271 |
| 71 | Ga0070704_100416330 | 3300005549 | Bacteria | 1150 |
| 72 | Ga0068855_100022161 | 3300005563 | Bacteria | 7612 |
| 73 | Ga0068855_100083223 | 3300005563 | Bacteria | 3707 |
| 74 | Ga0068855_100239207 | 3300005563 | Bacteria | 2029 |
| 75 | Ga0068855_100474313 | 3300005563 | Bacteria | 1363 |
| 76 | Ga0068855_101018964 | 3300005563 | Bacteria | 869 |
| 77 | Ga0070664_100530161 | 3300005564 | Bacteria | 1088 |
| 78 | Ga0070664_100583946 | 3300005564 | Bacteria | 1035 |
| 79 | Ga0068857_100023313 | 3300005577 | Bacteria | 5447 |
| 80 | Ga0068854_100003845 | 3300005578 | Bacteria | 9407 |
| 81 | Ga0068854_100030788 | 3300005578 | Bacteria | 3724 |
| 82 | Ga0068854_100129469 | 3300005578 | Bacteria | 1925 |
| 83 | Ga0068856_100011815 | 3300005614 | Bacteria | 8463 |
| 84 | Ga0068856_100026604 | 3300005614 | Bacteria | 5641 |
| 85 | Ga0068856_100461069 | 3300005614 | Bacteria | 1292 |
| 86 | Ga0068856_101219260 | 3300005614 | Bacteria | 769 |
| 87 | Ga0070702_100198995 | 3300005615 | Bacteria | 1325 |
| 88 | Ga0068852_100002580 | 3300005616 | Bacteria | 12500 |
| 89 | Ga0068852_100017943 | 3300005616 | Bacteria | 5565 |
| 90 | Ga0068852_100538403 | 3300005616 | Bacteria | 1167 |
| 91 | Ga0068852_100626453 | 3300005616 | Bacteria | 1082 |
| 92 | Ga0068859_100039596 | 3300005617 | Bacteria | 4728 |
| 93 | Ga0068859_100116649 | 3300005617 | Bacteria | 2735 |
| 94 | Ga0068864_100012188 | 3300005618 | Bacteria | 7106 |
| 95 | Ga0068864_100321795 | 3300005618 | Bacteria | 1453 |
| 96 | Ga0068864_100344220 | 3300005618 | Bacteria | 1405 |
| 97 | Ga0068866_10146159 | 3300005718 | Bacteria | 1363 |
| 98 | Ga0068866_10326683 | 3300005718 | Bacteria | 967 |
| 99 | Ga0068866_10466703 | 3300005718 | Bacteria | 829 |
| 100 | Ga0068861_100141288 | 3300005719 | Bacteria | 1965 |
| 101 | Ga0068851_10010036 | 3300005834 | Bacteria | 4411 |
| 102 | Ga0068851_10042199 | 3300005834 | Bacteria | 2296 |
| 103 | Ga0068851_10059289 | 3300005834 | Bacteria | 1957 |
| 104 | Ga0068870_10048002 | 3300005840 | Bacteria | 2247 |
| 105 | Ga0068870_10070972 | 3300005840 | Bacteria | 1900 |
| 106 | Ga0068863_100075669 | 3300005841 | Bacteria | 3185 |
| 107 | Ga0068858_100233873 | 3300005842 | Bacteria | 1742 |
| 108 | Ga0068858_100293340 | 3300005842 | Bacteria | 1550 |
| 109 | Ga0068858_100385329 | 3300005842 | Bacteria | 1345 |
| 110 | Ga0068860_100108861 | 3300005843 | Bacteria | 2648 |
| 111 | Ga0068860_100190338 | 3300005843 | Bacteria | 1985 |
| 112 | Ga0068860_100375687 | 3300005843 | Bacteria | 1402 |
| 113 | Ga0068860_100379761 | 3300005843 | Bacteria | 1395 |
| 114 | Ga0068862_100070369 | 3300005844 | Bacteria | 3020 |
| 115 | Ga0068862_100118140 | 3300005844 | Bacteria | 2334 |
| 116 | Ga0068862_100391869 | 3300005844 | Bacteria | 1298 |
| 117 | Ga0068862_100649480 | 3300005844 | Bacteria | 1017 |
| 118 | Ga0081455_10057793 | 3300005937 | Bacteria | 3286 |
| 119 | Ga0081455_10060751 | 3300005937 | Bacteria | 3184 |
| 120 | Ga0081455_10472183 | 3300005937 | Bacteria | 851 |
| 121 | Ga0081540_1000575 | 3300005983 | Bacteria | 35551 |
| 122 | Ga0081540_1008037 | 3300005983 | Bacteria | 7421 |
| 123 | Ga0081540_1012391 | 3300005983 | Bacteria | 5623 |
| 124 | Ga0081540_1018689 | 3300005983 | Bacteria | 4243 |
| 125 | Ga0081540_1023497 | 3300005983 | Bacteria | 3603 |
| 126 | Ga0081540_1034892 | 3300005983 | Bacteria | 2704 |
| 127 | Ga0081540_1074758 | 3300005983 | Bacteria | 1551 |
| 128 | Ga0081539_10000113 | 3300005985 | Bacteria | 189418 |
| 129 | Ga0081539_10039747 | 3300005985 | Bacteria | 2772 |
| 130 | Ga0070717_10825047 | 3300006028 | Bacteria | 844 |
| 131 | Ga0075365_10024932 | 3300006038 | Bacteria | 3781 |
| 132 | Ga0075365_10050581 | 3300006038 | Bacteria | 2741 |
| 133 | Ga0075365_10374404 | 3300006038 | Bacteria | 1004 |
| 134 | Ga0075368_10051916 | 3300006042 | Bacteria | 1630 |
| 135 | Ga0075368_10083503 | 3300006042 | Bacteria | 1301 |
| 136 | Ga0075368_10186359 | 3300006042 | Bacteria | 876 |
| 137 | Ga0075363_100138607 | 3300006048 | Bacteria | 1368 |
| 138 | Ga0075362_10010927 | 3300006177 | Bacteria | 3562 |
| 139 | Ga0075362_10014438 | 3300006177 | Bacteria | 3188 |
| 140 | Ga0075367_10026278 | 3300006178 | Bacteria | 3300 |
| 141 | Ga0075367_10138782 | 3300006178 | Bacteria | 1505 |
| 142 | Ga0075369_10067465 | 3300006186 | Bacteria | 1570 |
| 143 | Ga0075366_10039208 | 3300006195 | Bacteria | 2800 |
| 144 | Ga0075366_10107024 | 3300006195 | Bacteria | 1681 |
| 145 | Ga0075366_10276803 | 3300006195 | Bacteria | 1025 |
| 146 | Ga0097621_100135110 | 3300006237 | Bacteria | 2103 |
| 147 | Ga0068871_100095962 | 3300006358 | Bacteria | 2477 |
| 148 | Ga0068871_100263951 | 3300006358 | Bacteria | 1503 |
| 149 | Ga0075428_100190956 | 3300006844 | Bacteria | 2215 |
| 150 | Ga0075431_100439372 | 3300006847 | Bacteria | 1302 |
| 151 | Ga0068865_100260196 | 3300006881 | Bacteria | 1373 |
| 152 | Ga0075436_100163073 | 3300006914 | Bacteria | 1572 |
| 153 | Ga0097620_100039598 | 3300006931 | Bacteria | 4728 |
| 154 | Ga0097620_100116651 | 3300006931 | Bacteria | 2735 |
| 155 | Ga0099795_10092135 | 3300007788 | Bacteria | 1176 |
| 156 | Ga0105244_10308900 | 3300009036 | Bacteria | 731 |
| 157 | Ga0105250_10097006 | 3300009092 | Bacteria | 1202 |
| 158 | Ga0105240_10016135 | 3300009093 | Bacteria | 10123 |
| 159 | Ga0105240_10082005 | 3300009093 | Bacteria | 3962 |
| 160 | Ga0105240_10141161 | 3300009093 | Bacteria | 2880 |
| 161 | Ga0105245_10126611 | 3300009098 | Bacteria | 2392 |
| 162 | Ga0105245_10209432 | 3300009098 | Bacteria | 1876 |
| 163 | Ga0105247_10088313 | 3300009101 | Bacteria | 1964 |
| 164 | Ga0105247_10123500 | 3300009101 | Bacteria | 1680 |
| 165 | Ga0105247_10197944 | 3300009101 | Bacteria | 1348 |
| 166 | Ga0114129_10631316 | 3300009147 | Bacteria | 1384 |
| 167 | Ga0105243_10088683 | 3300009148 | Bacteria | 2541 |
| 168 | Ga0105243_10120222 | 3300009148 | Bacteria | 2213 |
| 169 | Ga0105241_10001401 | 3300009174 | Bacteria | 18447 |
| 170 | Ga0105241_10046934 | 3300009174 | Bacteria | 3282 |
| 171 | Ga0105241_10292233 | 3300009174 | Bacteria | 1396 |
| 172 | Ga0105242_10225935 | 3300009176 | Bacteria | 1675 |
| 173 | Ga0105248_10184198 | 3300009177 | Bacteria | 2353 |
| 174 | Ga0105248_10232856 | 3300009177 | Bacteria | 2074 |
| 175 | Ga0105237_10008696 | 3300009545 | Bacteria | 10967 |
| 176 | Ga0105237_10058881 | 3300009545 | Bacteria | 3845 |
| 177 | Ga0105237_10102741 | 3300009545 | Bacteria | 2850 |
| 178 | Ga0105237_10131779 | 3300009545 | Bacteria | 2494 |
| 179 | Ga0105237_10439844 | 3300009545 | Bacteria | 1310 |
| 180 | Ga0105237_10598622 | 3300009545 | Bacteria | 1109 |
| 181 | Ga0105238_10006652 | 3300009551 | Bacteria | 11526 |
| 182 | Ga0105238_10008473 | 3300009551 | Bacteria | 10294 |
| 183 | Ga0105238_10011666 | 3300009551 | Bacteria | 8855 |
| 184 | Ga0105249_10196025 | 3300009553 | Bacteria | 1974 |
| 185 | Ga0105249_10314377 | 3300009553 | Bacteria | 1576 |
| 186 | Ga0105249_11088917 | 3300009553 | Bacteria | 869 |
| 187 | Ga0105239_10004659 | 3300010375 | Bacteria | 16304 |
| 188 | Ga0105239_10072318 | 3300010375 | Bacteria | 3791 |
| 189 | Ga0105239_10133836 | 3300010375 | Bacteria | 2759 |
| 190 | Ga0105239_10610254 | 3300010375 | Bacteria | 1245 |
| 191 | Ga0105246_10060031 | 3300011119 | Bacteria | 2641 |
| 192 | Ga0105246_10140977 | 3300011119 | Bacteria | 1812 |
| 193 | Ga0157369_10275996 | 3300013105 | Bacteria | 1751 |
| 194 | Ga0157374_10013080 | 3300013296 | Bacteria | 7239 |
| 195 | Ga0157374_10088341 | 3300013296 | Bacteria | 2952 |
| 196 | Ga0157374_10292096 | 3300013296 | Bacteria | 1611 |
| 197 | Ga0157374_10450379 | 3300013296 | Bacteria | 1288 |
| 198 | Ga0157378_10009387 | 3300013297 | Bacteria | 8523 |
| 199 | Ga0157378_10267217 | 3300013297 | Bacteria | 1643 |
| 200 | Ga0157378_10584210 | 3300013297 | Bacteria | 1126 |
| 201 | Ga0163162_10111361 | 3300013306 | Bacteria | 2835 |
| 202 | Ga0163162_10183755 | 3300013306 | Bacteria | 2217 |
| 203 | Ga0163162_10337595 | 3300013306 | Bacteria | 1639 |
| 204 | Ga0163162_11365129 | 3300013306 | Bacteria | 806 |
| 205 | Ga0157372_10947817 | 3300013307 | Bacteria | 998 |
| 206 | Ga0157375_10581703 | 3300013308 | Bacteria | 1280 |
| 207 | Ga0163163_10310125 | 3300014325 | Bacteria | 1631 |
| 208 | Ga0163163_10494014 | 3300014325 | Bacteria | 1285 |
| 209 | Ga0157377_10082014 | 3300014745 | Bacteria | 1887 |
| 210 | Ga0157379_10109480 | 3300014968 | Bacteria | 2481 |
| 211 | Ga0157379_10298324 | 3300014968 | Bacteria | 1468 |
| 212 | Ga0157379_10365802 | 3300014968 | Bacteria | 1322 |
| 213 | Ga0157379_10431000 | 3300014968 | Bacteria | 1215 |
| 214 | Ga0157376_10008594 | 3300014969 | Bacteria | 7379 |
| 215 | Ga0163161_10022770 | 3300017792 | Bacteria | 4414 |
| 216 | Ga0213876_10146329 | 3300021384 | Bacteria | 1256 |
| 217 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 218 | Ga0209233_1032716 | 3300025261 | Bacteria | 1200 |
| 219 | Ga0209455_1002814 | 3300025272 | Bacteria | 6473 |
| 220 | Ga0209455_1018656 | 3300025272 | Bacteria | 1419 |
| 221 | Ga0209564_1001937 | 3300025295 | Bacteria | 18414 |
| 222 | Ga0209758_1004237 | 3300025297 | Bacteria | 12139 |
| 223 | Ga0209758_1007006 | 3300025297 | Bacteria | 7841 |
| 224 | Ga0209758_1012541 | 3300025297 | Bacteria | 4729 |
| 225 | Ga0207426_1000998 | 3300025302 | Bacteria | 27598 |
| 226 | Ga0207426_1021924 | 3300025302 | Bacteria | 2200 |
| 227 | Ga0207656_10008182 | 3300025321 | Bacteria | 3838 |
| 228 | Ga0207653_10004937 | 3300025885 | Bacteria | 4166 |
| 229 | Ga0207642_10119142 | 3300025899 | Bacteria | 1358 |
| 230 | Ga0207688_10018719 | 3300025901 | Bacteria | 3766 |
| 231 | Ga0207688_10047639 | 3300025901 | Bacteria | 2393 |
| 232 | Ga0207688_10059448 | 3300025901 | Bacteria | 2153 |
| 233 | Ga0207688_10127135 | 3300025901 | Bacteria | 1491 |
| 234 | Ga0207647_10000674 | 3300025904 | Bacteria | 26753 |
| 235 | Ga0207643_10045737 | 3300025908 | Bacteria | 2472 |
| 236 | Ga0207705_10081176 | 3300025909 | Bacteria | 2364 |
| 237 | Ga0207654_10000411 | 3300025911 | Bacteria | 24726 |
| 238 | Ga0207654_10011939 | 3300025911 | Bacteria | 4441 |
| 239 | Ga0207654_10194199 | 3300025911 | Bacteria | 1332 |
| 240 | Ga0207654_10252539 | 3300025911 | Bacteria | 1183 |
| 241 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 242 | Ga0207695_10000424 | 3300025913 | Bacteria | 93657 |
| 243 | Ga0207695_10057665 | 3300025913 | Bacteria | 4034 |
| 244 | Ga0207671_10011774 | 3300025914 | Bacteria | 7083 |
| 245 | Ga0207671_10012559 | 3300025914 | Bacteria | 6802 |
| 246 | Ga0207671_10415587 | 3300025914 | Bacteria | 1070 |
| 247 | Ga0207693_10008179 | 3300025915 | Bacteria | 8569 |
| 248 | Ga0207660_10757170 | 3300025917 | Bacteria | 793 |
| 249 | Ga0207657_10310272 | 3300025919 | Bacteria | 1249 |
| 250 | Ga0207649_10177172 | 3300025920 | Bacteria | 1490 |
| 251 | Ga0207649_10474252 | 3300025920 | Bacteria | 948 |
| 252 | Ga0207649_10561136 | 3300025920 | Bacteria | 875 |
| 253 | Ga0207652_10316470 | 3300025921 | Bacteria | 1409 |
