F478792

General Info

Members Datasets Scaffolds Average Seq Length
745 393 1490 245

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10367633|Ga0114129_103676333
Length 261
Sequence MAHGARKLTRMRPLKSRPAGRRRGRARGVPTQPIELYYWPTPNGQKVSIMLEECGLPYRVIAVNIARGEQFKPAFLKISPNNRIPAIVDPHGPGGRPIAVFESGAILQYLGRKTGQFYPAGERARVEVDQWLFWQMANLGPKAGEANHFRRYATAANQQYAVERFGNELNRLFGVMNKRLKDRAFLAGRYSIADMACVGWIRLFERQGRELDGFPHLKRWLKRVRARPAVRRGMGIRIEEASRVDVRDPTVRAVLFGQRAR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
107 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
233 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
234 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
235 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
236 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
237 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
238 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
239 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
240 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
241 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
256 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
257 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
258 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
272 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
273 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
274 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
290 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
293 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
324 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
325 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
326 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
330 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
379 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
383 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
384 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
385 2773857925 Microvirga vignae BR3299 Isolate Unclassified
386 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
387 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
388 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
389 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
390 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
391 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
392 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
393 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 0.13
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0.81
Rhizoplane 6.85
Rhizosphere 89.93
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10367633 3300009147 Bacteria 1902
2 2214756334 2209111006 Bacteria 3097
3 ARcpr5oldR_c000183 3300000041 Bacteria 10873
4 ARSoilYngRDRAFT_c00120 3300000042 Bacteria 13387
5 ARcpr5yngRDRAFT_c000195 3300000043 Bacteria 9370
6 ARSoilOldRDRAFT_c000093 3300000044 Bacteria 16766
7 ARCol0oldRDRAFT_c01241 3300000045 Bacteria 1815
8 ARCol0yngRDRAFT_1000124 3300000652 Bacteria 13864
9 JGI24736J21556_1023741 3300001904 Bacteria 957
10 JGI24746J21847_1000166 3300001977 Bacteria 8589
11 JGI24747J21853_1000502 3300001978 Bacteria 2469
12 JGI24740J21852_10013161 3300001979 Bacteria 3096
13 JGI24739J22299_10000057 3300001989 Bacteria 31581
14 JGI24737J22298_10000391 3300001990 Bacteria 14950
15 JGI24737J22298_10001583 3300001990 Bacteria 8090
16 JGI24750J21931_1000122 3300002070 Bacteria 12437
17 JGI24745J21846_1000432 3300002073 Bacteria 3722
18 JGI24748J21848_1008199 3300002074 Bacteria 1227
19 JGI24738J21930_10000767 3300002075 Bacteria 9204
20 JGI24749J21850_1000951 3300002076 Bacteria 4128
21 JGI24035J26624_1000228 3300002126 Bacteria 5149
22 JGI24033J26618_1000617 3300002155 Bacteria 3419
23 JGI24034J26672_10000108 3300002239 Bacteria 13522
24 JGI24742J22300_10000111 3300002244 Bacteria 11743
25 JGI24751J29686_10013943 3300002459 Bacteria 1659
26 JGI25151J46595_10000086 3300003187 Bacteria 126250
27 JGI25153J46596_10006736 3300003215 Bacteria 5763
28 Ga0055526_1000371 3300003771 Bacteria 36363
29 Ga0065717_1003053 3300005276 Bacteria 1448
30 Ga0065704_10107468 3300005289 Bacteria 2055
31 Ga0065712_10072616 3300005290 Bacteria 4681
32 Ga0065712_10103628 3300005290 Bacteria 1980
33 Ga0065715_10002625 3300005293 Bacteria 8315
34 Ga0065715_10090398 3300005293 Bacteria 7088
35 Ga0065715_10327286 3300005293 Bacteria 990
36 Ga0065707_10135694 3300005295 Bacteria 1845
37 Ga0065707_10231548 3300005295 Bacteria 1187
38 Ga0070658_10038385 3300005327 Bacteria 3862
39 Ga0070658_10088474 3300005327 Bacteria 2550
40 Ga0070658_10153929 3300005327 Bacteria 1926
41 Ga0070676_10000170 3300005328 Bacteria 26484
42 Ga0070683_100003392 3300005329 Bacteria 12912
43 Ga0070690_100013276 3300005330 Bacteria 4865
44 Ga0070670_100021304 3300005331 Bacteria 5576