| 254 | Ga0207681_10311617 | 3300025923 | Bacteria | 1248 |
| 255 | Ga0207681_10433971 | 3300025923 | Bacteria | 1066 |
| 256 | Ga0207694_10000347 | 3300025924 | Bacteria | 43770 |
| 257 | Ga0207694_10032322 | 3300025924 | Bacteria | 4004 |
| 258 | Ga0207694_10139322 | 3300025924 | Bacteria | 1950 |
| 259 | Ga0207687_10044667 | 3300025927 | Bacteria | 3059 |
| 260 | Ga0207687_10059786 | 3300025927 | Bacteria | 2686 |
| 261 | Ga0207700_10071868 | 3300025928 | Bacteria | 2666 |
| 262 | Ga0207644_10106269 | 3300025931 | Bacteria | 2116 |
| 263 | Ga0207644_10335423 | 3300025931 | Bacteria | 1225 |
| 264 | Ga0207690_10230331 | 3300025932 | Bacteria | 1422 |
| 265 | Ga0207706_10076024 | 3300025933 | Bacteria | 2954 |
| 266 | Ga0207706_10095998 | 3300025933 | Bacteria | 2607 |
| 267 | Ga0207706_10132071 | 3300025933 | Bacteria | 2196 |
| 268 | Ga0207709_10022516 | 3300025935 | Bacteria | 3574 |
| 269 | Ga0207709_10224329 | 3300025935 | Bacteria | 1357 |
| 270 | Ga0207670_10244497 | 3300025936 | Bacteria | 1384 |
| 271 | Ga0207670_10355988 | 3300025936 | Bacteria | 1160 |
| 272 | Ga0207669_10113998 | 3300025937 | Bacteria | 1818 |
| 273 | Ga0207669_10173836 | 3300025937 | Bacteria | 1536 |
| 274 | Ga0207665_10435643 | 3300025939 | Bacteria | 1004 |
| 275 | Ga0207691_10344280 | 3300025940 | Bacteria | 1276 |
| 276 | Ga0207711_10394178 | 3300025941 | Bacteria | 1286 |
| 277 | Ga0207689_10027970 | 3300025942 | Bacteria | 4716 |
| 278 | Ga0207689_10033587 | 3300025942 | Bacteria | 4262 |
| 279 | Ga0207689_10152292 | 3300025942 | Bacteria | 1906 |
| 280 | Ga0207661_10000647 | 3300025944 | Bacteria | 22491 |
| 281 | Ga0207667_10012216 | 3300025949 | Bacteria | 9919 |
| 282 | Ga0207667_10208918 | 3300025949 | Bacteria | 2001 |
| 283 | Ga0207667_10574287 | 3300025949 | Bacteria | 1139 |
| 284 | Ga0207651_10146138 | 3300025960 | Bacteria | 1834 |
| 285 | Ga0207712_10131060 | 3300025961 | Bacteria | 1911 |
| 286 | Ga0207668_10038842 | 3300025972 | Bacteria | 3198 |
| 287 | Ga0207668_10116812 | 3300025972 | Bacteria | 2012 |
| 288 | Ga0207640_10010275 | 3300025981 | Bacteria | 5268 |
| 289 | Ga0207640_10021552 | 3300025981 | Bacteria | 3843 |
| 290 | Ga0207640_10034597 | 3300025981 | Bacteria | 3154 |
| 291 | Ga0207640_10083049 | 3300025981 | Bacteria | 2195 |
| 292 | Ga0207658_10054061 | 3300025986 | Bacteria | 2970 |
| 293 | Ga0207658_10114458 | 3300025986 | Bacteria | 2139 |
| 294 | Ga0207677_10059246 | 3300026023 | Bacteria | 2640 |
| 295 | Ga0207677_10495634 | 3300026023 | Bacteria | 1055 |
| 296 | Ga0207703_10117760 | 3300026035 | Bacteria | 2276 |
| 297 | Ga0207703_10127478 | 3300026035 | Bacteria | 2193 |
| 298 | Ga0207703_10333448 | 3300026035 | Bacteria | 1392 |
| 299 | Ga0207639_10041076 | 3300026041 | Bacteria | 3458 |
| 300 | Ga0207639_10054143 | 3300026041 | Bacteria | 3065 |
| 301 | Ga0207678_10077729 | 3300026067 | Bacteria | 2843 |
| 302 | Ga0207678_10091798 | 3300026067 | Bacteria | 2596 |
| 303 | Ga0207678_10095176 | 3300026067 | Bacteria | 2545 |
| 304 | Ga0207678_10100719 | 3300026067 | Bacteria | 2468 |
| 305 | Ga0207678_10109551 | 3300026067 | Bacteria | 2355 |
| 306 | Ga0207678_10319696 | 3300026067 | Bacteria | 1335 |
| 307 | Ga0207678_10380464 | 3300026067 | Bacteria | 1220 |
| 308 | Ga0207678_10474669 | 3300026067 | Bacteria | 1089 |
| 309 | Ga0207678_10508965 | 3300026067 | Bacteria | 1050 |
| 310 | Ga0207708_10218688 | 3300026075 | Bacteria | 1526 |
| 311 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 312 | Ga0207702_10011407 | 3300026078 | Bacteria | 7409 |
| 313 | Ga0207702_10149452 | 3300026078 | Bacteria | 2123 |
| 314 | Ga0207702_10694435 | 3300026078 | Bacteria | 1003 |
| 315 | Ga0207641_10805848 | 3300026088 | Bacteria | 929 |
| 316 | Ga0207648_10176716 | 3300026089 | Bacteria | 1888 |
| 317 | Ga0207648_10234412 | 3300026089 | Bacteria | 1633 |
| 318 | Ga0207676_10522172 | 3300026095 | Bacteria | 1130 |
| 319 | Ga0207676_10545255 | 3300026095 | Bacteria | 1107 |
| 320 | Ga0207676_10938721 | 3300026095 | Bacteria | 850 |
| 321 | Ga0207674_10009561 | 3300026116 | Bacteria | 11063 |
| 322 | Ga0207674_10168213 | 3300026116 | Bacteria | 2146 |
| 323 | Ga0207675_100187275 | 3300026118 | Bacteria | 1984 |
| 324 | Ga0207683_10055407 | 3300026121 | Bacteria | 3476 |
| 325 | Ga0207683_10327426 | 3300026121 | Bacteria | 1404 |
| 326 | Ga0207683_10606486 | 3300026121 | Bacteria | 1013 |
| 327 | Ga0207698_10003453 | 3300026142 | Bacteria | 9514 |
| 328 | Ga0207698_10028115 | 3300026142 | Bacteria | 4005 |
| 329 | Ga0207698_10143341 | 3300026142 | Bacteria | 2062 |
| 330 | Ga0207698_10258632 | 3300026142 | Bacteria | 1598 |
| 331 | Ga0207698_10930600 | 3300026142 | Bacteria | 877 |
| 332 | Ga0209813_10124070 | 3300027866 | Bacteria | 902 |
| 333 | Ga0268266_10283021 | 3300028379 | Bacteria | 1542 |
| 334 | Ga0268266_10355467 | 3300028379 | Bacteria | 1377 |
| 335 | Ga0268265_10026044 | 3300028380 | Bacteria | 4157 |
| 336 | Ga0268265_10089976 | 3300028380 | Bacteria | 2450 |
| 337 | Ga0268265_10274083 | 3300028380 | Bacteria | 1506 |
| 338 | Ga0268264_10159180 | 3300028381 | Bacteria | 2032 |
| 339 | Ga0307517_10001507 | 3300028786 | Bacteria | 38891 |
| 340 | Ga0307511_10131200 | 3300030521 | Bacteria | 1509 |
| 341 | Ga0265766_1004717 | 3300030863 | Bacteria | 841 |
| 342 | Ga0265339_10002027 | 3300031249 | Bacteria | 14869 |
| 343 | Ga0307513_10160001 | 3300031456 | Bacteria | 2146 |
| 344 | Ga0307513_10202539 | 3300031456 | Bacteria | 1824 |
| 345 | Ga0307508_10000249 | 3300031616 | Bacteria | 65482 |
| 346 | Ga0265314_10014031 | 3300031711 | Bacteria | 6439 |
| 347 | Ga0265314_10048593 | 3300031711 | Bacteria | 2977 |
| 348 | Ga0307413_10026093 | 3300031824 | Bacteria | 3215 |
| 349 | Ga0307413_10197518 | 3300031824 | Bacteria | 1450 |
| 350 | Ga0307406_10170831 | 3300031901 | Bacteria | 1573 |
| 351 | Ga0307407_10186701 | 3300031903 | Bacteria | 1378 |
| 352 | Ga0307412_10025793 | 3300031911 | Bacteria | 3645 |
| 353 | Ga0307412_10199695 | 3300031911 | Bacteria | 1518 |
| 354 | Ga0307409_100170998 | 3300031995 | Bacteria | 1912 |
| 355 | Ga0307416_100080534 | 3300032002 | Bacteria | 2749 |
| 356 | Ga0307411_10076487 | 3300032005 | Bacteria | 2288 |
| 357 | Ga0307415_100139282 | 3300032126 | Bacteria | 1850 |
| 358 | Ga0307415_100628855 | 3300032126 | Bacteria | 959 |
| 359 | Ga0307510_10075034 | 3300033180 | Bacteria | 3336 |
| 360 | Ga0307510_10077445 | 3300033180 | Bacteria | 3261 |
| 361 | Ga0307510_10175299 | 3300033180 | Bacteria | 1716 |
| 362 | Ga0316215_1003920 | 3300033544 | Bacteria | 1423 |
| 363 | Ga0372808_001591 | 3300036459 | Bacteria | 2405 |
| 364 | Ga0395898_0078048 | 3300037466 | Bacteria | 3196 |
| 365 | Ga0395905_0009682 | 3300037471 | Bacteria | 9408 |
| 366 | Ga0395901_0173751 | 3300038443 | Bacteria | 2260 |
| 367 | Ga0436365_0130490 | 3300039437 | Bacteria | 923 |
| 368 | Ga0436365_1407659 | 3300039437 | Bacteria | 2118 |
| 369 | Ga0436365_1588981 | 3300039437 | Bacteria | 1140 |
| 370 | Ga0436360_1009642 | 3300039438 | Bacteria | 839 |
| 371 | Ga0436361_1114452 | 3300039447 | Bacteria | 1702 |
| 372 | Ga0436363_0799159 | 3300039450 | Bacteria | 817 |
| 373 | Ga0439465_0092680 | 3300041413 | Bacteria | 1035 |
| 374 | Ga0451804_0890762 | 3300041463 | Bacteria | 904 |
| 375 | Ga0451853_1779309 | 3300041512 | Bacteria | 810 |
| 376 | Ga0451853_1916674 | 3300041512 | Bacteria | 982 |
| 377 | Ga0439458_0023515 | 3300042157 | Bacteria | 1437 |
| 378 | Ga0466969_0019181 | 3300044656 | Bacteria | 3560 |
| 379 | Ga0466969_0282756 | 3300044656 | Bacteria | 751 |
| 380 | Ga0466972_0000200 | 3300044658 | Bacteria | 43953 |
| 381 | Ga0466966_0001059 | 3300044684 | Bacteria | 17577 |
| 382 | Ga0466961_0000050 | 3300044693 | Bacteria | 71289 |
| 383 | Ga0466959_0026668 | 3300045049 | Bacteria | 4283 |
| 384 | Ga0466958_0367497 | 3300045836 | Bacteria | 927 |
| 385 | Ga0466967_0006745 | 3300045976 | Bacteria | 8170 |
| 386 | Ga0466967_0084624 | 3300045976 | Bacteria | 2870 |
| 387 | Ga0495617_049104 | 3300046452 | Bacteria | 1404 |
| 388 | Ga0495592_0240856 | 3300046454 | Bacteria | 1200 |
| 389 | Ga0495603_0116155 | 3300046455 | Bacteria | 1560 |
| 390 | Ga0495590_0014239 | 3300046457 | Bacteria | 2905 |
| 391 | Ga0495629_0001074 | 3300046459 | Bacteria | 21800 |
| 392 | Ga0495629_0045299 | 3300046459 | Bacteria | 3086 |
| 393 | Ga0495638_0001532 | 3300046460 | Bacteria | 20807 |
| 394 | Ga0495638_0023480 | 3300046460 | Bacteria | 4032 |
| 395 | Ga0495651_0001520 | 3300046462 | Bacteria | 17929 |
| 396 | Ga0495651_0198724 | 3300046462 | Bacteria | 1405 |
| 397 | Ga0495653_0349349 | 3300046463 | Bacteria | 951 |
| 398 | Ga0495650_0051836 | 3300046471 | Bacteria | 1688 |
| 399 | Ga0495650_0055945 | 3300046471 | Bacteria | 1603 |
| 400 | Ga0495580_0284028 | 3300046472 | Bacteria | 1129 |
| 401 | Ga0495582_0199011 | 3300046473 | Bacteria | 1144 |
| 402 | Ga0495605_0062814 | 3300046474 | Bacteria | 1773 |
| 403 | Ga0495605_0087120 | 3300046474 | Bacteria | 1452 |
| 404 | Ga0495639_0143637 | 3300046475 | Bacteria | 1148 |
| 405 | Ga0495664_0009304 | 3300046477 | Bacteria | 5493 |
| 406 | Ga0495584_0035337 | 3300046491 | Bacteria | 2526 |
| 407 | Ga0495585_0049564 | 3300046492 | Bacteria | 2331 |
| 408 | Ga0495585_0064445 | 3300046492 | Bacteria | 2009 |
| 409 | Ga0495594_0120361 | 3300046499 | Bacteria | 1484 |
| 410 | Ga0495594_0214838 | 3300046499 | Bacteria | 1097 |
| 411 | Ga0495594_0221291 | 3300046499 | Bacteria | 1079 |
| 412 | Ga0495596_0017806 | 3300046500 | Bacteria | 2936 |
| 413 | Ga0495607_0083920 | 3300046501 | Bacteria | 1744 |
| 414 | Ga0495583_0113473 | 3300046506 | Bacteria | 1146 |
| 415 | Ga0495606_0012281 | 3300046507 | Bacteria | 6889 |
| 416 | Ga0495606_0038140 | 3300046507 | Bacteria | 3253 |
| 417 | Ga0495606_0322119 | 3300046507 | Bacteria | 830 |
| 418 | Ga0495608_0041927 | 3300046511 | Bacteria | 3061 |
| 419 | Ga0495608_0061400 | 3300046511 | Bacteria | 2471 |
| 420 | Ga0495610_0031329 | 3300046512 | Bacteria | 2775 |
| 421 | Ga0495616_0019622 | 3300046513 | Bacteria | 3687 |
| 422 | Ga0495620_0037367 | 3300046515 | Bacteria | 2164 |
| 423 | Ga0495620_0053252 | 3300046515 | Bacteria | 1714 |
| 424 | Ga0495628_0048546 | 3300046516 | Bacteria | 3364 |
| 425 | Ga0495628_0430925 | 3300046516 | Bacteria | 960 |
| 426 | Ga0495631_0170169 | 3300046518 | Bacteria | 934 |
| 427 | Ga0495631_0177187 | 3300046518 | Bacteria | 914 |
| 428 | Ga0495643_0089804 | 3300046522 | Bacteria | 1586 |
| 429 | Ga0495644_0085417 | 3300046523 | Bacteria | 1189 |
| 430 | Ga0495644_0177550 | 3300046523 | Bacteria | 818 |
| 431 | Ga0495648_0007789 | 3300046524 | Bacteria | 8521 |
| 432 | Ga0495648_0035596 | 3300046524 | Bacteria | 3226 |
| 433 | Ga0495642_0022245 | 3300046528 | Bacteria | 2497 |
| 434 | Ga0495652_0004137 | 3300046529 | Bacteria | 13996 |
| 435 | Ga0495652_0116715 | 3300046529 | Bacteria | 2136 |
| 436 | Ga0495652_0237307 | 3300046529 | Bacteria | 1359 |
| 437 | Ga0495654_0057989 | 3300046530 | Bacteria | 1869 |
| 438 | Ga0495640_0013570 | 3300046533 | Bacteria | 6193 |
| 439 | Ga0495640_0175586 | 3300046533 | Bacteria | 1367 |
| 440 | Ga0495587_0099595 | 3300046536 | Bacteria | 1675 |
| 441 | Ga0495609_0023003 | 3300046538 | Bacteria | 2867 |
| 442 | Ga0495621_0072084 | 3300046539 | Bacteria | 1274 |
| 443 | Ga0495621_0157055 | 3300046539 | Bacteria | 898 |
| 444 | Ga0495645_0052767 | 3300046543 | Bacteria | 2957 |
| 445 | Ga0495622_0029823 | 3300046557 | Bacteria | 2548 |
| 446 | Ga0495633_0031508 | 3300046558 | Bacteria | 2569 |
| 447 | Ga0495633_0168187 | 3300046558 | Bacteria | 1011 |
| 448 | Ga0495633_0177272 | 3300046558 | Bacteria | 981 |
| 449 | Ga0495667_0001954 | 3300046559 | Bacteria | 13634 |
| 450 | Ga0495667_0216481 | 3300046559 | Bacteria | 1223 |
| 451 | Ga0495656_0107535 | 3300046615 | Bacteria | 1299 |
| 452 | Ga0495656_0127132 | 3300046615 | Bacteria | 1209 |
| 453 | Ga0495656_0169119 | 3300046615 | Bacteria | 1067 |
| 454 | Ga0495656_0200272 | 3300046615 | Bacteria | 990 |
| 455 | Ga0495668_0046611 | 3300046616 | Bacteria | 2408 |
| 456 | Ga0495668_0055740 | 3300046616 | Bacteria | 2182 |
| 457 | Ga0495668_0207276 | 3300046616 | Bacteria | 1073 |
| 458 | Ga0495634_0064051 | 3300046642 | Bacteria | 2438 |
| 459 | Ga0495611_0014614 | 3300046648 | Bacteria | 3356 |
| 460 | Ga0495611_0018442 | 3300046648 | Bacteria | 2993 |
| 461 | Ga0495625_0065754 | 3300046660 | Bacteria | 2555 |
| 462 | Ga0495625_0118546 | 3300046660 | Bacteria | 1803 |
| 463 | Ga0495635_0029484 | 3300046663 | Bacteria | 3816 |
| 464 | Ga0495635_0038884 | 3300046663 | Bacteria | 3293 |
| 465 | Ga0495659_0057282 | 3300046664 | Bacteria | 1431 |
| 466 | Ga0495659_0170113 | 3300046664 | Bacteria | 883 |
| 467 | Ga0495588_0146885 | 3300046674 | Bacteria | 1246 |
| 468 | Ga0495657_0000889 | 3300046675 | Bacteria | 26346 |
| 469 | Ga0495657_0013750 | 3300046675 | Bacteria | 5959 |
| 470 | Ga0495599_0048064 | 3300046678 | Bacteria | 2674 |
| 471 | Ga0495623_0005846 | 3300046679 | Bacteria | 8019 |
| 472 | Ga0495646_0023476 | 3300046680 | Bacteria | 3882 |
| 473 | Ga0495646_0069412 | 3300046680 | Bacteria | 2079 |
| 474 | Ga0495647_0092494 | 3300046681 | Bacteria | 1242 |
| 475 | Ga0495669_0001878 | 3300046684 | Bacteria | 8615 |
| 476 | Ga0495669_0023843 | 3300046684 | Bacteria | 2665 |
| 477 | Ga0495669_0214743 | 3300046684 | Bacteria | 921 |
| 478 | Ga0495613_0010887 | 3300046689 | Bacteria | 6750 |
| 479 | Ga0495613_0012709 | 3300046689 | Bacteria | 6261 |
| 480 | Ga0495624_0036110 | 3300046690 | Bacteria | 3188 |
| 481 | Ga0495670_0081849 | 3300046691 | Bacteria | 1645 |
| 482 | Ga0495670_0283774 | 3300046691 | Bacteria | 886 |
| 483 | Ga0495649_0006966 | 3300046694 | Bacteria | 6975 |
| 484 | Ga0495649_0090648 | 3300046694 | Bacteria | 1630 |
| 485 | Ga0495649_0094642 | 3300046694 | Bacteria | 1590 |
| 486 | Ga0495600_0001856 | 3300046809 | Bacteria | 11854 |
| 487 | Ga0495600_0051569 | 3300046809 | Bacteria | 2685 |
| 488 | Ga0495604_0004282 | 3300047317 | Bacteria | 11303 |
| 489 | Ga0495604_0043497 | 3300047317 | Bacteria | 3515 |
| 490 | Ga0495674_0051435 | 3300047319 | Bacteria | 3632 |
| 491 | Ga0495672_0072363 | 3300047320 | Bacteria | 1947 |
| 492 | Ga0495672_0096380 | 3300047320 | Bacteria | 1613 |
| 493 | Ga0495672_0241082 | 3300047320 | Bacteria | 883 |
| 494 | Ga0495676_0030358 | 3300047321 | Bacteria | 4589 |
| 495 | Ga0495676_0177434 | 3300047321 | Bacteria | 1495 |
| 496 | Ga0495680_0002530 | 3300047322 | Bacteria | 18695 |
| 497 | Ga0495683_0037174 | 3300047323 | Bacteria | 2469 |
| 498 | Ga0495675_0025330 | 3300047444 | Bacteria | 3782 |
| 499 | Ga0495677_0017120 | 3300047445 | Bacteria | 2628 |
| 500 | Ga0495677_0028231 | 3300047445 | Bacteria | 2037 |
| 501 | Ga0495673_0053938 | 3300047469 | Bacteria | 1750 |
| 502 | Ga0495673_0090873 | 3300047469 | Bacteria | 1248 |
| 503 | Ga0495684_0088708 | 3300047471 | Bacteria | 2344 |
| 504 | Ga0495686_0042724 | 3300047472 | Bacteria | 2879 |
| 505 | Ga0495686_0075836 | 3300047472 | Bacteria | 2061 |
| 506 | Ga0495686_0175993 | 3300047472 | Bacteria | 1242 |
| 507 | Ga0495686_0234383 | 3300047472 | Bacteria | 1038 |
| 508 | Ga0495593_0054177 | 3300047673 | Bacteria | 2115 |
| 509 | Ga0495593_0197116 | 3300047673 | Bacteria | 1012 |
| 510 | Ga0495602_0003401 | 3300048088 | Bacteria | 16456 |
| 511 | Ga0495602_0345942 | 3300048088 | Bacteria | 1074 |
| 512 | Ga0495615_0037754 | 3300048090 | Bacteria | 1191 |
| 513 | Ga0495626_0019232 | 3300048091 | Bacteria | 3416 |
| 514 | Ga0496100_0047643 | 3300048903 | Bacteria | 2763 |
| 515 | Ga0496100_0097636 | 3300048903 | Bacteria | 2018 |
| 516 | Ga0496100_0529006 | 3300048903 | Bacteria | 910 |
| 517 | Ga0496101_0006609 | 3300048904 | Bacteria | 7470 |
| 518 | Ga0496101_0163170 | 3300048904 | Bacteria | 1710 |
| 519 | Ga0496101_0252853 | 3300048904 | Bacteria | 1373 |
| 520 | Ga0496102_0013546 | 3300048905 | Bacteria | 7067 |
| 521 | Ga0496102_0083160 | 3300048905 | Bacteria | 2953 |
| 522 | Ga0496102_0105735 | 3300048905 | Bacteria | 2619 |
| 523 | Ga0496102_0133818 | 3300048905 | Bacteria | 2322 |
| 524 | Ga0496103_0127918 | 3300048906 | Bacteria | 1621 |
| 525 | Ga0496104_0000281 | 3300048907 | Bacteria | 45166 |
| 526 | Ga0496104_0008421 | 3300048907 | Bacteria | 9169 |
| 527 | Ga0496104_0037061 | 3300048907 | Bacteria | 4560 |
| 528 | Ga0496104_0143567 | 3300048907 | Bacteria | 2293 |
| 529 | Ga0496104_0480999 | 3300048907 | Bacteria | 1153 |
| 530 | Ga0496105_0011220 | 3300048908 | Bacteria | 7069 |
| 531 | Ga0496105_0038493 | 3300048908 | Bacteria | 3939 |
| 532 | Ga0496105_0061759 | 3300048908 | Bacteria | 3092 |
| 533 | Ga0496106_0006503 | 3300048909 | Bacteria | 8654 |
| 534 | Ga0496106_0107271 | 3300048909 | Bacteria | 2172 |
| 535 | Ga0496107_0019745 | 3300048910 | Bacteria | 4756 |
| 536 | Ga0496107_0043926 | 3300048910 | Bacteria | 3211 |
| 537 | Ga0496107_0364426 | 3300048910 | Bacteria | 1075 |
| 538 | Ga0496108_0067630 | 3300048911 | Bacteria | 3014 |
| 539 | Ga0496108_0277701 | 3300048911 | Bacteria | 1458 |
| 540 | Ga0496110_0117351 | 3300048913 | Bacteria | 2396 |
| 541 | Ga0496110_0238866 | 3300048913 | Bacteria | 1653 |
| 542 | Ga0496110_0243092 | 3300048913 | Bacteria | 1638 |
| 543 | Ga0496111_0058971 | 3300048914 | Bacteria | 2780 |
| 544 | Ga0496111_0061667 | 3300048914 | Bacteria | 2718 |
| 545 | Ga0496111_0530763 | 3300048914 | Bacteria | 865 |
| 546 | Ga0496112_0070807 | 3300048915 | Bacteria | 3446 |
| 547 | Ga0496112_0251739 | 3300048915 | Bacteria | 1717 |
| 548 | Ga0496113_0122738 | 3300048916 | Bacteria | 2032 |
| 549 | Ga0496113_0141201 | 3300048916 | Bacteria | 1895 |
| 550 | Ga0496113_0281929 | 3300048916 | Bacteria | 1329 |
| 551 | Ga0496114_0025621 | 3300048917 | Bacteria | 4822 |
| 552 | Ga0496114_0034287 | 3300048917 | Bacteria | 4187 |
| 553 | Ga0496114_0269795 | 3300048917 | Bacteria | 1499 |
| 554 | Ga0496115_0001082 | 3300048918 | Bacteria | 19741 |
| 555 | Ga0496115_0026056 | 3300048918 | Bacteria | 4560 |
| 556 | Ga0496115_0138877 | 3300048918 | Bacteria | 2004 |
| 557 | Ga0496115_0385966 | 3300048918 | Bacteria | 1138 |
| 558 | Ga0496115_0765900 | 3300048918 | Bacteria | 754 |
| 559 | Ga0496116_0158272 | 3300048919 | Bacteria | 1247 |
| 560 | Ga0496117_0066676 | 3300048920 | Bacteria | 2440 |
| 561 | Ga0496117_0160149 | 3300048920 | Bacteria | 1320 |
| 562 | Ga0496118_0219110 | 3300048921 | Bacteria | 1109 |
| 563 | Ga0496119_0005325 | 3300048922 | Bacteria | 12378 |
| 564 | Ga0496119_0111262 | 3300048922 | Bacteria | 1519 |
| 565 | Ga0496119_0167280 | 3300048922 | Bacteria | 1164 |
| 566 | Ga0496120_0001511 | 3300048923 | Bacteria | 27505 |
| 567 | Ga0496120_0128661 | 3300048923 | Bacteria | 1300 |
| 568 | Ga0496121_0028398 | 3300048924 | Bacteria | 5207 |
| 569 | Ga0496121_0077823 | 3300048924 | Bacteria | 2639 |
| 570 | Ga0496121_0149409 | 3300048924 | Bacteria | 1721 |
| 571 | Ga0496121_0293196 | 3300048924 | Bacteria | 1107 |
| 572 | Ga0496121_0373635 | 3300048924 | Bacteria | 942 |
| 573 | Ga0496122_0014132 | 3300048925 | Bacteria | 7742 |
| 574 | Ga0496122_0024695 | 3300048925 | Bacteria | 5251 |
| 575 | Ga0496123_0267797 | 3300048926 | Bacteria | 833 |
| 576 | Ga0496124_0029888 | 3300048927 | Bacteria | 4847 |
| 577 | Ga0496124_0144905 | 3300048927 | Bacteria | 1870 |
| 578 | Ga0496124_0464134 | 3300048927 | Bacteria | 859 |
| 579 | Ga0496125_0050051 | 3300048928 | Bacteria | 3464 |
| 580 | Ga0496125_0122043 | 3300048928 | Bacteria | 1856 |
| 581 | Ga0496125_0302923 | 3300048928 | Bacteria | 978 |
| 582 | Ga0496126_0002195 | 3300048929 | Bacteria | 27094 |
| 583 | Ga0496126_0038456 | 3300048929 | Bacteria | 4452 |
| 584 | Ga0496126_0088669 | 3300048929 | Bacteria | 2724 |
| 585 | Ga0496126_0141281 | 3300048929 | Bacteria | 2072 |
| 586 | Ga0496126_0246766 | 3300048929 | Bacteria | 1489 |
| 587 | Ga0496126_0411946 | 3300048929 | Bacteria | 1094 |
| 588 | Ga0496126_0433651 | 3300048929 | Bacteria | 1060 |
| 589 | Ga0495682_0009193 | 3300049460 | Bacteria | 3866 |
| 590 | Ga0501039_0313739 | 3300049575 | Bacteria | 1233 |
| 591 | Ga0501067_0029147 | 3300049583 | Bacteria | 3059 |
| 592 | Ga0501070_0614443 | 3300049586 | Bacteria | 866 |
| 593 | Ga0501071_0175580 | 3300049587 | Bacteria | 1605 |
| 594 | Ga0501076_0056326 | 3300049592 | Bacteria | 3120 |
| 595 | Ga0501045_0231428 | 3300049824 | Bacteria | 1376 |
| 596 | nmdc:mga03683_203959_c1 | 3300050489 | Bacteria | 908 |
| 597 | nmdc:mga03n38_45781_c1 | 3300050490 | Bacteria | 1928 |
| 598 | nmdc:mga03n38_72315_c1 | 3300050490 | Bacteria | 1598 |
| 599 | nmdc:mga0yw44_167115_c1 | 3300050492 | Bacteria | 1443 |
| 600 | nmdc:mga0yw44_23741_c1 | 3300050492 | Bacteria | 3459 |
| 601 | nmdc:mga0yw44_30604_c1 | 3300050492 | Bacteria | 3122 |
| 602 | nmdc:mga0yw44_4648_c1 | 3300050492 | Bacteria | 6341 |
| 603 | nmdc:mga0k408_78564_c1 | 3300050493 | Bacteria | 1931 |
| 604 | nmdc:mga0k408_8031_c1 | 3300050493 | Bacteria | 5657 |
| 605 | nmdc:mga06z11_240560_c1 | 3300050494 | Bacteria | 1063 |
| 606 | nmdc:mga09592_183634_c1 | 3300050508 | Bacteria | 1809 |
| 607 | nmdc:mga08y16_492555_c1 | 3300050511 | Bacteria | 1246 |
| 608 | nmdc:mga0n895_197525_c1 | 3300050512 | Bacteria | 2043 |
| 609 | nmdc:mga0rr50_588152_c1 | 3300050513 | Bacteria | 949 |
| 610 | nmdc:mga08x19_201358_c1 | 3300050514 | Bacteria | 1365 |
| 611 | nmdc:mga0sz30_144776_c1 | 3300050516 | Bacteria | 1050 |
| 612 | nmdc:mga0sz30_1617_c1 | 3300050516 | Bacteria | 3982 |
| 613 | Ga0495601_0148205 | 3300053077 | Bacteria | 1532 |
| 614 | Ga0500610_0185895 | 3300053079 | Bacteria | 1013 |
| 615 | Ga0495655_0003619 | 3300053083 | Bacteria | 2566 |
| 616 | Ga0495595_0124545 | 3300053084 | Bacteria | 1257 |
| 617 | Ga0495619_0133418 | 3300053085 | Bacteria | 1707 |
| 618 | Ga0500578_0051516 | 3300053086 | Bacteria | 2637 |
| 619 | Ga0500643_000319 | 3300053087 | Bacteria | 38698 |
| 620 | Ga0500643_034252 | 3300053087 | Bacteria | 1531 |
| 621 | Ga0500583_0058527 | 3300053092 | Bacteria | 1812 |
| 622 | Ga0500566_0004766 | 3300053094 | Bacteria | 8084 |