45 Ga0070670_100214100 3300005331 Bacteria 1675
46 Ga0070677_10000320 3300005333 Bacteria 16762
47 Ga0068869_100000181 3300005334 Bacteria 32256
48 Ga0068869_100538273 3300005334 Bacteria 979
49 Ga0070680_100002750 3300005336 Bacteria 13050
50 Ga0070680_100044489 3300005336 Bacteria 3607
51 Ga0070680_100123385 3300005336 Bacteria 2163
52 Ga0070682_100000903 3300005337 Bacteria 17347
53 Ga0070682_100270343 3300005337 Bacteria 1234
54 Ga0068868_100000590 3300005338 Bacteria 24437
55 Ga0070660_100007288 3300005339 Bacteria 7706
56 Ga0070660_100043246 3300005339 Bacteria 3442
57 Ga0070660_100095703 3300005339 Bacteria 2347
58 Ga0070660_100145147 3300005339 Bacteria 1906
59 Ga0070689_100001256 3300005340 Bacteria 16143
60 Ga0070689_100015933 3300005340 Bacteria 5493
61 Ga0070689_100174164 3300005340 Bacteria 1744
62 Ga0070691_10000085 3300005341 Bacteria 26262
63 Ga0070691_10052867 3300005341 Bacteria 1942
64 Ga0070687_100000037 3300005343 Bacteria 42337
65 Ga0070687_100009985 3300005343 Bacteria 4085
66 Ga0070661_100014737 3300005344 Bacteria 5513
67 Ga0070692_10000038 3300005345 Bacteria 25433
68 Ga0070668_100012587 3300005347 Bacteria 6299
69 Ga0070669_100015059 3300005353 Bacteria 5513
70 Ga0070669_100344318 3300005353 Bacteria 1209
71 Ga0070675_100013975 3300005354 Bacteria 6320
72 Ga0070671_100010890 3300005355 Bacteria 7303
73 Ga0070674_100000195 3300005356 Bacteria 29060
74 Ga0070674_100063853 3300005356 Bacteria 2579
75 Ga0070674_100106305 3300005356 Bacteria 2053
76 Ga0070673_100000191 3300005364 Bacteria 30135
77 Ga0070688_100006371 3300005365 Bacteria 6307
78 Ga0070688_100008846 3300005365 Bacteria 5481
79 Ga0070688_100026022 3300005365 Bacteria 3471
80 Ga0070659_100001504 3300005366 Bacteria 16803
81 Ga0070667_100015512 3300005367 Bacteria 6299
82 Ga0070667_100330758 3300005367 Bacteria 1376
83 Ga0070709_10129111 3300005434 Bacteria 1723
84 Ga0070709_10199095 3300005434 Bacteria 1417
85 Ga0070709_10268758 3300005434 Bacteria 1235
86 Ga0070709_10334425 3300005434 Bacteria 1115
87 Ga0070714_100090919 3300005435 Bacteria 2674
88 Ga0070714_100410973 3300005435 Bacteria 1281
89 Ga0070714_100976386 3300005435 Bacteria 824
90 Ga0070713_100030801 3300005436 Bacteria 4266
91 Ga0070701_10032655 3300005438 Bacteria 2594
92 Ga0070711_100098293 3300005439 Bacteria 2125
93 Ga0070711_100387541 3300005439 Bacteria 1131
94 Ga0070700_100009799 3300005441 Bacteria 5269
95 Ga0070700_100028282 3300005441 Bacteria 3332
96 Ga0070694_100019235 3300005444 Bacteria 4342
97 Ga0070694_100526283 3300005444 Bacteria 944
98 Ga0070663_100005367 3300005455 Bacteria 7611
99 Ga0070663_100082466 3300005455 Bacteria 2365
100 Ga0070663_100148508 3300005455 Bacteria 1795
101 Ga0070663_100581151 3300005455 Bacteria 940
102 Ga0070678_100010208 3300005456 Bacteria 5725
103 Ga0070678_100379491 3300005456 Bacteria 1223
104 Ga0070662_100001810 3300005457 Bacteria 13141
105 Ga0070662_100014550 3300005457 Bacteria 5260
106 Ga0070662_100531376 3300005457 Bacteria 984
107 Ga0070681_10002441 3300005458 Bacteria 17015
108 Ga0070681_10007687 3300005458 Bacteria 10539
109 Ga0070681_10022976 3300005458 Bacteria 6267
110 Ga0068867_100000082 3300005459 Bacteria 59236
111 Ga0070685_10006868 3300005466 Bacteria 5808
112 Ga0070685_10022949 3300005466 Bacteria 3409
113 Ga0074259_10441056 3300005507 Bacteria 991
114 Ga0070679_100006190 3300005530 Bacteria 11142
115 Ga0070679_100059858 3300005530 Bacteria 3795
116 Ga0070679_100092831 3300005530 Bacteria 3005
117 Ga0070684_100001355 3300005535 Bacteria 17557
118 Ga0070697_100046445 3300005536 Bacteria 3520
119 Ga0070697_100287956 3300005536 Bacteria 1410
120 Ga0068853_100020240 3300005539 Bacteria 5532
121 Ga0070672_100001052 3300005543 Bacteria 16850
122 Ga0070672_100083939 3300005543 Bacteria 2557
123 Ga0070686_100005857 3300005544 Bacteria 6810
124 Ga0070686_100038034 3300005544 Bacteria 2989
125 Ga0070686_100079120 3300005544 Bacteria 2173
126 Ga0070695_100024055 3300005545 Bacteria 3750
127 Ga0070695_100028142 3300005545 Bacteria 3486
128 Ga0070695_100319416 3300005545 Bacteria 1154
129 Ga0070696_100019040 3300005546 Bacteria 4647
130 Ga0070696_100019906 3300005546 Bacteria 4549
131 Ga0070696_100055263 3300005546 Bacteria 2768
132 Ga0070693_100006925 3300005547 Bacteria 5513
133 Ga0070693_100009627 3300005547 Bacteria 4810
134 Ga0070693_100043952 3300005547 Bacteria 2525
135 Ga0070665_100035064 3300005548 Bacteria 5046
136 Ga0070704_100002284 3300005549 Bacteria 10707
137 Ga0070704_100008914 3300005549 Bacteria 6042
138 Ga0068855_100066014 3300005563 Bacteria 4218
139 Ga0068855_100176270 3300005563 Bacteria 2419
140 Ga0068855_100356364 3300005563 Bacteria 1610
141 Ga0070664_100015140 3300005564 Bacteria 6299
142 Ga0070664_100417004 3300005564 Bacteria 1229
143 Ga0068857_100001561 3300005577 Bacteria 18370