| 623 | Ga0500641_0023473 | 3300053096 | Bacteria | 2372 |
| 624 | Ga0500641_0216751 | 3300053096 | Bacteria | 813 |
| 625 | Ga0500556_0096440 | 3300053104 | Bacteria | 1135 |
| 626 | Ga0500557_001651 | 3300053105 | Bacteria | 3758 |
| 627 | Ga0500569_051451 | 3300053109 | Bacteria | 1244 |
| 628 | Ga0500595_001406 | 3300053119 | Bacteria | 12911 |
| 629 | Ga0500595_008531 | 3300053119 | Bacteria | 4182 |
| 630 | Ga0500595_009426 | 3300053119 | Bacteria | 3940 |
| 631 | Ga0500642_0000057 | 3300053130 | Bacteria | 67011 |
| 632 | Ga0500559_0187967 | 3300053136 | Bacteria | 973 |
| 633 | Ga0500561_0032027 | 3300053137 | Bacteria | 1333 |
| 634 | Ga0500577_0045176 | 3300053142 | Bacteria | 1626 |
| 635 | Ga0500579_105193 | 3300053143 | Bacteria | 1450 |
| 636 | Ga0500589_085098 | 3300053147 | Bacteria | 1404 |
| 637 | Ga0500590_109946 | 3300053148 | Bacteria | 1309 |
| 638 | Ga0500603_084254 | 3300053150 | Bacteria | 925 |
| 639 | Ga0500622_0007294 | 3300053156 | Bacteria | 6294 |
| 640 | Ga0500627_0053283 | 3300053158 | Bacteria | 1767 |
| 641 | Ga0500638_000402 | 3300053162 | Bacteria | 10262 |
| 642 | Ga0500637_0002381 | 3300053178 | Bacteria | 8348 |
| 643 | Ga0500637_0113806 | 3300053178 | Bacteria | 1569 |
| 644 | Ga0500649_063600 | 3300053722 | Bacteria | 1535 |
| 645 | Ga0500625_002930 | 3300053729 | Bacteria | 6580 |
| 646 | Ga0500656_005620 | 3300053732 | Bacteria | 1244 |
| 647 | Ga0500656_007310 | 3300053732 | Bacteria | 1144 |
| 648 | Ga0500661_000108 | 3300055283 | Bacteria | 13387 |
| 649 | Ga0500661_019746 | 3300055283 | Bacteria | 1199 |
| 650 | Ga0587090_021918 | 3300059510 | Bacteria | 1006 |
| 651 | Ga0587111_0024083 | 3300060346 | Bacteria | 1196 |
| 652 | Ga0530510_0288941 | 3300061734 | Bacteria | 1226 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_0799159 | Ga0436363_0799159_199_807 | 182 |
| 2 | 3300013297 | Ga0157378_10584210 | Ga0157378_105842102 | 187 |
| 3 | 3300048915 | Ga0496112_0251739 | Ga0496112_0251739_177_866 | 190 |
| 4 | 3300013296 | Ga0157374_10013080 | Ga0157374_100130802 | 191 |
| 5 | 3300005563 | Ga0068855_100239207 | Ga0068855_1002392072 | 192 |
| 6 | 3300046455 | Ga0495603_0116155 | Ga0495603_0116155_342_1052 | 193 |
| 7 | 3300046492 | Ga0495585_0049564 | Ga0495585_0049564_224_934 | 193 |
| 8 | 3300046499 | Ga0495594_0221291 | Ga0495594_0221291_177_887 | 193 |
| 9 | 3300046615 | Ga0495656_0169119 | Ga0495656_0169119_166_876 | 193 |
| 10 | 3300046664 | Ga0495659_0170113 | Ga0495659_0170113_43_753 | 193 |
| 11 | iso_pu_bacteria | 8019678201 | 8019685383 | 193 |
| 12 | 3300005535 | Ga0070684_100005320 | Ga0070684_1000053203 | 194 |
| 13 | 3300025944 | Ga0207661_10000647 | Ga0207661_1000064712 | 194 |
| 14 | 3300041512 | Ga0451853_1779309 | Ga0451853_1779309_88_789 | 194 |
| 15 | 3300026142 | Ga0207698_10258632 | Ga0207698_102586321 | 195 |
| 16 | 3300037466 | Ga0395898_0078048 | Ga0395898_0078048_1159_1845 | 195 |
| 17 | 3300044656 | Ga0466969_0282756 | Ga0466969_0282756_13_660 | 195 |
| 18 | 3300005548 | Ga0070665_100084978 | Ga0070665_1000849782 | 197 |
| 19 | 3300025939 | Ga0207665_10435643 | Ga0207665_104356431 | 197 |
| 20 | 3300028379 | Ga0268266_10355467 | Ga0268266_103554672 | 197 |
| 21 | 3300049592 | Ga0501076_0056326 | Ga0501076_0056326_813_1520 | 197 |
| 22 | 3300009545 | Ga0105237_10102741 | Ga0105237_101027412 | 199 |
| 23 | 3300009551 | Ga0105238_10008473 | Ga0105238_100084739 | 199 |
| 24 | 3300005336 | Ga0070680_100393738 | Ga0070680_1003937382 | 200 |
| 25 | 3300025924 | Ga0207694_10139322 | Ga0207694_101393222 | 200 |
| 26 | 3300047469 | Ga0495673_0090873 | Ga0495673_0090873_593_1225 | 200 |
| 27 | 3300046472 | Ga0495580_0284028 | Ga0495580_0284028_168_878 | 201 |
| 28 | 3300046681 | Ga0495647_0092494 | Ga0495647_0092494_338_1048 | 201 |
| 29 | 3300047321 | Ga0495676_0177434 | Ga0495676_0177434_278_988 | 201 |
| 30 | 3300053094 | Ga0500566_0004766 | Ga0500566_0004766_4000_4692 | 201 |
| 31 | 3300053119 | Ga0500595_001406 | Ga0500595_001406_6487_7179 | 201 |
| 32 | 3300053162 | Ga0500638_000402 | Ga0500638_000402_6552_7244 | 201 |
| 33 | 3300053178 | Ga0500637_0002381 | Ga0500637_0002381_1135_1827 | 201 |
| 34 | 3300055283 | Ga0500661_000108 | Ga0500661_000108_7971_8663 | 201 |
| 35 | 3300021384 | Ga0213876_10146329 | Ga0213876_101463292 | 202 |
| 36 | 3300039437 | Ga0436365_1588981 | Ga0436365_1588981_80_769 | 202 |
| 37 | 3300005329 | Ga0070683_100153824 | Ga0070683_1001538242 | 204 |
| 38 | 3300005341 | Ga0070691_10260897 | Ga0070691_102608971 | 204 |
| 39 | 3300005458 | Ga0070681_10088485 | Ga0070681_100884852 | 204 |
| 40 | 3300025272 | Ga0209455_1018656 | Ga0209455_10186562 | 205 |
| 41 | 3300046516 | Ga0495628_0430925 | Ga0495628_0430925_110_817 | 206 |
| 42 | 3300005336 | Ga0070680_100036060 | Ga0070680_1000360604 | 207 |
| 43 | 3300005530 | Ga0070679_100332109 | Ga0070679_1003321092 | 207 |
| 44 | 3300025917 | Ga0207660_10757170 | Ga0207660_107571701 | 207 |
| 45 | 3300025921 | Ga0207652_10316470 | Ga0207652_103164702 | 207 |
| 46 | 3300033180 | Ga0307510_10075034 | Ga0307510_100750342 | 207 |
| 47 | 3300044656 | Ga0466969_0019181 | Ga0466969_0019181_1055_1747 | 207 |
| 48 | 3300044684 | Ga0466966_0001059 | Ga0466966_0001059_13574_14266 | 207 |
| 49 | 3300044693 | Ga0466961_0000050 | Ga0466961_0000050_9547_10239 | 207 |
| 50 | 3300045049 | Ga0466959_0026668 | Ga0466959_0026668_2298_2990 | 207 |
| 51 | 3300045836 | Ga0466958_0367497 | Ga0466958_0367497_145_837 | 207 |
| 52 | 3300046501 | Ga0495607_0083920 | Ga0495607_0083920_115_807 | 207 |
| 53 | 3300048918 | Ga0496115_0765900 | Ga0496115_0765900_16_663 | 207 |
| 54 | 3300048924 | Ga0496121_0293196 | Ga0496121_0293196_146_862 | 207 |
| 55 | 3300053722 | Ga0500649_063600 | Ga0500649_063600_201_893 | 207 |
| 56 | 3300055283 | Ga0500661_019746 | Ga0500661_019746_285_983 | 207 |
| 57 | 3300038443 | Ga0395901_0173751 | Ga0395901_0173751_691_1380 | 209 |
| 58 | 3300045976 | Ga0466967_0084624 | Ga0466967_0084624_1838_2527 | 209 |
| 59 | 3300039447 | Ga0436361_1114452 | Ga0436361_1114452_725_1420 | 210 |
| 60 | 3300025986 | Ga0207658_10054061 | Ga0207658_100540612 | 211 |
| 61 | 3300031824 | Ga0307413_10197518 | Ga0307413_101975182 | 211 |
| 62 | 3300025981 | Ga0207640_10010275 | Ga0207640_100102754 | 213 |
| 63 | iso_pu_bacteria | 8016603502 | 8016609402 | 213 |
| 64 | iso_pu_bacteria | 2528768022 | 2528849077 | 214 |
| 65 | iso_pu_bacteria | 2824661429 | 2824668506 | 214 |
| 66 | iso_pu_bacteria | 2824753945 | 2824758460 | 214 |
| 67 | iso_pu_bacteria | 2824763712 | 2824770044 | 214 |
| 68 | iso_pu_bacteria | 2879099564 | 2879107043 | 214 |
| 69 | iso_pu_bacteria | 2904711408 | 2904712073 | 214 |
| 70 | iso_pu_bacteria | 2922368715 | 2922372504 | 214 |
| 71 | iso_pu_bacteria | 2929615660 | 2929620932 | 214 |
| 72 | iso_pu_bacteria | 2929624759 | 2929626237 | 214 |
| 73 | iso_pu_bacteria | 2932784394 | 2932784884 | 214 |
| 74 | iso_pu_bacteria | 2932809354 | 2932809918 | 214 |
| 75 | iso_pu_bacteria | 2932818245 | 2932818339 | 214 |
| 76 | iso_pu_bacteria | 2932828146 | 2932828721 | 214 |
| 77 | iso_pu_bacteria | 2933577622 | 2933583198 | 214 |
| 78 | iso_pu_bacteria | 2935616580 | 2935619859 | 214 |
| 79 | iso_pu_bacteria | 2935638405 | 2935638841 | 214 |
| 80 | iso_pu_bacteria | 2935665750 | 2935666309 | 214 |
| 81 | iso_pu_bacteria | 2935675223 | 2935676646 | 214 |
| 82 | iso_pu_bacteria | 2935684952 | 2935685029 | 214 |
| 83 | iso_pu_bacteria | 2935694250 | 2935694725 | 214 |
| 84 | iso_pu_bacteria | 2935703347 | 2935703846 | 214 |
| 85 | iso_pu_bacteria | 2935713505 | 2935713582 | 214 |
| 86 | iso_pu_bacteria | 2935722832 | 2935724202 | 214 |
| 87 | iso_pu_bacteria | 2935732158 | 2935733440 | 214 |
| 88 | iso_pu_bacteria | 2935741537 | 2935742819 | 214 |
| 89 | iso_pu_bacteria | 2935750917 | 2935750994 | 214 |
| 90 | iso_pu_bacteria | 2935760218 | 2935760477 | 214 |
| 91 | iso_pu_bacteria | 2935801545 | 2935801983 | 214 |
| 92 | iso_pu_bacteria | 2935810662 | 2935810752 | 214 |
| 93 | iso_pu_bacteria | 2935827899 | 2935828335 | 214 |
| 94 | iso_pu_bacteria | 2935837841 | 2935839750 | 214 |
| 95 | iso_pu_bacteria | 2935855204 | 2935857826 | 214 |
| 96 | iso_pu_bacteria | 2935864058 | 2935868832 | 214 |
| 97 | iso_pu_bacteria | 2935873716 | 2935874247 | 214 |
| 98 | iso_pu_bacteria | 2935992306 | 2935992828 | 214 |
| 99 | iso_pu_bacteria | 2936002035 | 2936002741 | 214 |
| 100 | iso_pu_bacteria | 2936037263 | 2936037828 | 214 |
| 101 | iso_pu_bacteria | 2940556831 | 2940558203 | 214 |
| 102 | iso_pu_bacteria | 2941538514 | 2941540909 | 214 |
| 103 | iso_pu_bacteria | 8016511872 | 8016520757 | 214 |
| 104 | iso_pu_bacteria | 8017057580 | 8017064829 | 214 |
| 105 | iso_pu_bacteria | 8019576017 | 8019584202 | 214 |
| 106 | iso_pu_bacteria | 8019597564 | 8019599323 | 214 |
| 107 | iso_pu_bacteria | 8019608314 | 8019609035 | 214 |
| 108 | iso_pu_bacteria | 8055742211 | 8055745205 | 214 |
| 109 | 3300048927 | Ga0496124_0029888 | Ga0496124_0029888_37_843 | 215 |
| 110 | 3300048929 | Ga0496126_0411946 | Ga0496126_0411946_302_1081 | 215 |
| 111 | iso_pu_bacteria | 2513237094 | 2513642883 | 215 |
| 112 | iso_pu_bacteria | 2844315083 | 2844319927 | 215 |
| 113 | iso_pu_bacteria | 2885383462 | 2885388300 | 215 |
| 114 | iso_pu_bacteria | 2885409591 | 2885412281 | 215 |
| 115 | iso_pu_bacteria | 2903727486 | 2903730400 | 215 |
| 116 | iso_pu_bacteria | 2906602504 | 2906604667 | 215 |
| 117 | iso_pu_bacteria | 2932794094 | 2932795243 | 215 |
| 118 | iso_pu_bacteria | 2932801729 | 2932805774 | 215 |
| 119 | iso_pu_bacteria | 2935883170 | 2935883856 | 215 |
| 120 | iso_pu_bacteria | 2935959822 | 2935961321 | 215 |
| 121 | iso_pu_bacteria | 2941531003 | 2941531112 | 215 |
| 122 | iso_pu_bacteria | 3005594810 | 3005600206 | 215 |
| 123 | iso_pu_bacteria | 3005718088 | 3005723066 | 215 |
| 124 | iso_pu_bacteria | 8019648815 | 8019649253 | 215 |
| 125 | iso_pu_bacteria | 8056967851 | 8056975167 | 215 |
| 126 | 3300025295 | Ga0209564_1001937 | Ga0209564_10019374 | 216 |
| 127 | 3300048925 | Ga0496122_0024695 | Ga0496122_0024695_2155_2955 | 216 |
| 128 | iso_pu_bacteria | 2507262055 | 2507507748 | 216 |
| 129 | iso_pu_bacteria | 2508501009 | 2508541871 | 216 |
| 130 | iso_pu_bacteria | 2876808645 | 2876814531 | 216 |
| 131 | iso_pu_bacteria | 2879110137 | 2879114626 | 216 |
| 132 | iso_pu_bacteria | 2889033259 | 2889038111 | 216 |
| 133 | iso_pu_bacteria | 2935769743 | 2935772031 | 216 |
| 134 | iso_pu_bacteria | 2935777560 | 2935784206 | 216 |
| 135 | iso_pu_bacteria | 2935785616 | 2935787581 | 216 |
| 136 | iso_pu_bacteria | 2935793552 | 2935796213 | 216 |
| 137 | iso_pu_bacteria | 2936055302 | 2936062067 | 216 |
| 138 | iso_pu_bacteria | 3005710791 | 3005715718 | 216 |
| 139 | iso_pu_bacteria | 8016522445 | 8016528788 | 216 |
| 140 | iso_pu_bacteria | 8016530956 | 8016533969 | 216 |
| 141 | iso_pu_bacteria | 8016539877 | 8016547197 | 216 |
| 142 | iso_pu_bacteria | 8016548790 | 8016554932 | 216 |
| 143 | iso_pu_bacteria | 8016557553 | 8016563299 | 216 |
| 144 | iso_pu_bacteria | 8016566248 | 8016572312 | 216 |
| 145 | iso_pu_bacteria | 8016575299 | 8016576493 | 216 |
| 146 | iso_pu_bacteria | 8016595262 | 8016601051 | 216 |
| 147 | iso_pu_bacteria | 8016613128 | 8016615507 | 216 |
| 148 | iso_pu_bacteria | 8016622563 | 8016625716 | 216 |
| 149 | iso_pu_bacteria | 8019530166 | 8019533742 | 216 |
| 150 | iso_pu_bacteria | 8019538911 | 8019545927 | 216 |
| 151 | iso_pu_bacteria | 8019547302 | 8019552799 | 216 |
| 152 | 3300009101 | Ga0105247_10088313 | Ga0105247_100883132 | 217 |
| 153 | 3300014325 | Ga0163163_10310125 | Ga0163163_103101252 | 217 |
| 154 | 3300048920 | Ga0496117_0066676 | Ga0496117_0066676_1444_2130 | 217 |
| 155 | 3300049575 | Ga0501039_0313739 | Ga0501039_0313739_237_923 | 217 |
| 156 | 3300050492 | nmdc:mga0yw44_23741_c1 | nmdc:mga0yw44_23741_c1_908_1594 | 217 |
| 157 | 3300061734 | Ga0530510_0288941 | Ga0530510_0288941_498_1184 | 217 |
| 158 | 3300005337 | Ga0070682_100512492 | Ga0070682_1005124921 | 218 |
| 159 | 3300005338 | Ga0068868_100284394 | Ga0068868_1002843942 | 218 |
| 160 | 3300005347 | Ga0070668_100074203 | Ga0070668_1000742032 | 218 |
| 161 | 3300005455 | Ga0070663_100035903 | Ga0070663_1000359032 | 218 |
| 162 | 3300005457 | Ga0070662_100280027 | Ga0070662_1002800272 | 218 |
| 163 | 3300005539 | Ga0068853_100228520 | Ga0068853_1002285202 | 218 |
| 164 | 3300005564 | Ga0070664_100530161 | Ga0070664_1005301612 | 218 |
| 165 | 3300005614 | Ga0068856_100461069 | Ga0068856_1004610692 | 218 |
| 166 | 3300005618 | Ga0068864_100321795 | Ga0068864_1003217952 | 218 |
| 167 | 3300005842 | Ga0068858_100293340 | Ga0068858_1002933402 | 218 |
| 168 | 3300005983 | Ga0081540_1008037 | Ga0081540_10080376 | 218 |
| 169 | 3300006038 | Ga0075365_10374404 | Ga0075365_103744042 | 218 |
| 170 | 3300009036 | Ga0105244_10308900 | Ga0105244_103089001 | 218 |
| 171 | 3300009545 | Ga0105237_10131779 | Ga0105237_101317793 | 218 |
| 172 | 3300010375 | Ga0105239_10610254 | Ga0105239_106102542 | 218 |
| 173 | 3300025909 | Ga0207705_10081176 | Ga0207705_100811761 | 218 |
| 174 | 3300025920 | Ga0207649_10474252 | Ga0207649_104742522 | 218 |
| 175 | 3300025972 | Ga0207668_10038842 | Ga0207668_100388422 | 218 |
| 176 | 3300026035 | Ga0207703_10333448 | Ga0207703_103334481 | 218 |
| 177 | 3300026041 | Ga0207639_10054143 | Ga0207639_100541432 | 218 |
| 178 | 3300026067 | Ga0207678_10380464 | Ga0207678_103804642 | 218 |
| 179 | 3300026078 | Ga0207702_10694435 | Ga0207702_106944352 | 218 |
| 180 | 3300026095 | Ga0207676_10522172 | Ga0207676_105221721 | 218 |
| 181 | 3300046462 | Ga0495651_0001520 | Ga0495651_0001520_16969_17658 | 218 |
| 182 | 3300046477 | Ga0495664_0009304 | Ga0495664_0009304_4120_4809 | 218 |
| 183 | 3300046511 | Ga0495608_0041927 | Ga0495608_0041927_1046_1735 | 218 |
| 184 | 3300046515 | Ga0495620_0037367 | Ga0495620_0037367_1014_1703 | 218 |
| 185 | 3300046516 | Ga0495628_0048546 | Ga0495628_0048546_1501_2190 | 218 |
| 186 | 3300046524 | Ga0495648_0035596 | Ga0495648_0035596_1633_2322 | 218 |
| 187 | 3300046529 | Ga0495652_0004137 | Ga0495652_0004137_3726_4415 | 218 |
| 188 | 3300046533 | Ga0495640_0013570 | Ga0495640_0013570_1637_2326 | 218 |
| 189 | 3300046536 | Ga0495587_0099595 | Ga0495587_0099595_395_1084 | 218 |
| 190 | 3300046543 | Ga0495645_0052767 | Ga0495645_0052767_1995_2684 | 218 |
| 191 | 3300046559 | Ga0495667_0001954 | Ga0495667_0001954_9748_10437 | 218 |
| 192 | 3300046648 | Ga0495611_0018442 | Ga0495611_0018442_12_701 | 218 |
| 193 | 3300046663 | Ga0495635_0029484 | Ga0495635_0029484_1749_2438 | 218 |
| 194 | 3300046674 | Ga0495588_0146885 | Ga0495588_0146885_491_1180 | 218 |
| 195 | 3300046675 | Ga0495657_0000889 | Ga0495657_0000889_5615_6304 | 218 |
| 196 | 3300046678 | Ga0495599_0048064 | Ga0495599_0048064_1709_2398 | 218 |
| 197 | 3300046679 | Ga0495623_0005846 | Ga0495623_0005846_5411_6100 | 218 |
| 198 | 3300046680 | Ga0495646_0023476 | Ga0495646_0023476_2399_3088 | 218 |
| 199 | 3300046689 | Ga0495613_0012709 | Ga0495613_0012709_4577_5266 | 218 |
| 200 | 3300046809 | Ga0495600_0051569 | Ga0495600_0051569_1911_2600 | 218 |
| 201 | 3300047317 | Ga0495604_0004282 | Ga0495604_0004282_6379_7068 | 218 |
| 202 | 3300047319 | Ga0495674_0051435 | Ga0495674_0051435_760_1449 | 218 |
| 203 | 3300048088 | Ga0495602_0003401 | Ga0495602_0003401_13351_14040 | 218 |
| 204 | 3300048905 | Ga0496102_0013546 | Ga0496102_0013546_886_1575 | 218 |
| 205 | 3300048906 | Ga0496103_0127918 | Ga0496103_0127918_709_1395 | 218 |
| 206 | 3300048907 | Ga0496104_0037061 | Ga0496104_0037061_586_1275 | 218 |
| 207 | 3300048908 | Ga0496105_0038493 | Ga0496105_0038493_791_1480 | 218 |
| 208 | 3300048910 | Ga0496107_0043926 | Ga0496107_0043926_2009_2698 | 218 |
| 209 | 3300048914 | Ga0496111_0061667 | Ga0496111_0061667_919_1608 | 218 |
| 210 | 3300048915 | Ga0496112_0070807 | Ga0496112_0070807_795_1484 | 218 |
| 211 | 3300048917 | Ga0496114_0025621 | Ga0496114_0025621_2855_3544 | 218 |
| 212 | 3300048918 | Ga0496115_0138877 | Ga0496115_0138877_685_1374 | 218 |
| 213 | 3300048924 | Ga0496121_0077823 | Ga0496121_0077823_1879_2568 | 218 |
| 214 | 3300003762 | Ga0055542_1023569 | Ga0055542_10235691 | 219 |
| 215 | 3300005262 | Ga0065165_1001679 | Ga0065165_10016793 | 219 |
| 216 | 3300005578 | Ga0068854_100030788 | Ga0068854_1000307884 | 219 |
| 217 | 3300005614 | Ga0068856_101219260 | Ga0068856_1012192601 | 219 |
| 218 | 3300005616 | Ga0068852_100017943 | Ga0068852_1000179434 | 219 |
| 219 | 3300009093 | Ga0105240_10016135 | Ga0105240_100161356 | 219 |
| 220 | 3300009545 | Ga0105237_10008696 | Ga0105237_100086962 | 219 |
| 221 | 3300010375 | Ga0105239_10072318 | Ga0105239_100723183 | 219 |
| 222 | 3300025254 | Ga0209148_1000180 | Ga0209148_10001806 | 219 |
| 223 | 3300025261 | Ga0209233_1032716 | Ga0209233_10327162 | 219 |
| 224 | 3300025272 | Ga0209455_1002814 | Ga0209455_10028142 | 219 |
| 225 | 3300025297 | Ga0209758_1004237 | Ga0209758_10042379 | 219 |
| 226 | 3300025302 | Ga0207426_1000998 | Ga0207426_10009982 | 219 |
| 227 | 3300025911 | Ga0207654_10011939 | Ga0207654_100119394 | 219 |
| 228 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008704 | 219 |
| 229 | 3300025914 | Ga0207671_10011774 | Ga0207671_100117746 | 219 |
| 230 | 3300025981 | Ga0207640_10083049 | Ga0207640_100830492 | 219 |
| 231 | 3300026142 | Ga0207698_10003453 | Ga0207698_100034539 | 219 |
| 232 | 3300033180 | Ga0307510_10077445 | Ga0307510_100774452 | 219 |
| 233 | 3300039437 | Ga0436365_0130490 | Ga0436365_0130490_153_845 | 219 |
| 234 | 3300039437 | Ga0436365_1407659 | Ga0436365_1407659_1058_1750 | 219 |
| 235 | 3300042157 | Ga0439458_0023515 | Ga0439458_0023515_501_1190 | 219 |
| 236 | 3300044658 | Ga0466972_0000200 | Ga0466972_0000200_93_785 | 219 |
| 237 | 3300045976 | Ga0466967_0006745 | Ga0466967_0006745_4487_5179 | 219 |
| 238 | 3300046454 | Ga0495592_0240856 | Ga0495592_0240856_70_762 | 219 |
| 239 | 3300046459 | Ga0495629_0001074 | Ga0495629_0001074_20232_20924 | 219 |
| 240 | 3300046460 | Ga0495638_0001532 | Ga0495638_0001532_2898_3590 | 219 |
| 241 | 3300046463 | Ga0495653_0349349 | Ga0495653_0349349_195_887 | 219 |
| 242 | 3300046474 | Ga0495605_0087120 | Ga0495605_0087120_214_906 | 219 |
| 243 | 3300046475 | Ga0495639_0143637 | Ga0495639_0143637_99_791 | 219 |
| 244 | 3300046499 | Ga0495594_0120361 | Ga0495594_0120361_568_1260 | 219 |
| 245 | 3300046506 | Ga0495583_0113473 | Ga0495583_0113473_83_775 | 219 |
| 246 | 3300046507 | Ga0495606_0012281 | Ga0495606_0012281_3571_4263 | 219 |
| 247 | 3300046511 | Ga0495608_0061400 | Ga0495608_0061400_1016_1708 | 219 |
| 248 | 3300046515 | Ga0495620_0053252 | Ga0495620_0053252_826_1518 | 219 |
| 249 | 3300046518 | Ga0495631_0177187 | Ga0495631_0177187_11_703 | 219 |
| 250 | 3300046524 | Ga0495648_0007789 | Ga0495648_0007789_2852_3544 | 219 |
| 251 | 3300046529 | Ga0495652_0116715 | Ga0495652_0116715_783_1475 | 219 |
| 252 | 3300046529 | Ga0495652_0237307 | Ga0495652_0237307_412_1104 | 219 |
| 253 | 3300046533 | Ga0495640_0175586 | Ga0495640_0175586_280_972 | 219 |
| 254 | 3300046557 | Ga0495622_0029823 | Ga0495622_0029823_1317_2009 | 219 |
| 255 | 3300046559 | Ga0495667_0216481 | Ga0495667_0216481_437_1129 | 219 |
| 256 | 3300046642 | Ga0495634_0064051 | Ga0495634_0064051_1651_2343 | 219 |
| 257 | 3300046660 | Ga0495625_0118546 | Ga0495625_0118546_924_1616 | 219 |
| 258 | 3300046663 | Ga0495635_0038884 | Ga0495635_0038884_2271_2963 | 219 |
| 259 | 3300046675 | Ga0495657_0013750 | Ga0495657_0013750_896_1588 | 219 |
| 260 | 3300046680 | Ga0495646_0069412 | Ga0495646_0069412_1325_2017 | 219 |
| 261 | 3300046689 | Ga0495613_0010887 | Ga0495613_0010887_414_1106 | 219 |
| 262 | 3300046690 | Ga0495624_0036110 | Ga0495624_0036110_1923_2615 | 219 |
| 263 | 3300046694 | Ga0495649_0006966 | Ga0495649_0006966_3800_4492 | 219 |
| 264 | 3300046809 | Ga0495600_0001856 | Ga0495600_0001856_792_1484 | 219 |
| 265 | 3300047317 | Ga0495604_0043497 | Ga0495604_0043497_692_1384 | 219 |
| 266 | 3300047321 | Ga0495676_0030358 | Ga0495676_0030358_424_1116 | 219 |
| 267 | 3300047322 | Ga0495680_0002530 | Ga0495680_0002530_13016_13708 | 219 |
| 268 | 3300047444 | Ga0495675_0025330 | Ga0495675_0025330_1989_2681 | 219 |
| 269 | 3300047471 | Ga0495684_0088708 | Ga0495684_0088708_1542_2234 | 219 |
| 270 | 3300047472 | Ga0495686_0042724 | Ga0495686_0042724_259_951 | 219 |
| 271 | 3300047472 | Ga0495686_0075836 | Ga0495686_0075836_332_1024 | 219 |
| 272 | 3300047673 | Ga0495593_0197116 | Ga0495593_0197116_107_799 | 219 |
| 273 | 3300048088 | Ga0495602_0345942 | Ga0495602_0345942_361_1053 | 219 |
| 274 | 3300048905 | Ga0496102_0105735 | Ga0496102_0105735_1878_2570 | 219 |
| 275 | 3300048907 | Ga0496104_0000281 | Ga0496104_0000281_20671_21363 | 219 |
| 276 | 3300048908 | Ga0496105_0011220 | Ga0496105_0011220_4474_5166 | 219 |
| 277 | 3300048916 | Ga0496113_0141201 | Ga0496113_0141201_758_1450 | 219 |
| 278 | 3300048917 | Ga0496114_0269795 | Ga0496114_0269795_477_1169 | 219 |
| 279 | 3300048918 | Ga0496115_0026056 | Ga0496115_0026056_3637_4329 | 219 |
| 280 | 3300048921 | Ga0496118_0219110 | Ga0496118_0219110_145_837 | 219 |
| 281 | 3300048922 | Ga0496119_0005325 | Ga0496119_0005325_575_1267 | 219 |
| 282 | 3300048923 | Ga0496120_0001511 | Ga0496120_0001511_19175_19867 | 219 |
| 283 | 3300048924 | Ga0496121_0373635 | Ga0496121_0373635_30_722 | 219 |
| 284 | 3300048926 | Ga0496123_0267797 | Ga0496123_0267797_117_809 | 219 |
| 285 | 3300048929 | Ga0496126_0088669 | Ga0496126_0088669_1136_1828 | 219 |
| 286 | 3300049460 | Ga0495682_0009193 | Ga0495682_0009193_770_1462 | 219 |
| 287 | 3300053084 | Ga0495595_0124545 | Ga0495595_0124545_70_762 | 219 |
| 288 | 3300053085 | Ga0495619_0133418 | Ga0495619_0133418_940_1632 | 219 |
| 289 | 3300053087 | Ga0500643_000319 | Ga0500643_000319_16188_16880 | 219 |
| 290 | 3300053096 | Ga0500641_0216751 | Ga0500641_0216751_110_802 | 219 |
| 291 | 3300053119 | Ga0500595_008531 | Ga0500595_008531_2692_3384 | 219 |
| 292 | 3300053136 | Ga0500559_0187967 | Ga0500559_0187967_19_711 | 219 |