144 Ga0068854_100000140 3300005578 Bacteria 50187
145 Ga0068854_100126224 3300005578 Bacteria 1949
146 Ga0068856_100014995 3300005614 Bacteria 7486
147 Ga0070702_100000796 3300005615 Bacteria 12029
148 Ga0070702_100171461 3300005615 Bacteria 1412
149 Ga0070702_100460682 3300005615 Bacteria 924
150 Ga0068852_100009442 3300005616 Bacteria 7245
151 Ga0068852_100563421 3300005616 Bacteria 1141
152 Ga0068859_100029961 3300005617 Bacteria 5459
153 Ga0068864_100002090 3300005618 Bacteria 16498
154 Ga0068861_100062512 3300005719 Bacteria 2860
155 Ga0068870_10000063 3300005840 Bacteria 33368
156 Ga0068863_100026081 3300005841 Bacteria 5577
157 Ga0068863_100474921 3300005841 Bacteria 1229
158 Ga0068858_100025376 3300005842 Bacteria 5514
159 Ga0068858_100042274 3300005842 Bacteria 4225
160 Ga0068860_100003358 3300005843 Bacteria 16477
161 Ga0068862_100001746 3300005844 Bacteria 19666
162 Ga0081455_10000028 3300005937 Bacteria 155778
163 Ga0081455_10009936 3300005937 Bacteria 9733
164 Ga0081455_10177700 3300005937 Bacteria 1615
165 Ga0075363_100148315 3300006048 Bacteria 1323
166 Ga0075363_100148335 3300006048 Bacteria 1323
167 Ga0075432_10074372 3300006058 Bacteria 1224
168 Ga0070716_100176439 3300006173 Bacteria 1399
169 Ga0070712_100004132 3300006175 Bacteria 8923
170 Ga0075427_10008231 3300006194 Bacteria 1543
171 Ga0097621_100000083 3300006237 Bacteria 50576
172 Ga0097621_100136443 3300006237 Bacteria 2093
173 Ga0068871_100000067 3300006358 Bacteria 57681
174 Ga0068871_100097761 3300006358 Bacteria 2455
175 Ga0075430_100031292 3300006846 Bacteria 4516
176 Ga0075430_100120670 3300006846 Bacteria 2185
177 Ga0075430_100423031 3300006846 Bacteria 1099
178 Ga0075431_100252555 3300006847 Bacteria 1791
179 Ga0075433_10001386 3300006852 Bacteria 17846
180 Ga0075433_10018647 3300006852 Bacteria 5771
181 Ga0075433_10068230 3300006852 Bacteria 3122
182 Ga0075434_100001186 3300006871 Bacteria 21600
183 Ga0075434_100006580 3300006871 Bacteria 10659
184 Ga0075434_100131989 3300006871 Bacteria 2517
185 Ga0075429_100038699 3300006880 Bacteria 4152
186 Ga0075429_100535484 3300006880 Bacteria 1026
187 Ga0068865_100000244 3300006881 Bacteria 30343
188 Ga0068865_100414752 3300006881 Bacteria 1106
189 Ga0075436_100255479 3300006914 Bacteria 1249
190 Ga0097620_100029962 3300006931 Bacteria 5459
191 Ga0075435_100017607 3300007076 Bacteria 5413
192 Ga0075435_100109445 3300007076 Bacteria 2297
193 Ga0075435_100167915 3300007076 Bacteria 1851
194 Ga0075435_100472532 3300007076 Bacteria 1082
195 Ga0105240_10027953 3300009093 Bacteria 7377
196 Ga0105240_10109579 3300009093 Bacteria 3343
197 Ga0111539_10032831 3300009094 Bacteria 6303
198 Ga0111539_10091401 3300009094 Bacteria 3576
199 Ga0111539_10207974 3300009094 Bacteria 2280
200 Ga0111539_10301194 3300009094 Bacteria 1866
201 Ga0105245_10000762 3300009098 Bacteria 29109
202 Ga0105245_10204325 3300009098 Bacteria 1898
203 Ga0105247_10164326 3300009101 Bacteria 1472
204 Ga0105247_10178452 3300009101 Bacteria 1416
205 Ga0114129_10072717 3300009147 Bacteria 4793
206 Ga0114129_10263683 3300009147 Bacteria 2308
207 Ga0105243_10016647 3300009148 Bacteria 5560
208 Ga0105243_10039120 3300009148 Bacteria 3696
209 Ga0105243_10087167 3300009148 Bacteria 2562
210 Ga0105243_10124097 3300009148 Bacteria 2182
211 Ga0105243_10343414 3300009148 Bacteria 1368
212 Ga0105241_10000900 3300009174 Bacteria 22448
213 Ga0105241_10086615 3300009174 Bacteria 2464
214 Ga0105241_10247267 3300009174 Bacteria 1510
215 Ga0105242_10000036 3300009176 Bacteria 91470
216 Ga0105242_10177227 3300009176 Bacteria 1878
217 Ga0105248_10034721 3300009177 Bacteria 5642
218 Ga0105248_10050918 3300009177 Bacteria 4647
219 Ga0105248_10392904 3300009177 Bacteria 1562
220 Ga0105237_10029241 3300009545 Bacteria 5605
221 Ga0105238_10037849 3300009551 Bacteria 4902
222 Ga0105238_10101122 3300009551 Bacteria 2866
223 Ga0105238_10138983 3300009551 Bacteria 2406
224 Ga0105249_10001033 3300009553 Bacteria 24619
225 Ga0105249_10065149 3300009553 Bacteria 3351
226 Ga0105239_10035447 3300010375 Bacteria 5479
227 Ga0105239_10042248 3300010375 Bacteria 4996
228 Ga0157339_1000936 3300012505 Bacteria 1642
229 Ga0157373_10432321 3300013100 Bacteria 946
230 Ga0157371_10037194 3300013102 Bacteria 3485
231 Ga0157371_10075390 3300013102 Bacteria 2389
232 Ga0157369_10102581 3300013105 Bacteria 3048
233 Ga0157369_10207590 3300013105 Bacteria 2054
234 Ga0157374_10009715 3300013296 Bacteria 8260
235 Ga0157378_10002181 3300013297 Bacteria 17356
236 Ga0157378_10066591 3300013297 Bacteria 3226
237 Ga0157378_10644994 3300013297 Bacteria 1074
238 Ga0163162_10011076 3300013306 Bacteria 8786
239 Ga0163162_10021532 3300013306 Bacteria 6350
240 Ga0157372_10039877 3300013307 Bacteria 5185
241 Ga0157372_10543544 3300013307 Bacteria 1354
242 Ga0157372_10725265 3300013307 Bacteria 1156