| 293 | 3300053156 | Ga0500622_0007294 | Ga0500622_0007294_344_1036 | 219 |
| 294 | 3300053732 | Ga0500656_005620 | Ga0500656_005620_157_849 | 219 |
| 295 | iso_pu_bacteria | 2508501128 | 2509149395 | 219 |
| 296 | 3300003215 | JGI25153J46596_10016218 | JGI25153J46596_100162182 | 220 |
| 297 | 3300014325 | Ga0163163_10494014 | Ga0163163_104940142 | 220 |
| 298 | 3300025302 | Ga0207426_1021924 | Ga0207426_10219241 | 220 |
| 299 | 3300037471 | Ga0395905_0009682 | Ga0395905_0009682_5953_6648 | 220 |
| 300 | 3300048907 | Ga0496104_0143567 | Ga0496104_0143567_108_800 | 220 |
| 301 | 3300048909 | Ga0496106_0107271 | Ga0496106_0107271_258_950 | 220 |
| 302 | 3300048916 | Ga0496113_0281929 | Ga0496113_0281929_128_820 | 220 |
| 303 | 3300048919 | Ga0496116_0158272 | Ga0496116_0158272_240_932 | 220 |
| 304 | 3300048929 | Ga0496126_0141281 | Ga0496126_0141281_408_1103 | 220 |
| 305 | 3300050513 | nmdc:mga0rr50_588152_c1 | nmdc:mga0rr50_588152_c1_14_706 | 220 |
| 306 | 3300053105 | Ga0500557_001651 | Ga0500557_001651_1933_2628 | 220 |
| 307 | 3300053130 | Ga0500642_0000057 | Ga0500642_0000057_18097_18792 | 220 |
| 308 | 3300053729 | Ga0500625_002930 | Ga0500625_002930_3942_4637 | 220 |
| 309 | iso_pu_bacteria | 2791355199 | 2793084134 | 220 |
| 310 | iso_pu_bacteria | 8056673599 | 8056681018 | 220 |
| 311 | 3300033544 | Ga0316215_1003920 | Ga0316215_10039201 | 221 |
| 312 | 3300036459 | Ga0372808_001591 | Ga0372808_001591_633_1346 | 221 |
| 313 | iso_pu_bacteria | 2513237101 | 2513695809 | 221 |
| 314 | iso_pu_bacteria | 2874604998 | 2874607294 | 221 |
| 315 | iso_pu_bacteria | 8006994254 | 8006994810 | 221 |
| 316 | 3300005985 | Ga0081539_10000113 | Ga0081539_1000011353 | 222 |
| 317 | 3300031249 | Ga0265339_10002027 | Ga0265339_1000202711 | 222 |
| 318 | 3300031616 | Ga0307508_10000249 | Ga0307508_1000024916 | 222 |
| 319 | 3300046507 | Ga0495606_0322119 | Ga0495606_0322119_49_726 | 222 |
| 320 | 3300053077 | Ga0495601_0148205 | Ga0495601_0148205_375_1079 | 222 |
| 321 | iso_pu_bacteria | 8006964411 | 8006968362 | 222 |
| 322 | iso_pu_bacteria | 8006984368 | 8006989198 | 222 |
| 323 | 3300005331 | Ga0070670_100700020 | Ga0070670_1007000201 | 223 |
| 324 | 3300005341 | Ga0070691_10116771 | Ga0070691_101167712 | 223 |
| 325 | 3300005548 | Ga0070665_100420931 | Ga0070665_1004209312 | 223 |
| 326 | 3300005563 | Ga0068855_101018964 | Ga0068855_1010189641 | 223 |
| 327 | 3300009148 | Ga0105243_10088683 | Ga0105243_100886831 | 223 |
| 328 | 3300009553 | Ga0105249_10196025 | Ga0105249_101960251 | 223 |
| 329 | 3300013105 | Ga0157369_10275996 | Ga0157369_102759962 | 223 |
| 330 | 3300014968 | Ga0157379_10365802 | Ga0157379_103658022 | 223 |
| 331 | 3300025935 | Ga0207709_10022516 | Ga0207709_100225163 | 223 |
| 332 | 3300030863 | Ga0265766_1004717 | Ga0265766_10047171 | 223 |
| 333 | 3300031711 | Ga0265314_10014031 | Ga0265314_100140313 | 223 |
| 334 | 3300039438 | Ga0436360_1009642 | Ga0436360_1009642_107_811 | 223 |
| 335 | 3300046558 | Ga0495633_0168187 | Ga0495633_0168187_242_946 | 223 |
| 336 | 3300046684 | Ga0495669_0001878 | Ga0495669_0001878_7512_8216 | 223 |
| 337 | 3300046694 | Ga0495649_0094642 | Ga0495649_0094642_643_1347 | 223 |
| 338 | 3300047445 | Ga0495677_0017120 | Ga0495677_0017120_447_1151 | 223 |
| 339 | 3300048903 | Ga0496100_0097636 | Ga0496100_0097636_1184_1888 | 223 |
| 340 | 3300048904 | Ga0496101_0163170 | Ga0496101_0163170_626_1330 | 223 |
| 341 | 3300048905 | Ga0496102_0133818 | Ga0496102_0133818_313_1017 | 223 |
| 342 | 3300049586 | Ga0501070_0614443 | Ga0501070_0614443_52_759 | 223 |
| 343 | 3300050490 | nmdc:mga03n38_45781_c1 | nmdc:mga03n38_45781_c1_642_1346 | 223 |
| 344 | 3300002244 | JGI24742J22300_10016348 | JGI24742J22300_100163481 | 224 |
| 345 | 3300005328 | Ga0070676_10220090 | Ga0070676_102200901 | 224 |
| 346 | 3300005329 | Ga0070683_100265873 | Ga0070683_1002658732 | 224 |
| 347 | 3300005333 | Ga0070677_10111798 | Ga0070677_101117981 | 224 |
| 348 | 3300005338 | Ga0068868_100287279 | Ga0068868_1002872791 | 224 |
| 349 | 3300005340 | Ga0070689_100235139 | Ga0070689_1002351391 | 224 |
| 350 | 3300005344 | Ga0070661_100256092 | Ga0070661_1002560922 | 224 |
| 351 | 3300005347 | Ga0070668_100097490 | Ga0070668_1000974902 | 224 |
| 352 | 3300005355 | Ga0070671_100040143 | Ga0070671_1000401434 | 224 |
| 353 | 3300005356 | Ga0070674_100195147 | Ga0070674_1001951472 | 224 |
| 354 | 3300005367 | Ga0070667_100053267 | Ga0070667_1000532673 | 224 |
| 355 | 3300005456 | Ga0070678_100117476 | Ga0070678_1001174762 | 224 |
| 356 | 3300005456 | Ga0070678_100301591 | Ga0070678_1003015912 | 224 |
| 357 | 3300005457 | Ga0070662_100035056 | Ga0070662_1000350562 | 224 |
| 358 | 3300005530 | Ga0070679_100681457 | Ga0070679_1006814571 | 224 |
| 359 | 3300005563 | Ga0068855_100474313 | Ga0068855_1004743132 | 224 |
| 360 | 3300005564 | Ga0070664_100583946 | Ga0070664_1005839462 | 224 |
| 361 | 3300005578 | Ga0068854_100129469 | Ga0068854_1001294692 | 224 |
| 362 | 3300005616 | Ga0068852_100626453 | Ga0068852_1006264532 | 224 |
| 363 | 3300005718 | Ga0068866_10146159 | Ga0068866_101461592 | 224 |
| 364 | 3300005718 | Ga0068866_10326683 | Ga0068866_103266832 | 224 |
| 365 | 3300005834 | Ga0068851_10042199 | Ga0068851_100421992 | 224 |
| 366 | 3300005840 | Ga0068870_10070972 | Ga0068870_100709722 | 224 |
| 367 | 3300005843 | Ga0068860_100190338 | Ga0068860_1001903382 | 224 |
| 368 | 3300005844 | Ga0068862_100391869 | Ga0068862_1003918692 | 224 |
| 369 | 3300005937 | Ga0081455_10060751 | Ga0081455_100607511 | 224 |
| 370 | 3300005983 | Ga0081540_1018689 | Ga0081540_10186894 | 224 |
| 371 | 3300006042 | Ga0075368_10051916 | Ga0075368_100519162 | 224 |
| 372 | 3300006178 | Ga0075367_10026278 | Ga0075367_100262783 | 224 |
| 373 | 3300006186 | Ga0075369_10067465 | Ga0075369_100674652 | 224 |
| 374 | 3300006237 | Ga0097621_100135110 | Ga0097621_1001351102 | 224 |
| 375 | 3300006358 | Ga0068871_100263951 | Ga0068871_1002639512 | 224 |
| 376 | 3300006881 | Ga0068865_100260196 | Ga0068865_1002601962 | 224 |
| 377 | 3300009092 | Ga0105250_10097006 | Ga0105250_100970062 | 224 |
| 378 | 3300009098 | Ga0105245_10209432 | Ga0105245_102094322 | 224 |
| 379 | 3300009174 | Ga0105241_10292233 | Ga0105241_102922332 | 224 |
| 380 | 3300009176 | Ga0105242_10225935 | Ga0105242_102259352 | 224 |
| 381 | 3300009177 | Ga0105248_10232856 | Ga0105248_102328562 | 224 |
| 382 | 3300009545 | Ga0105237_10439844 | Ga0105237_104398442 | 224 |
| 383 | 3300011119 | Ga0105246_10060031 | Ga0105246_100600312 | 224 |
| 384 | 3300013296 | Ga0157374_10088341 | Ga0157374_100883412 | 224 |
| 385 | 3300013306 | Ga0163162_10111361 | Ga0163162_101113612 | 224 |
| 386 | 3300013306 | Ga0163162_10337595 | Ga0163162_103375952 | 224 |
| 387 | 3300013307 | Ga0157372_10947817 | Ga0157372_109478172 | 224 |
| 388 | 3300013308 | Ga0157375_10581703 | Ga0157375_105817031 | 224 |
| 389 | 3300014968 | Ga0157379_10298324 | Ga0157379_102983242 | 224 |
| 390 | 3300014969 | Ga0157376_10008594 | Ga0157376_100085947 | 224 |
| 391 | 3300017792 | Ga0163161_10022770 | Ga0163161_100227705 | 224 |
| 392 | 3300025899 | Ga0207642_10119142 | Ga0207642_101191421 | 224 |
| 393 | 3300025901 | Ga0207688_10047639 | Ga0207688_100476392 | 224 |
| 394 | 3300025901 | Ga0207688_10127135 | Ga0207688_101271352 | 224 |
| 395 | 3300025911 | Ga0207654_10194199 | Ga0207654_101941992 | 224 |
| 396 | 3300025919 | Ga0207657_10310272 | Ga0207657_103102722 | 224 |
| 397 | 3300025920 | Ga0207649_10177172 | Ga0207649_101771722 | 224 |
| 398 | 3300025927 | Ga0207687_10044667 | Ga0207687_100446672 | 224 |
| 399 | 3300025931 | Ga0207644_10106269 | Ga0207644_101062691 | 224 |
| 400 | 3300025932 | Ga0207690_10230331 | Ga0207690_102303312 | 224 |
| 401 | 3300025933 | Ga0207706_10076024 | Ga0207706_100760242 | 224 |
| 402 | 3300025936 | Ga0207670_10244497 | Ga0207670_102444972 | 224 |
| 403 | 3300025937 | Ga0207669_10113998 | Ga0207669_101139982 | 224 |
| 404 | 3300025940 | Ga0207691_10344280 | Ga0207691_103442802 | 224 |
| 405 | 3300025941 | Ga0207711_10394178 | Ga0207711_103941782 | 224 |
| 406 | 3300025949 | Ga0207667_10574287 | Ga0207667_105742872 | 224 |
| 407 | 3300025961 | Ga0207712_10131060 | Ga0207712_101310602 | 224 |
| 408 | 3300025972 | Ga0207668_10116812 | Ga0207668_101168122 | 224 |
| 409 | 3300026023 | Ga0207677_10495634 | Ga0207677_104956342 | 224 |
| 410 | 3300026067 | Ga0207678_10077729 | Ga0207678_100777292 | 224 |
| 411 | 3300026067 | Ga0207678_10474669 | Ga0207678_104746692 | 224 |
| 412 | 3300026067 | Ga0207678_10508965 | Ga0207678_105089652 | 224 |
| 413 | 3300026088 | Ga0207641_10805848 | Ga0207641_108058482 | 224 |
| 414 | 3300026089 | Ga0207648_10234412 | Ga0207648_102344122 | 224 |
| 415 | 3300026095 | Ga0207676_10938721 | Ga0207676_109387211 | 224 |
| 416 | 3300026121 | Ga0207683_10055407 | Ga0207683_100554072 | 224 |
| 417 | 3300026121 | Ga0207683_10606486 | Ga0207683_106064862 | 224 |
| 418 | 3300031456 | Ga0307513_10160001 | Ga0307513_101600012 | 224 |
| 419 | 3300032126 | Ga0307415_100628855 | Ga0307415_1006288552 | 224 |
| 420 | 3300041413 | Ga0439465_0092680 | Ga0439465_0092680_121_828 | 224 |
| 421 | 3300041512 | Ga0451853_1916674 | Ga0451853_1916674_174_878 | 224 |
| 422 | 3300046462 | Ga0495651_0198724 | Ga0495651_0198724_548_1252 | 224 |
| 423 | 3300046539 | Ga0495621_0072084 | Ga0495621_0072084_500_1207 | 224 |
| 424 | 3300046558 | Ga0495633_0177272 | Ga0495633_0177272_204_911 | 224 |
| 425 | 3300046615 | Ga0495656_0127132 | Ga0495656_0127132_462_1169 | 224 |
| 426 | 3300046616 | Ga0495668_0046611 | Ga0495668_0046611_309_1016 | 224 |
| 427 | 3300046616 | Ga0495668_0207276 | Ga0495668_0207276_235_939 | 224 |
| 428 | 3300046684 | Ga0495669_0214743 | Ga0495669_0214743_94_801 | 224 |
| 429 | 3300046691 | Ga0495670_0283774 | Ga0495670_0283774_65_772 | 224 |
| 430 | 3300047320 | Ga0495672_0072363 | Ga0495672_0072363_374_1081 | 224 |
| 431 | 3300047320 | Ga0495672_0096380 | Ga0495672_0096380_899_1603 | 224 |
| 432 | 3300047472 | Ga0495686_0234383 | Ga0495686_0234383_110_817 | 224 |
| 433 | 3300047673 | Ga0495593_0054177 | Ga0495593_0054177_872_1579 | 224 |
| 434 | 3300048090 | Ga0495615_0037754 | Ga0495615_0037754_368_1075 | 224 |
| 435 | 3300048903 | Ga0496100_0047643 | Ga0496100_0047643_746_1456 | 224 |
| 436 | 3300048903 | Ga0496100_0529006 | Ga0496100_0529006_16_723 | 224 |
| 437 | 3300048904 | Ga0496101_0006609 | Ga0496101_0006609_1158_1868 | 224 |
| 438 | 3300048904 | Ga0496101_0252853 | Ga0496101_0252853_468_1175 | 224 |
| 439 | 3300048905 | Ga0496102_0083160 | Ga0496102_0083160_1986_2696 | 224 |
| 440 | 3300048907 | Ga0496104_0008421 | Ga0496104_0008421_3291_4001 | 224 |
| 441 | 3300048908 | Ga0496105_0061759 | Ga0496105_0061759_507_1217 | 224 |
| 442 | 3300048909 | Ga0496106_0006503 | Ga0496106_0006503_7622_8332 | 224 |
| 443 | 3300048910 | Ga0496107_0019745 | Ga0496107_0019745_3145_3855 | 224 |
| 444 | 3300048910 | Ga0496107_0364426 | Ga0496107_0364426_38_745 | 224 |
| 445 | 3300048911 | Ga0496108_0277701 | Ga0496108_0277701_357_1067 | 224 |
| 446 | 3300048913 | Ga0496110_0117351 | Ga0496110_0117351_1367_2077 | 224 |
| 447 | 3300048913 | Ga0496110_0238866 | Ga0496110_0238866_187_894 | 224 |
| 448 | 3300048914 | Ga0496111_0058971 | Ga0496111_0058971_88_798 | 224 |
| 449 | 3300048916 | Ga0496113_0122738 | Ga0496113_0122738_347_1057 | 224 |
| 450 | 3300048917 | Ga0496114_0034287 | Ga0496114_0034287_3278_3988 | 224 |
| 451 | 3300048918 | Ga0496115_0001082 | Ga0496115_0001082_1720_2430 | 224 |
| 452 | 3300048925 | Ga0496122_0014132 | Ga0496122_0014132_6912_7622 | 224 |
| 453 | 3300048929 | Ga0496126_0038456 | Ga0496126_0038456_120_830 | 224 |
| 454 | 3300048929 | Ga0496126_0433651 | Ga0496126_0433651_237_944 | 224 |
| 455 | 3300049824 | Ga0501045_0231428 | Ga0501045_0231428_230_937 | 224 |
| 456 | 3300050490 | nmdc:mga03n38_72315_c1 | nmdc:mga03n38_72315_c1_469_1176 | 224 |
| 457 | 3300050494 | nmdc:mga06z11_240560_c1 | nmdc:mga06z11_240560_c1_200_907 | 224 |
| 458 | 3300050511 | nmdc:mga08y16_492555_c1 | nmdc:mga08y16_492555_c1_185_895 | 224 |
| 459 | 3300050516 | nmdc:mga0sz30_144776_c1 | nmdc:mga0sz30_144776_c1_132_839 | 224 |
| 460 | 3300053096 | Ga0500641_0023473 | Ga0500641_0023473_213_920 | 224 |
| 461 | 3300003215 | JGI25153J46596_10002094 | JGI25153J46596_100020944 | 225 |
| 462 | 3300005436 | Ga0070713_100162789 | Ga0070713_1001627892 | 225 |
| 463 | 3300005548 | Ga0070665_100090409 | Ga0070665_1000904093 | 225 |
| 464 | 3300005718 | Ga0068866_10466703 | Ga0068866_104667031 | 225 |
| 465 | 3300005937 | Ga0081455_10057793 | Ga0081455_100577932 | 225 |
| 466 | 3300005937 | Ga0081455_10472183 | Ga0081455_104721831 | 225 |
| 467 | 3300005985 | Ga0081539_10039747 | Ga0081539_100397473 | 225 |
| 468 | 3300006028 | Ga0070717_10825047 | Ga0070717_108250471 | 225 |
| 469 | 3300006042 | Ga0075368_10186359 | Ga0075368_101863591 | 225 |
| 470 | 3300006048 | Ga0075363_100138607 | Ga0075363_1001386072 | 225 |
| 471 | 3300006177 | Ga0075362_10010927 | Ga0075362_100109274 | 225 |
| 472 | 3300006195 | Ga0075366_10276803 | Ga0075366_102768032 | 225 |
| 473 | 3300013297 | Ga0157378_10009387 | Ga0157378_100093876 | 225 |
| 474 | 3300025297 | Ga0209758_1007006 | Ga0209758_10070065 | 225 |
| 475 | 3300025915 | Ga0207693_10008179 | Ga0207693_100081796 | 225 |
| 476 | 3300025928 | Ga0207700_10071868 | Ga0207700_100718683 | 225 |
| 477 | 3300026067 | Ga0207678_10095176 | Ga0207678_100951762 | 225 |
| 478 | 3300026067 | Ga0207678_10109551 | Ga0207678_101095512 | 225 |
| 479 | 3300026142 | Ga0207698_10930600 | Ga0207698_109306001 | 225 |
| 480 | 3300027866 | Ga0209813_10124070 | Ga0209813_101240702 | 225 |
| 481 | 3300028379 | Ga0268266_10283021 | Ga0268266_102830212 | 225 |
| 482 | 3300028786 | Ga0307517_10001507 | Ga0307517_1000150711 | 225 |
| 483 | 3300031711 | Ga0265314_10048593 | Ga0265314_100485932 | 225 |
| 484 | 3300046459 | Ga0495629_0045299 | Ga0495629_0045299_1939_2649 | 225 |
| 485 | 3300046471 | Ga0495650_0055945 | Ga0495650_0055945_217_924 | 225 |
| 486 | 3300046518 | Ga0495631_0170169 | Ga0495631_0170169_93_803 | 225 |
| 487 | 3300046615 | Ga0495656_0107535 | Ga0495656_0107535_413_1123 | 225 |
| 488 | 3300048907 | Ga0496104_0480999 | Ga0496104_0480999_388_1098 | 225 |
| 489 | 3300048918 | Ga0496115_0385966 | Ga0496115_0385966_273_983 | 225 |
| 490 | 3300048922 | Ga0496119_0111262 | Ga0496119_0111262_226_933 | 225 |
| 491 | 3300049583 | Ga0501067_0029147 | Ga0501067_0029147_128_838 | 225 |
| 492 | 3300049587 | Ga0501071_0175580 | Ga0501071_0175580_775_1485 | 225 |
| 493 | 3300053147 | Ga0500589_085098 | Ga0500589_085098_187_897 | 225 |
| 494 | 3300060346 | Ga0587111_0024083 | Ga0587111_0024083_178_888 | 225 |
| 495 | 3300001989 | JGI24739J22299_10001037 | JGI24739J22299_100010374 | 226 |
| 496 | 3300001990 | JGI24737J22298_10001787 | JGI24737J22298_100017878 | 226 |
| 497 | 3300005334 | Ga0068869_100158664 | Ga0068869_1001586642 | 226 |
| 498 | 3300005335 | Ga0070666_10175194 | Ga0070666_101751942 | 226 |
| 499 | 3300005337 | Ga0070682_100116467 | Ga0070682_1001164672 | 226 |
| 500 | 3300005340 | Ga0070689_100308544 | Ga0070689_1003085442 | 226 |
| 501 | 3300005347 | Ga0070668_100023792 | Ga0070668_1000237922 | 226 |
| 502 | 3300005347 | Ga0070668_100174605 | Ga0070668_1001746052 | 226 |
| 503 | 3300005353 | Ga0070669_100155575 | Ga0070669_1001555752 | 226 |
| 504 | 3300005353 | Ga0070669_100324730 | Ga0070669_1003247302 | 226 |
| 505 | 3300005355 | Ga0070671_100068060 | Ga0070671_1000680602 | 226 |
| 506 | 3300005356 | Ga0070674_100573592 | Ga0070674_1005735922 | 226 |
| 507 | 3300005367 | Ga0070667_100124352 | Ga0070667_1001243522 | 226 |
| 508 | 3300005406 | Ga0070703_10041790 | Ga0070703_100417902 | 226 |
| 509 | 3300005438 | Ga0070701_10080884 | Ga0070701_100808842 | 226 |
| 510 | 3300005440 | Ga0070705_100048404 | Ga0070705_1000484042 | 226 |
| 511 | 3300005441 | Ga0070700_100072913 | Ga0070700_1000729132 | 226 |
| 512 | 3300005455 | Ga0070663_100010640 | Ga0070663_1000106405 | 226 |
| 513 | 3300005455 | Ga0070663_100044846 | Ga0070663_1000448462 | 226 |
| 514 | 3300005455 | Ga0070663_100198687 | Ga0070663_1001986872 | 226 |
| 515 | 3300005456 | Ga0070678_100304945 | Ga0070678_1003049452 | 226 |
| 516 | 3300005456 | Ga0070678_100358655 | Ga0070678_1003586552 | 226 |
| 517 | 3300005457 | Ga0070662_100092022 | Ga0070662_1000920222 | 226 |
| 518 | 3300005457 | Ga0070662_100122315 | Ga0070662_1001223152 | 226 |
| 519 | 3300005458 | Ga0070681_10026475 | Ga0070681_100264753 | 226 |
| 520 | 3300005459 | Ga0068867_100637118 | Ga0068867_1006371181 | 226 |
| 521 | 3300005471 | Ga0070698_100496964 | Ga0070698_1004969642 | 226 |
| 522 | 3300005539 | Ga0068853_100031622 | Ga0068853_1000316222 | 226 |
| 523 | 3300005539 | Ga0068853_100107416 | Ga0068853_1001074162 | 226 |
| 524 | 3300005548 | Ga0070665_100277043 | Ga0070665_1002770432 | 226 |
| 525 | 3300005548 | Ga0070665_100429234 | Ga0070665_1004292342 | 226 |
| 526 | 3300005549 | Ga0070704_100335799 | Ga0070704_1003357992 | 226 |
| 527 | 3300005549 | Ga0070704_100416330 | Ga0070704_1004163302 | 226 |
| 528 | 3300005563 | Ga0068855_100022161 | Ga0068855_1000221615 | 226 |
| 529 | 3300005563 | Ga0068855_100083223 | Ga0068855_1000832233 | 226 |
| 530 | 3300005577 | Ga0068857_100023313 | Ga0068857_1000233132 | 226 |
| 531 | 3300005578 | Ga0068854_100003845 | Ga0068854_1000038454 | 226 |
| 532 | 3300005614 | Ga0068856_100011815 | Ga0068856_1000118154 | 226 |
| 533 | 3300005614 | Ga0068856_100026604 | Ga0068856_1000266042 | 226 |
| 534 | 3300005615 | Ga0070702_100198995 | Ga0070702_1001989952 | 226 |
| 535 | 3300005616 | Ga0068852_100002580 | Ga0068852_1000025809 | 226 |
| 536 | 3300005616 | Ga0068852_100538403 | Ga0068852_1005384032 | 226 |
| 537 | 3300005617 | Ga0068859_100039596 | Ga0068859_1000395964 | 226 |
| 538 | 3300005617 | Ga0068859_100116649 | Ga0068859_1001166494 | 226 |
| 539 | 3300005618 | Ga0068864_100012188 | Ga0068864_1000121882 | 226 |
| 540 | 3300005618 | Ga0068864_100344220 | Ga0068864_1003442202 | 226 |
| 541 | 3300005719 | Ga0068861_100141288 | Ga0068861_1001412882 | 226 |
| 542 | 3300005834 | Ga0068851_10010036 | Ga0068851_100100365 | 226 |
| 543 | 3300005834 | Ga0068851_10059289 | Ga0068851_100592892 | 226 |
| 544 | 3300005840 | Ga0068870_10048002 | Ga0068870_100480022 | 226 |
| 545 | 3300005841 | Ga0068863_100075669 | Ga0068863_1000756694 | 226 |
| 546 | 3300005842 | Ga0068858_100233873 | Ga0068858_1002338732 | 226 |
| 547 | 3300005842 | Ga0068858_100385329 | Ga0068858_1003853291 | 226 |
| 548 | 3300005843 | Ga0068860_100108861 | Ga0068860_1001088612 | 226 |
| 549 | 3300005843 | Ga0068860_100375687 | Ga0068860_1003756872 | 226 |
| 550 | 3300005843 | Ga0068860_100379761 | Ga0068860_1003797612 | 226 |
| 551 | 3300005844 | Ga0068862_100070369 | Ga0068862_1000703692 | 226 |
| 552 | 3300005844 | Ga0068862_100118140 | Ga0068862_1001181402 | 226 |
| 553 | 3300005844 | Ga0068862_100649480 | Ga0068862_1006494802 | 226 |
| 554 | 3300005983 | Ga0081540_1000575 | Ga0081540_10005756 | 226 |
| 555 | 3300005983 | Ga0081540_1012391 | Ga0081540_10123915 | 226 |
| 556 | 3300005983 | Ga0081540_1023497 | Ga0081540_10234973 | 226 |
| 557 | 3300005983 | Ga0081540_1034892 | Ga0081540_10348922 | 226 |
| 558 | 3300005983 | Ga0081540_1074758 | Ga0081540_10747582 | 226 |
| 559 | 3300006038 | Ga0075365_10024932 | Ga0075365_100249322 | 226 |
| 560 | 3300006038 | Ga0075365_10050581 | Ga0075365_100505814 | 226 |
| 561 | 3300006042 | Ga0075368_10083503 | Ga0075368_100835032 | 226 |
| 562 | 3300006177 | Ga0075362_10014438 | Ga0075362_100144384 | 226 |
| 563 | 3300006178 | Ga0075367_10138782 | Ga0075367_101387822 | 226 |
| 564 | 3300006195 | Ga0075366_10039208 | Ga0075366_100392082 | 226 |
| 565 | 3300006195 | Ga0075366_10107024 | Ga0075366_101070242 | 226 |
| 566 | 3300006358 | Ga0068871_100095962 | Ga0068871_1000959622 | 226 |
| 567 | 3300006844 | Ga0075428_100190956 | Ga0075428_1001909562 | 226 |
| 568 | 3300006847 | Ga0075431_100439372 | Ga0075431_1004393722 | 226 |
| 569 | 3300006914 | Ga0075436_100163073 | Ga0075436_1001630732 | 226 |
| 570 | 3300006931 | Ga0097620_100039598 | Ga0097620_1000395984 | 226 |
| 571 | 3300006931 | Ga0097620_100116651 | Ga0097620_1001166514 | 226 |
| 572 | 3300007788 | Ga0099795_10092135 | Ga0099795_100921352 | 226 |
| 573 | 3300009093 | Ga0105240_10082005 | Ga0105240_100820054 | 226 |
| 574 | 3300009093 | Ga0105240_10141161 | Ga0105240_101411612 | 226 |
| 575 | 3300009098 | Ga0105245_10126611 | Ga0105245_101266113 | 226 |
| 576 | 3300009101 | Ga0105247_10123500 | Ga0105247_101235002 | 226 |
| 577 | 3300009101 | Ga0105247_10197944 | Ga0105247_101979442 | 226 |
| 578 | 3300009147 | Ga0114129_10631316 | Ga0114129_106313162 | 226 |
| 579 | 3300009148 | Ga0105243_10120222 | Ga0105243_101202222 | 226 |
| 580 | 3300009174 | Ga0105241_10001401 | Ga0105241_1000140114 | 226 |
| 581 | 3300009174 | Ga0105241_10046934 | Ga0105241_100469342 | 226 |
| 582 | 3300009177 | Ga0105248_10184198 | Ga0105248_101841982 | 226 |
| 583 | 3300009545 | Ga0105237_10058881 | Ga0105237_100588813 | 226 |
| 584 | 3300009545 | Ga0105237_10598622 | Ga0105237_105986222 | 226 |
| 585 | 3300009551 | Ga0105238_10006652 | Ga0105238_100066525 | 226 |
| 586 | 3300009551 | Ga0105238_10011666 | Ga0105238_100116666 | 226 |
| 587 | 3300009553 | Ga0105249_10314377 | Ga0105249_103143772 | 226 |
| 588 | 3300009553 | Ga0105249_11088917 | Ga0105249_110889172 | 226 |
| 589 | 3300010375 | Ga0105239_10004659 | Ga0105239_100046592 | 226 |
| 590 | 3300010375 | Ga0105239_10133836 | Ga0105239_101338362 | 226 |
| 591 | 3300011119 | Ga0105246_10140977 | Ga0105246_101409772 | 226 |
| 592 | 3300013296 | Ga0157374_10292096 | Ga0157374_102920962 | 226 |
| 593 | 3300013296 | Ga0157374_10450379 | Ga0157374_104503792 | 226 |
| 594 | 3300013297 | Ga0157378_10267217 | Ga0157378_102672172 | 226 |
| 595 | 3300013306 | Ga0163162_10183755 | Ga0163162_101837552 | 226 |
| 596 | 3300013306 | Ga0163162_11365129 | Ga0163162_113651292 | 226 |
| 597 | 3300014745 | Ga0157377_10082014 | Ga0157377_100820142 | 226 |
| 598 | 3300014968 | Ga0157379_10109480 | Ga0157379_101094802 | 226 |