243 Ga0157375_10003806 3300013308 Bacteria 13080
244 Ga0157375_10188167 3300013308 Bacteria 2219
245 Ga0163163_10016530 3300014325 Bacteria 6861
246 Ga0163163_10088960 3300014325 Bacteria 3100
247 Ga0163163_10284043 3300014325 Bacteria 1707
248 Ga0163163_11022761 3300014325 Bacteria 890
249 Ga0157380_10001301 3300014326 Bacteria 16225
250 Ga0157380_10097749 3300014326 Bacteria 2437
251 Ga0157377_10000124 3300014745 Bacteria 49953
252 Ga0157379_10000275 3300014968 Bacteria 40524
253 Ga0157379_10377201 3300014968 Bacteria 1301
254 Ga0157376_10000115 3300014969 Bacteria 57170
255 Ga0163161_10010835 3300017792 Bacteria 6320
256 Ga0163161_10175659 3300017792 Bacteria 1640
257 Ga0163161_10298124 3300017792 Bacteria 1269
258 Ga0213876_10060758 3300021384 Bacteria 1994
259 Ga0207666_1000050 3300025271 Bacteria 22802
260 Ga0207666_1000394 3300025271 Bacteria 5755
261 Ga0207673_1000083 3300025290 Bacteria 8317
262 Ga0209758_1009129 3300025297 Bacteria 6244
263 Ga0207697_10000039 3300025315 Bacteria 49235
264 Ga0207697_10044924 3300025315 Bacteria 1818
265 Ga0207682_10000121 3300025893 Bacteria 35950
266 Ga0207692_10116613 3300025898 Bacteria 1489
267 Ga0207692_10173098 3300025898 Bacteria 1252
268 Ga0207642_10001013 3300025899 Bacteria 8804
269 Ga0207710_10104614 3300025900 Bacteria 1339
270 Ga0207710_10206923 3300025900 Bacteria 971
271 Ga0207710_10213179 3300025900 Bacteria 957
272 Ga0207688_10000073 3300025901 Bacteria 37681
273 Ga0207688_10001691 3300025901 Bacteria 11690
274 Ga0207688_10041092 3300025901 Bacteria 2571
275 Ga0207680_10062152 3300025903 Bacteria 2280
276 Ga0207647_10013109 3300025904 Bacteria 5759
277 Ga0207647_10023727 3300025904 Bacteria 4053
278 Ga0207699_10147743 3300025906 Bacteria 1552
279 Ga0207645_10000114 3300025907 Bacteria 60880
280 Ga0207645_10080713 3300025907 Bacteria 2085
281 Ga0207643_10000134 3300025908 Bacteria 50474
282 Ga0207705_10076166 3300025909 Bacteria 2438
283 Ga0207705_10107127 3300025909 Bacteria 2062
284 Ga0207654_10000527 3300025911 Bacteria 21845
285 Ga0207707_10017884 3300025912 Bacteria 6180
286 Ga0207707_10072873 3300025912 Bacteria 2994
287 Ga0207707_10149287 3300025912 Bacteria 2044
288 Ga0207707_10165869 3300025912 Bacteria 1930
289 Ga0207695_10079997 3300025913 Bacteria 3311
290 Ga0207671_10015778 3300025914 Bacteria 5898
291 Ga0207671_10077531 3300025914 Bacteria 2488
292 Ga0207693_10002351 3300025915 Bacteria 16428
293 Ga0207693_10149824 3300025915 Bacteria 1835
294 Ga0207693_10236824 3300025915 Bacteria 1433
295 Ga0207693_10396546 3300025915 Bacteria 1079
296 Ga0207663_10288072 3300025916 Bacteria 1222
297 Ga0207660_10000034 3300025917 Bacteria 65783
298 Ga0207660_10101409 3300025917 Bacteria 2150
299 Ga0207660_10413467 3300025917 Bacteria 1087
300 Ga0207662_10008712 3300025918 Bacteria 5564
301 Ga0207657_10005404 3300025919 Bacteria 13354
302 Ga0207657_10014984 3300025919 Bacteria 7531
303 Ga0207657_10037686 3300025919 Bacteria 4313
304 Ga0207657_10148869 3300025919 Bacteria 1908
305 Ga0207649_10000142 3300025920 Bacteria 60023
306 Ga0207652_10002021 3300025921 Bacteria 17491
307 Ga0207652_10028137 3300025921 Bacteria 4688
308 Ga0207652_10084695 3300025921 Bacteria 2778
309 Ga0207652_10196609 3300025921 Bacteria 1814
310 Ga0207652_10210104 3300025921 Bacteria 1752
311 Ga0207681_10000065 3300025923 Bacteria 98832
312 Ga0207694_10061870 3300025924 Bacteria 2914
313 Ga0207694_10176142 3300025924 Bacteria 1733
314 Ga0207650_10013410 3300025925 Bacteria 5674
315 Ga0207659_10000078 3300025926 Bacteria 61403
316 Ga0207687_10007258 3300025927 Bacteria 7308
317 Ga0207687_10055950 3300025927 Bacteria 2766
318 Ga0207644_10023497 3300025931 Bacteria 4223
319 Ga0207690_10000200 3300025932 Bacteria 46868
320 Ga0207690_10469920 3300025932 Bacteria 1013
321 Ga0207706_10023274 3300025933 Bacteria 5564
322 Ga0207706_10264061 3300025933 Bacteria 1503
323 Ga0207706_10541153 3300025933 Bacteria 1003
324 Ga0207686_10007002 3300025934 Bacteria 6068
325 Ga0207709_10000183 3300025935 Bacteria 83374
326 Ga0207709_10178892 3300025935 Bacteria 1496
327 Ga0207670_10006498 3300025936 Bacteria 6487
328 Ga0207670_10486686 3300025936 Bacteria 1000
329 Ga0207669_10000248 3300025937 Bacteria 24525
330 Ga0207669_10185446 3300025937 Bacteria 1496
331 Ga0207669_10194135 3300025937 Bacteria 1467
332 Ga0207704_10000719 3300025938 Bacteria 14567
333 Ga0207704_10061999 3300025938 Bacteria 2323
334 Ga0207704_10288214 3300025938 Bacteria 1251
335 Ga0207665_10110238 3300025939 Bacteria 1933
336 Ga0207665_10226841 3300025939 Bacteria 1371
337 Ga0207691_10000990 3300025940 Bacteria 28262
338 Ga0207691_10162026 3300025940 Bacteria 1962
339 Ga0207711_10031108 3300025941 Bacteria 4504
340 Ga0207711_10117161 3300025941 Bacteria 2375
341 Ga0207689_10000144 3300025942 Bacteria 61402
342 Ga0207689_10070952 3300025942 Bacteria 2861
343 Ga0207689_10164753 3300025942 Bacteria 1827
344 Ga0207661_10001264 3300025944 Bacteria 16911
345 Ga0207661_10169458 3300025944 Bacteria 1900
346 Ga0207661_10269667 3300025944 Bacteria 1519
347 Ga0207679_10000064 3300025945 Bacteria 98118
348 Ga0207679_10188373 3300025945 Bacteria 1713
349 Ga0207667_10140537 3300025949 Bacteria 2486
350 Ga0207667_10271242 3300025949 Bacteria 1735
351 Ga0207667_10275509 3300025949 Bacteria 1720
352 Ga0207651_10000420 3300025960 Bacteria 18070
353 Ga0207651_10234872 3300025960 Bacteria 1491
354 Ga0207712_10001661 3300025961 Bacteria 14931
355 Ga0207712_10105751 3300025961 Bacteria 2101
356 Ga0207712_10136291 3300025961 Bacteria 1878
357 Ga0207668_10193755 3300025972 Bacteria 1613
358 Ga0207668_10362044 3300025972 Bacteria 1216
359 Ga0207640_10004058 3300025981 Bacteria 7911
360 Ga0207658_10022503 3300025986 Bacteria 4389
361 Ga0207677_10008968 3300026023 Bacteria 5611
362 Ga0207703_10010897 3300026035 Bacteria 7087
363 Ga0207703_10380122 3300026035 Bacteria 1306
364 Ga0207703_10668501 3300026035 Bacteria 986
365 Ga0207639_10379319 3300026041 Bacteria 1269
366 Ga0207678_10003913 3300026067 Bacteria 13396
367 Ga0207678_10028306 3300026067 Bacteria 4893
368 Ga0207678_10043085 3300026067 Bacteria 3907
369 Ga0207678_10067329 3300026067 Bacteria 3074
370 Ga0207708_10016908 3300026075 Bacteria 5492
371 Ga0207708_10029616 3300026075 Bacteria 4150
372 Ga0207708_10161778 3300026075 Bacteria 1768
373 Ga0207702_10032108 3300026078 Bacteria 4381
374 Ga0207702_10122792 3300026078 Bacteria 2327
375 Ga0207702_10795749 3300026078 Bacteria 934
376 Ga0207641_10001821 3300026088 Bacteria 20519
377 Ga0207648_10023701 3300026089 Bacteria 5492
378 Ga0207648_10491555 3300026089 Bacteria 1122
379 Ga0207676_10000079 3300026095 Bacteria 94811
380 Ga0207676_10162583 3300026095 Bacteria 1936
381 Ga0207674_10000323 3300026116 Bacteria 61026
382 Ga0207675_100000270 3300026118 Bacteria 49235
383 Ga0207675_100048918 3300026118 Bacteria 3947
384 Ga0207683_10000037 3300026121 Bacteria 100920
385 Ga0207683_10012300 3300026121 Bacteria 7305
386 Ga0207698_10001179 3300026142 Bacteria 15239
387 Ga0209973_1001076 3300027252 Bacteria 2280
388 Ga0209982_1014937 3300027552 Bacteria 1175
389 Ga0210002_1000055 3300027617 Bacteria 17399
390 Ga0209971_1012497 3300027682 Bacteria 2009
391 Ga0209966_1010800 3300027695 Bacteria 1655
392 Ga0209998_10003279 3300027717 Bacteria 3562
393 Ga0209998_10006433 3300027717 Bacteria 2439
394 Ga0209974_10001624 3300027876 Bacteria 8137
395 Ga0207428_10000216 3300027907 Bacteria 79777
396 Ga0207428_10000947 3300027907 Bacteria 32277
397 Ga0207428_10135243 3300027907 Bacteria 1885
398 Ga0207428_10169255 3300027907 Bacteria 1655
399 Ga0268266_10050353 3300028379 Bacteria 3574
400 Ga0268265_10001593 3300028380 Bacteria 18775
401 Ga0268265_10163574 3300028380 Bacteria 1894
402 Ga0268265_10459201 3300028380 Bacteria 1191
403 Ga0268264_10002487 3300028381 Bacteria 16198
404 Ga0268264_10185461 3300028381 Bacteria 1893
405 Ga0265338_10034833 3300028800 Bacteria 4854
406 Ga0265338_10075788 3300028800 Bacteria 2853
407 Ga0265324_10073106 3300029957 Bacteria 1168
408 Ga0265330_10119049 3300031235 Bacteria 1125
409 Ga0265325_10000104 3300031241 Bacteria 59692
410 Ga0265325_10012604 3300031241 Bacteria 4830
411 Ga0265329_10042660 3300031242 Bacteria 1452
412 Ga0265339_10001035 3300031249 Bacteria 21200
413 Ga0265339_10150744 3300031249 Bacteria 1176
414 Ga0265339_10171751 3300031249 Bacteria 1084
415 Ga0265331_10074499 3300031250 Bacteria 1584
416 Ga0265313_10000825 3300031595 Bacteria 31303
417 Ga0265313_10009755 3300031595 Bacteria 6187
418 Ga0265313_10033183 3300031595 Bacteria 2627
419 Ga0265313_10057445 3300031595 Bacteria 1837
420 Ga0316575_10021842 3300031665 Bacteria 2467
421 Ga0265314_10039560 3300031711 Bacteria 3394
422 Ga0265342_10000807 3300031712 Bacteria 31481
423 Ga0265342_10004144 3300031712 Bacteria 11539
424 Ga0265342_10185477 3300031712 Bacteria 1137
425 Ga0265342_10236214 3300031712 Bacteria 980
426 Ga0307416_100578520 3300032002 Bacteria 1200
427 Ga0307414_10315019 3300032004 Bacteria 1329
428 Ga0307411_10064652 3300032005 Bacteria 2450
429 Ga0316583_10029508 3300032133 Bacteria 1955
430 Ga0373930_0002122 3300034816 Unclassified 3039
431 Ga0373930_0041699 3300034816 Bacteria 980
432 Ga0373948_0015571 3300034817 Bacteria 1397
433 Ga0373948_0017194 3300034817 Bacteria 1345
434 Ga0373938_0000060 3300034957 Bacteria 13928
435 Ga0373926_0052232 3300035083 Bacteria 1477
436 Ga0373928_0002099 3300035084 Bacteria 3891
437 Ga0373928_0002309 3300035084 Bacteria 3704
438 Ga0373929_0016449 3300035085 Bacteria 1449
439 Ga0373940_0012286 3300035088 Bacteria 2049
440 Ga0373940_0027836 3300035088 Bacteria 1488
441 Ga0373944_0090275 3300035089 Bacteria 1023
442 Ga0373949_0006592 3300035090 Bacteria 2552
443 Ga0373949_0024510 3300035090 Bacteria 1403
444 Ga0373949_0074800 3300035090 Bacteria 893
445 Ga0373951_0017842 3300035091 Bacteria 1608
446 Ga0373951_0064848 3300035091 Bacteria 920
447 Ga0373952_0003451 3300035092 Bacteria 2852
448 Ga0373952_0003689 3300035092 Bacteria 2765
449 Ga0373952_0032655 3300035092 Bacteria 1164
450 Ga0373923_0046600 3300035111 Bacteria 1804
451 Ga0373923_0136853 3300035111 Bacteria 1105
452 Ga0373932_0002546 3300035112 Bacteria 4567
453 Ga0373932_0003334 3300035112 Bacteria 3874
454 Ga0373936_0074531 3300035113 Bacteria 1404
455 Ga0373939_0000354 3300035114 Bacteria 11613
456 Ga0373939_0003245 3300035114 Bacteria 3810
457 Ga0373939_0005961 3300035114 Bacteria 2919
458 Ga0373941_0000729 3300035115 Bacteria 6757
459 Ga0373941_0018605 3300035115 Bacteria 1921
460 Ga0373945_0024660 3300035116 Bacteria 2085
461 Ga0373945_0130469 3300035116 Bacteria 1006
462 Ga0373954_0003357 3300035118 Bacteria 6778
463 Ga0373956_0032682 3300035119 Bacteria 2284
464 Ga0373957_0048971 3300035120 Bacteria 1612
465 Ga0373960_0000114 3300035121 Bacteria 12986
466 Ga0373960_0010353 3300035121 Bacteria 2276
467 Ga0373943_0025585 3300035170 Bacteria 2759
468 Ga0373946_0021196 3300035171 Bacteria 2518
469 Ga0373946_0129034 3300035171 Bacteria 1161
470 Ga0373955_0096661 3300035172 Bacteria 1690
471 Ga0373942_0030402 3300035207 Bacteria 1423
472 Ga0373961_0007426 3300035241 Bacteria 2650
473 Ga0373961_0039634 3300035241 Bacteria 1354
474 Ga0373961_0095828 3300035241 Bacteria 954
475 Ga0373962_0001858 3300035242 Bacteria 5032
476 Ga0373962_0010726 3300035242 Bacteria 2289
477 Ga0373962_0021825 3300035242 Bacteria 1692
478 Ga0373924_0052097 3300035410 Bacteria 1698
479 Ga0373931_0005088 3300035691 Bacteria 6050
480 Ga0373931_0005770 3300035691 Bacteria 5752
481 Ga0373931_0011401 3300035691 Bacteria 4294
482 Ga0373931_0067706 3300035691 Bacteria 1941
483 Ga0373931_0171890 3300035691 Bacteria 1277
484 Ga0373935_0039868 3300035692 Bacteria 2945
485 Ga0373935_0115969 3300035692 Bacteria 1783
486 Ga0373935_0225194 3300035692 Bacteria 1304
487 Ga0373935_0229770 3300035692 Bacteria 1291
488 Ga0373935_0233538 3300035692 Bacteria 1281
489 Ga0373927_0033962 3300035695 Bacteria 3319
490 Ga0373927_0185762 3300035695 Bacteria 1363
491 Ga0373933_0456464 3300035724 Bacteria 836
492 Ga0373947_0017482 3300035725 Bacteria 4125
493 Ga0373937_0110446 3300036401 Bacteria 2557
494 Ga0373937_0232459 3300036401 Bacteria 1736
495 Ga0373937_0354592 3300036401 Bacteria 1390
496 Ga0373925_0332372 3300037068 Bacteria 1231
497 Ga0395899_0002674 3300037312 Bacteria 14372
498 Ga0395900_0003303 3300037418 Bacteria 17453
499 Ga0395898_0006986 3300037466 Bacteria 12000
500 Ga0395898_0008249 3300037466 Bacteria 11015
501 Ga0395901_0245506 3300038443 Bacteria 1866
502 Ga0436365_0070766 3300039437 Bacteria 22318
503 Ga0436365_0379418 3300039437 Bacteria 3311
504 Ga0436363_0417802 3300039450 Bacteria 2105
505 Ga0439455_0031484 3300042012 Bacteria 1321
506 Ga0439464_0056907 3300042439 Bacteria 1139
507 Ga0466961_0131588 3300044693 Bacteria 1568
508 Ga0466963_0237663 3300044694 Bacteria 1277
509 Ga0466957_0081528 3300044842 Bacteria 2015
510 Ga0466960_0127631 3300044901 Bacteria 1339
511 Ga0466967_0030498 3300045976 Bacteria 4526
512 Ga0466967_0182759 3300045976 Bacteria 1979
513 Ga0466967_0357229 3300045976 Bacteria 1415
514 Ga0495592_0056089 3300046454 Bacteria 2912
515 Ga0495592_0103108 3300046454 Bacteria 2030
516 Ga0495603_0049063 3300046455 Bacteria 2513
517 Ga0495629_0001773 3300046459 Bacteria 16935
518 Ga0495641_0077498 3300046461 Bacteria 1490
519 Ga0495641_0091317 3300046461 Bacteria 1360
520 Ga0495651_0008470 3300046462 Bacteria 7880
521 Ga0495653_0044857 3300046463 Bacteria 3430
522 Ga0495653_0049099 3300046463 Bacteria 3253
523 Ga0495653_0073549 3300046463 Bacteria 2550
524 Ga0495653_0245034 3300046463 Bacteria 1192
525 Ga0495580_0082718 3300046472 Bacteria 2237
526 Ga0495580_0185405 3300046472 Bacteria 1436
527 Ga0495580_0300229 3300046472 Bacteria 1094
528 Ga0495639_0010519 3300046475 Bacteria 3984
529 Ga0495639_0058195 3300046475 Bacteria 1767
530 Ga0495662_0000862 3300046476 Bacteria 14797
531 Ga0495662_0006475 3300046476 Bacteria 5849
532 Ga0495662_0104251 3300046476 Bacteria 1387
533 Ga0495664_0003765 3300046477 Bacteria 8279
534 Ga0495585_0015702 3300046492 Bacteria 4397
535 Ga0495594_0025402 3300046499 Bacteria 3184
536 Ga0495607_0028101 3300046501 Bacteria 3473
537 Ga0495608_0057938 3300046511 Bacteria 2555
538 Ga0495618_0140557 3300046514 Bacteria 1544
539 Ga0495628_0049236 3300046516 Bacteria 3337
540 Ga0495628_0344817 3300046516 Bacteria 1096
541 Ga0495630_0300509 3300046517 Bacteria 1226
542 Ga0495644_0001471 3300046523 Bacteria 9606
543 Ga0495666_0076114 3300046526 Bacteria 1591
544 Ga0495652_0021427 3300046529 Bacteria 5746
545 Ga0495652_0045513 3300046529 Bacteria 3771
546 Ga0495652_0139129 3300046529 Bacteria 1911
547 Ga0495665_0075844 3300046531 Bacteria 1770
548 Ga0495640_0072445 3300046533 Bacteria 2309
549 Ga0495640_0096683 3300046533 Bacteria 1943
550 Ga0495587_0069138 3300046536 Bacteria 2056
551 Ga0495587_0093676 3300046536 Bacteria 1734
552 Ga0495609_0119402 3300046538 Bacteria 1134
553 Ga0495621_0056368 3300046539 Bacteria 1417
554 Ga0495645_0031035 3300046543 Bacteria 3892
555 Ga0495645_0149353 3300046543 Bacteria 1625
556 Ga0495645_0157530 3300046543 Bacteria 1572
557 Ga0495645_0302413 3300046543 Bacteria 1044
558 Ga0495633_0005211 3300046558 Bacteria 8021
559 Ga0495667_0042465 3300046559 Bacteria 3015
560 Ga0495667_0132750 3300046559 Bacteria 1606
561 Ga0495656_0007359 3300046615 Bacteria 3887
562 Ga0495634_0009441 3300046642 Bacteria 7195
563 Ga0495634_0094322 3300046642 Bacteria 1939
564 Ga0495611_0125324 3300046648 Bacteria 1198
565 Ga0495635_0012909 3300046663 Bacteria 5849
566 Ga0495635_0021945 3300046663 Bacteria 4449
567 Ga0495635_0118712 3300046663 Bacteria 1804
568 Ga0495635_0364867 3300046663 Bacteria 962
569 Ga0495588_0152784 3300046674 Bacteria 1220
570 Ga0495646_0009338 3300046680 Bacteria 6223
571 Ga0495647_0040938 3300046681 Bacteria 1762
572 Ga0495647_0056768 3300046681 Bacteria 1535
573 Ga0495658_0005766 3300046683 Bacteria 6082
574 Ga0495669_0002627 3300046684 Bacteria 7347
575 Ga0495613_0010751 3300046689 Bacteria 6788
576 Ga0495613_0423506 3300046689 Bacteria 905
577 Ga0495624_0022669 3300046690 Bacteria 4146
578 Ga0495624_0092800 3300046690 Bacteria 1861
579 Ga0495670_0002981 3300046691 Bacteria 8344
580 Ga0495581_0071081 3300047315 Bacteria 2014
581 Ga0495581_0174252 3300047315 Bacteria 1258
582 Ga0495604_0105375 3300047317 Bacteria 2064
583 Ga0495604_0260266 3300047317 Bacteria 1179
584 Ga0495604_0311425 3300047317 Bacteria 1055
585 Ga0495674_0013643 3300047319 Bacteria 7633
586 Ga0495674_0099852 3300047319 Bacteria 2470
587 Ga0495676_0093487 3300047321 Bacteria 2242
588 Ga0495676_0207648 3300047321 Bacteria 1357
589 Ga0495676_0251510 3300047321 Bacteria 1205
590 Ga0495680_0149439 3300047322 Bacteria 1704
591 Ga0495680_0202209 3300047322 Bacteria 1424
592 Ga0495677_0069897 3300047445 Bacteria 1308
593 Ga0495684_0002658 3300047471 Bacteria 14168
594 Ga0495684_0018177 3300047471 Bacteria 5417
595 Ga0495593_0014389 3300047673 Bacteria 4499
596 Ga0495593_0400814 3300047673 Bacteria 686
597 Ga0495602_0153107 3300048088 Bacteria 1809
598 Ga0495614_0140945 3300048089 Bacteria 1071
599 Ga0496100_0005485 3300048903 Bacteria 6837
600 Ga0496101_0185246 3300048904 Bacteria 1604
601 Ga0496102_0000857 3300048905 Bacteria 29213
602 Ga0496102_0416944 3300048905 Bacteria 1261
603 Ga0496103_0001402 3300048906 Bacteria 16210
604 Ga0496103_0099258 3300048906 Bacteria 1842
605 Ga0496103_0169505 3300048906 Bacteria 1401
606 Ga0496104_0003432 3300048907 Bacteria 13669
607 Ga0496104_0009004 3300048907 Bacteria 8877
608 Ga0496104_0075925 3300048907 Bacteria 3200
609 Ga0496104_0191154 3300048907 Bacteria 1958
610 Ga0496104_0242307 3300048907 Bacteria 1715
611 Ga0496104_0541858 3300048907 Bacteria 1074
612 Ga0496105_0025746 3300048908 Bacteria 4793
613 Ga0496105_0251297 3300048908 Bacteria 1432
614 Ga0496105_0285638 3300048908 Bacteria 1329
615 Ga0496105_0468577 3300048908 Bacteria 992
616 Ga0496106_0026946 3300048909 Bacteria 4280
617 Ga0496106_0039849 3300048909 Bacteria 3518
618 Ga0496106_0129103 3300048909 Bacteria 1981
619 Ga0496107_0035893 3300048910 Bacteria 3555
620 Ga0496107_0081619 3300048910 Bacteria 2358
621 Ga0496107_0323170 3300048910 Bacteria 1148
622 Ga0496108_0003866 3300048911 Bacteria 12025
623 Ga0496109_0005368 3300048912 Bacteria 10715
624 Ga0496109_0029090 3300048912 Bacteria 4946
625 Ga0496109_0143389 3300048912 Bacteria 2234
626 Ga0496110_0012589 3300048913 Bacteria 6957
627 Ga0496110_0056112 3300048913 Bacteria 3466
628 Ga0496110_0184148 3300048913 Bacteria 1896
629 Ga0496110_0204685 3300048913 Bacteria 1793
630 Ga0496110_0230537 3300048913 Bacteria 1684
631 Ga0496110_0330239 3300048913 Bacteria 1389
632 Ga0496111_0046069 3300048914 Bacteria 3139
633 Ga0496111_0053597 3300048914 Bacteria 2914
634 Ga0496111_0152709 3300048914 Bacteria 1713
635 Ga0496111_0235983 3300048914 Bacteria 1358
636 Ga0496112_0004182 3300048915 Bacteria 12158
637 Ga0496112_0138306 3300048915 Bacteria 2405
638 Ga0496112_0227365 3300048915 Bacteria 1821
639 Ga0496112_0487329 3300048915 Bacteria 1169
640 Ga0496112_0505139 3300048915 Bacteria 1144
641 Ga0496113_0018247 3300048916 Bacteria 4885
642 Ga0496113_0052028 3300048916 Bacteria 3057
643 Ga0496113_0319161 3300048916 Bacteria 1245
644 Ga0496114_0001715 3300048917 Bacteria 16640
645 Ga0496114_0738561 3300048917 Bacteria 861
646 Ga0496115_0003668 3300048918 Bacteria 11050
647 Ga0496115_0005508 3300048918 Bacteria 9214
648 Ga0496115_0051574 3300048918 Bacteria 3298
649 Ga0496115_0440846 3300048918 Bacteria 1053
650 Ga0496126_0187964 3300048929 Bacteria 1751
651 Ga0501318_013502 3300049534 Bacteria 951
652 Ga0501031_0053884 3300049568 Bacteria 2622
653 Ga0501032_0295081 3300049569 Bacteria 1048
654 Ga0501034_0005441 3300049571 Bacteria 13914
655 Ga0501034_0022069 3300049571 Bacteria 6486
656 Ga0501034_0104559 3300049571 Bacteria 2825
657 Ga0501034_0451479 3300049571 Bacteria 1203
658 Ga0501037_0023203 3300049573 Bacteria 4588
659 Ga0501037_0073718 3300049573 Bacteria 2482
660 Ga0501038_0101979 3300049574 Bacteria 2389
661 Ga0501038_0150082 3300049574 Bacteria 1901
662 Ga0501038_0372742 3300049574 Bacteria 1108
663 Ga0501043_0051671 3300049579 Bacteria 3229
664 Ga0501047_0000218 3300049581 Bacteria 68952
665 Ga0501047_0007054 3300049581 Bacteria 10551
666 Ga0501047_0452222 3300049581 Bacteria 1114
667 Ga0501048_0000762 3300049582 Bacteria 23616
668 Ga0501067_0099398 3300049583 Bacteria 1616
669 Ga0501069_0109809 3300049585 Bacteria 1570
670 Ga0501070_0011908 3300049586 Bacteria 7346
671 Ga0501070_0064609 3300049586 Bacteria 3030
672 Ga0501070_0565039 3300049586 Bacteria 909
673 Ga0501073_0016647 3300049589 Bacteria 5327
674 Ga0501073_0072277 3300049589 Bacteria 2402
675 Ga0501074_0203616 3300049590 Bacteria 1410
676 Ga0501079_0195819 3300049741 Bacteria 1578
677 Ga0501079_0327996 3300049741 Bacteria 1199
678 Ga0501080_0000489 3300049742 Bacteria 30879
679 Ga0501080_0174437 3300049742 Bacteria 1981
680 Ga0501083_0035521 3300049744 Bacteria 3404
681 Ga0501083_0073874 3300049744 Bacteria 2266
682 Ga0501035_0294672 3300049822 Bacteria 1368
683 Ga0501044_0000822 3300049823 Bacteria 37410
684 Ga0501044_0000931 3300049823 Bacteria 35180
685 Ga0501044_0028137 3300049823 Bacteria 5933
686 Ga0501044_0054761 3300049823 Bacteria 4099
687 nmdc:mga06z11_86137_c1 3300050494 Bacteria 1696
688 nmdc:mga07m45_82627_c1 3300050496 Bacteria 1835
689 nmdc:mga05p37_238950_c1 3300050507 Bacteria 2186
690 nmdc:mga05p37_415996_c1 3300050507 Bacteria 1566
691 nmdc:mga09592_224785_c1 3300050508 Bacteria 1626
692 nmdc:mga09592_487620_c1 3300050508 Bacteria 1062
693 nmdc:mga0qj67_11473_c1 3300050509 Bacteria 6641
694 nmdc:mga0qj67_274379_c1 3300050509 Bacteria 904
695 nmdc:mga0qj67_98625_c1 3300050509 Bacteria 2354
696 nmdc:mga06r32_112677_c1 3300050510 Bacteria 2677
697 nmdc:mga06r32_117970_c1 3300050510 Bacteria 2616
698 nmdc:mga06r32_65348_c1 3300050510 Bacteria 3509
699 nmdc:mga08y16_137324_c1 3300050511 Bacteria 2542
700 nmdc:mga08y16_248815_c1 3300050511 Bacteria 1837
701 nmdc:mga0n895_1013778_c1 3300050512 Bacteria 811
702 nmdc:mga0n895_145344_c1 3300050512 Bacteria 2401
703 nmdc:mga0n895_216859_c1 3300050512 Bacteria 1943
704 nmdc:mga0n895_292442_c1 3300050512 Bacteria 1651
705 nmdc:mga0n895_6097_c1 3300050512 Bacteria 10177
706 nmdc:mga0n895_6117_c1 3300050512 Bacteria 10162
707 nmdc:mga0n895_902858_c1 3300050512 Bacteria 869
708 nmdc:mga0rr50_108460_c1 3300050513 Bacteria 2193
709 nmdc:mga0rr50_296815_c1 3300050513 Bacteria 1351
710 nmdc:mga0rr50_479651_c1 3300050513 Bacteria 1056
711 nmdc:mga0rr50_482060_c1 3300050513 Bacteria 1053
712 nmdc:mga0rr50_7816_c1 3300050513 Bacteria 6628
713 nmdc:mga08x19_275320_c1 3300050514 Bacteria 1165
714 nmdc:mga08x19_354033_c1 3300050514 Bacteria 1025
715 nmdc:mga0a205_18984_c1 3300050515 Bacteria 6478
716 nmdc:mga0a205_386734_c1 3300050515 Bacteria 1264
717 nmdc:mga0a205_8435_c1 3300050515 Bacteria 9377
718 Ga0495601_0005540 3300053077 Bacteria 7366
719 Ga0495601_0005957 3300053077 Bacteria 7113
720 Ga0495601_0012093 3300053077 Bacteria 5173
721 Ga0495601_0098247 3300053077 Bacteria 1889
722 Ga0495601_0098855 3300053077 Bacteria 1883
723 Ga0495601_0134512 3300053077 Bacteria 1611
724 Ga0495612_0004268 3300053078 Bacteria 5937
725 Ga0495612_0026304 3300053078 Bacteria 2338
726 Ga0495612_0066058 3300053078 Bacteria 1503
727 Ga0495595_0003051 3300053084 Bacteria 6620
728 Ga0495595_0038503 3300053084 Bacteria 2178
729 Ga0495619_0000043 3300053085 Bacteria 109865
730 Ga0495619_0003707 3300053085 Bacteria 9849
731 Ga0495619_0007997 3300053085 Bacteria 6693
732 Ga0495619_0010056 3300053085 Bacteria 5954
733 Ga0495619_0072311 3300053085 Bacteria 2309
734 Ga0500616_0171940 3300053153 Bacteria 983
735 2509078414 2508501114 Bacteria 7082538
736 2513591060 2513237087 Bacteria 5817514
737 2774872609 2773857925 Bacteria 6472445
738 2776259625 2775506901 Bacteria 9631051
739 2835315454 2835312727 Bacteria 7413381
740 2841911909 2841911363 Bacteria 6173697
741 2841921362 2841917233 Bacteria 6173500
742 2882458206 2882456835 Bacteria 6863978
743 2884299824 2884298095 Bacteria 3823049
744 2894239667 