| 599 | 3300014968 | Ga0157379_10431000 | Ga0157379_104310001 | 226 |
| 600 | 3300025297 | Ga0209758_1012541 | Ga0209758_10125412 | 226 |
| 601 | 3300025321 | Ga0207656_10008182 | Ga0207656_100081823 | 226 |
| 602 | 3300025885 | Ga0207653_10004937 | Ga0207653_100049372 | 226 |
| 603 | 3300025901 | Ga0207688_10018719 | Ga0207688_100187192 | 226 |
| 604 | 3300025901 | Ga0207688_10059448 | Ga0207688_100594482 | 226 |
| 605 | 3300025904 | Ga0207647_10000674 | Ga0207647_1000067422 | 226 |
| 606 | 3300025908 | Ga0207643_10045737 | Ga0207643_100457372 | 226 |
| 607 | 3300025911 | Ga0207654_10000411 | Ga0207654_1000041118 | 226 |
| 608 | 3300025911 | Ga0207654_10252539 | Ga0207654_102525392 | 226 |
| 609 | 3300025913 | Ga0207695_10000424 | Ga0207695_1000042452 | 226 |
| 610 | 3300025913 | Ga0207695_10057665 | Ga0207695_100576652 | 226 |
| 611 | 3300025914 | Ga0207671_10012559 | Ga0207671_100125592 | 226 |
| 612 | 3300025914 | Ga0207671_10415587 | Ga0207671_104155872 | 226 |
| 613 | 3300025920 | Ga0207649_10561136 | Ga0207649_105611362 | 226 |
| 614 | 3300025923 | Ga0207681_10311617 | Ga0207681_103116172 | 226 |
| 615 | 3300025923 | Ga0207681_10433971 | Ga0207681_104339712 | 226 |
| 616 | 3300025924 | Ga0207694_10000347 | Ga0207694_1000034719 | 226 |
| 617 | 3300025924 | Ga0207694_10032322 | Ga0207694_100323224 | 226 |
| 618 | 3300025927 | Ga0207687_10059786 | Ga0207687_100597863 | 226 |
| 619 | 3300025931 | Ga0207644_10335423 | Ga0207644_103354232 | 226 |
| 620 | 3300025933 | Ga0207706_10095998 | Ga0207706_100959982 | 226 |
| 621 | 3300025933 | Ga0207706_10132071 | Ga0207706_101320712 | 226 |
| 622 | 3300025935 | Ga0207709_10224329 | Ga0207709_102243292 | 226 |
| 623 | 3300025936 | Ga0207670_10355988 | Ga0207670_103559882 | 226 |
| 624 | 3300025937 | Ga0207669_10173836 | Ga0207669_101738362 | 226 |
| 625 | 3300025942 | Ga0207689_10027970 | Ga0207689_100279702 | 226 |
| 626 | 3300025942 | Ga0207689_10033587 | Ga0207689_100335872 | 226 |
| 627 | 3300025942 | Ga0207689_10152292 | Ga0207689_101522922 | 226 |
| 628 | 3300025949 | Ga0207667_10012216 | Ga0207667_100122168 | 226 |
| 629 | 3300025949 | Ga0207667_10208918 | Ga0207667_102089183 | 226 |
| 630 | 3300025960 | Ga0207651_10146138 | Ga0207651_101461382 | 226 |
| 631 | 3300025981 | Ga0207640_10021552 | Ga0207640_100215521 | 226 |
| 632 | 3300025981 | Ga0207640_10034597 | Ga0207640_100345972 | 226 |
| 633 | 3300025986 | Ga0207658_10114458 | Ga0207658_101144582 | 226 |
| 634 | 3300026023 | Ga0207677_10059246 | Ga0207677_100592462 | 226 |
| 635 | 3300026035 | Ga0207703_10117760 | Ga0207703_101177602 | 226 |
| 636 | 3300026035 | Ga0207703_10127478 | Ga0207703_101274782 | 226 |
| 637 | 3300026041 | Ga0207639_10041076 | Ga0207639_100410763 | 226 |
| 638 | 3300026067 | Ga0207678_10091798 | Ga0207678_100917982 | 226 |
| 639 | 3300026067 | Ga0207678_10100719 | Ga0207678_101007192 | 226 |
| 640 | 3300026067 | Ga0207678_10319696 | Ga0207678_103196962 | 226 |
| 641 | 3300026075 | Ga0207708_10218688 | Ga0207708_102186882 | 226 |
| 642 | 3300026078 | Ga0207702_10000002 | Ga0207702_1000000286 | 226 |
| 643 | 3300026078 | Ga0207702_10011407 | Ga0207702_100114074 | 226 |
| 644 | 3300026078 | Ga0207702_10149452 | Ga0207702_101494522 | 226 |
| 645 | 3300026089 | Ga0207648_10176716 | Ga0207648_101767162 | 226 |
| 646 | 3300026095 | Ga0207676_10545255 | Ga0207676_105452551 | 226 |
| 647 | 3300026116 | Ga0207674_10009561 | Ga0207674_100095616 | 226 |
| 648 | 3300026116 | Ga0207674_10168213 | Ga0207674_101682132 | 226 |
| 649 | 3300026118 | Ga0207675_100187275 | Ga0207675_1001872752 | 226 |
| 650 | 3300026121 | Ga0207683_10327426 | Ga0207683_103274262 | 226 |
| 651 | 3300026142 | Ga0207698_10028115 | Ga0207698_100281152 | 226 |
| 652 | 3300026142 | Ga0207698_10143341 | Ga0207698_101433412 | 226 |
| 653 | 3300028380 | Ga0268265_10026044 | Ga0268265_100260442 | 226 |
| 654 | 3300028380 | Ga0268265_10089976 | Ga0268265_100899762 | 226 |
| 655 | 3300028380 | Ga0268265_10274083 | Ga0268265_102740832 | 226 |
| 656 | 3300028381 | Ga0268264_10159180 | Ga0268264_101591802 | 226 |
| 657 | 3300030521 | Ga0307511_10131200 | Ga0307511_101312002 | 226 |
| 658 | 3300031456 | Ga0307513_10202539 | Ga0307513_102025392 | 226 |
| 659 | 3300031824 | Ga0307413_10026093 | Ga0307413_100260933 | 226 |
| 660 | 3300031901 | Ga0307406_10170831 | Ga0307406_101708312 | 226 |
| 661 | 3300031903 | Ga0307407_10186701 | Ga0307407_101867012 | 226 |
| 662 | 3300031911 | Ga0307412_10025793 | Ga0307412_100257934 | 226 |
| 663 | 3300031911 | Ga0307412_10199695 | Ga0307412_101996952 | 226 |
| 664 | 3300031995 | Ga0307409_100170998 | Ga0307409_1001709982 | 226 |
| 665 | 3300032002 | Ga0307416_100080534 | Ga0307416_1000805343 | 226 |
| 666 | 3300032005 | Ga0307411_10076487 | Ga0307411_100764873 | 226 |
| 667 | 3300032126 | Ga0307415_100139282 | Ga0307415_1001392822 | 226 |
| 668 | 3300033180 | Ga0307510_10175299 | Ga0307510_101752992 | 226 |
| 669 | 3300041463 | Ga0451804_0890762 | Ga0451804_0890762_57_770 | 226 |
| 670 | 3300046452 | Ga0495617_049104 | Ga0495617_049104_210_923 | 226 |
| 671 | 3300046457 | Ga0495590_0014239 | Ga0495590_0014239_887_1600 | 226 |
| 672 | 3300046460 | Ga0495638_0023480 | Ga0495638_0023480_2213_2926 | 226 |
| 673 | 3300046471 | Ga0495650_0051836 | Ga0495650_0051836_583_1296 | 226 |
| 674 | 3300046473 | Ga0495582_0199011 | Ga0495582_0199011_192_905 | 226 |
| 675 | 3300046474 | Ga0495605_0062814 | Ga0495605_0062814_603_1316 | 226 |
| 676 | 3300046491 | Ga0495584_0035337 | Ga0495584_0035337_1305_2018 | 226 |
| 677 | 3300046492 | Ga0495585_0064445 | Ga0495585_0064445_213_926 | 226 |
| 678 | 3300046499 | Ga0495594_0214838 | Ga0495594_0214838_193_903 | 226 |
| 679 | 3300046500 | Ga0495596_0017806 | Ga0495596_0017806_803_1516 | 226 |
| 680 | 3300046507 | Ga0495606_0038140 | Ga0495606_0038140_1932_2645 | 226 |
| 681 | 3300046512 | Ga0495610_0031329 | Ga0495610_0031329_747_1460 | 226 |
| 682 | 3300046513 | Ga0495616_0019622 | Ga0495616_0019622_1287_2000 | 226 |
| 683 | 3300046522 | Ga0495643_0089804 | Ga0495643_0089804_409_1122 | 226 |
| 684 | 3300046523 | Ga0495644_0085417 | Ga0495644_0085417_271_981 | 226 |
| 685 | 3300046523 | Ga0495644_0177550 | Ga0495644_0177550_25_738 | 226 |
| 686 | 3300046528 | Ga0495642_0022245 | Ga0495642_0022245_601_1314 | 226 |
| 687 | 3300046530 | Ga0495654_0057989 | Ga0495654_0057989_632_1345 | 226 |
| 688 | 3300046538 | Ga0495609_0023003 | Ga0495609_0023003_761_1474 | 226 |
| 689 | 3300046539 | Ga0495621_0157055 | Ga0495621_0157055_167_877 | 226 |
| 690 | 3300046558 | Ga0495633_0031508 | Ga0495633_0031508_804_1517 | 226 |
| 691 | 3300046615 | Ga0495656_0200272 | Ga0495656_0200272_249_959 | 226 |
| 692 | 3300046616 | Ga0495668_0055740 | Ga0495668_0055740_426_1139 | 226 |
| 693 | 3300046648 | Ga0495611_0014614 | Ga0495611_0014614_2180_2893 | 226 |
| 694 | 3300046660 | Ga0495625_0065754 | Ga0495625_0065754_1001_1714 | 226 |
| 695 | 3300046664 | Ga0495659_0057282 | Ga0495659_0057282_342_1052 | 226 |
| 696 | 3300046684 | Ga0495669_0023843 | Ga0495669_0023843_837_1550 | 226 |
| 697 | 3300046691 | Ga0495670_0081849 | Ga0495670_0081849_874_1584 | 226 |
| 698 | 3300046694 | Ga0495649_0090648 | Ga0495649_0090648_532_1245 | 226 |
| 699 | 3300047320 | Ga0495672_0241082 | Ga0495672_0241082_92_805 | 226 |
| 700 | 3300047323 | Ga0495683_0037174 | Ga0495683_0037174_611_1324 | 226 |
| 701 | 3300047445 | Ga0495677_0028231 | Ga0495677_0028231_302_1015 | 226 |
| 702 | 3300047469 | Ga0495673_0053938 | Ga0495673_0053938_118_831 | 226 |
| 703 | 3300047472 | Ga0495686_0175993 | Ga0495686_0175993_133_846 | 226 |
| 704 | 3300048091 | Ga0495626_0019232 | Ga0495626_0019232_1932_2645 | 226 |
| 705 | 3300048911 | Ga0496108_0067630 | Ga0496108_0067630_963_1676 | 226 |
| 706 | 3300048913 | Ga0496110_0243092 | Ga0496110_0243092_495_1208 | 226 |
| 707 | 3300048914 | Ga0496111_0530763 | Ga0496111_0530763_125_838 | 226 |
| 708 | 3300048920 | Ga0496117_0160149 | Ga0496117_0160149_452_1165 | 226 |
| 709 | 3300048922 | Ga0496119_0167280 | Ga0496119_0167280_32_745 | 226 |
| 710 | 3300048923 | Ga0496120_0128661 | Ga0496120_0128661_110_823 | 226 |
| 711 | 3300048924 | Ga0496121_0028398 | Ga0496121_0028398_417_1130 | 226 |
| 712 | 3300048924 | Ga0496121_0149409 | Ga0496121_0149409_331_1044 | 226 |
| 713 | 3300048927 | Ga0496124_0144905 | Ga0496124_0144905_989_1702 | 226 |
| 714 | 3300048927 | Ga0496124_0464134 | Ga0496124_0464134_33_746 | 226 |
| 715 | 3300048928 | Ga0496125_0050051 | Ga0496125_0050051_1044_1757 | 226 |
| 716 | 3300048928 | Ga0496125_0122043 | Ga0496125_0122043_1104_1817 | 226 |
| 717 | 3300048928 | Ga0496125_0302923 | Ga0496125_0302923_32_745 | 226 |
| 718 | 3300048929 | Ga0496126_0002195 | Ga0496126_0002195_440_1153 | 226 |
| 719 | 3300048929 | Ga0496126_0246766 | Ga0496126_0246766_529_1242 | 226 |
| 720 | 3300050489 | nmdc:mga03683_203959_c1 | nmdc:mga03683_203959_c1_155_868 | 226 |
| 721 | 3300050492 | nmdc:mga0yw44_167115_c1 | nmdc:mga0yw44_167115_c1_563_1276 | 226 |
| 722 | 3300050492 | nmdc:mga0yw44_30604_c1 | nmdc:mga0yw44_30604_c1_1927_2640 | 226 |
| 723 | 3300050492 | nmdc:mga0yw44_4648_c1 | nmdc:mga0yw44_4648_c1_2772_3485 | 226 |
| 724 | 3300050493 | nmdc:mga0k408_78564_c1 | nmdc:mga0k408_78564_c1_508_1221 | 226 |
| 725 | 3300050493 | nmdc:mga0k408_8031_c1 | nmdc:mga0k408_8031_c1_1585_2298 | 226 |
| 726 | 3300050508 | nmdc:mga09592_183634_c1 | nmdc:mga09592_183634_c1_59_772 | 226 |
| 727 | 3300050512 | nmdc:mga0n895_197525_c1 | nmdc:mga0n895_197525_c1_163_876 | 226 |
| 728 | 3300050514 | nmdc:mga08x19_201358_c1 | nmdc:mga08x19_201358_c1_46_759 | 226 |
| 729 | 3300050516 | nmdc:mga0sz30_1617_c1 | nmdc:mga0sz30_1617_c1_2538_3251 | 226 |
| 730 | 3300053079 | Ga0500610_0185895 | Ga0500610_0185895_155_868 | 226 |
| 731 | 3300053083 | Ga0495655_0003619 | Ga0495655_0003619_706_1419 | 226 |
| 732 | 3300053086 | Ga0500578_0051516 | Ga0500578_0051516_227_940 | 226 |
| 733 | 3300053087 | Ga0500643_034252 | Ga0500643_034252_460_1173 | 226 |
| 734 | 3300053092 | Ga0500583_0058527 | Ga0500583_0058527_250_963 | 226 |
| 735 | 3300053104 | Ga0500556_0096440 | Ga0500556_0096440_139_852 | 226 |
| 736 | 3300053109 | Ga0500569_051451 | Ga0500569_051451_388_1101 | 226 |
| 737 | 3300053119 | Ga0500595_009426 | Ga0500595_009426_1757_2470 | 226 |
| 738 | 3300053137 | Ga0500561_0032027 | Ga0500561_0032027_161_874 | 226 |
| 739 | 3300053142 | Ga0500577_0045176 | Ga0500577_0045176_703_1416 | 226 |
| 740 | 3300053143 | Ga0500579_105193 | Ga0500579_105193_144_857 | 226 |
| 741 | 3300053148 | Ga0500590_109946 | Ga0500590_109946_170_883 | 226 |
| 742 | 3300053150 | Ga0500603_084254 | Ga0500603_084254_70_783 | 226 |
| 743 | 3300053158 | Ga0500627_0053283 | Ga0500627_0053283_206_919 | 226 |
| 744 | 3300053178 | Ga0500637_0113806 | Ga0500637_0113806_561_1274 | 226 |
| 745 | 3300053732 | Ga0500656_007310 | Ga0500656_007310_209_922 | 226 |
| 746 | 3300059510 | Ga0587090_021918 | Ga0587090_021918_177_890 | 226 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar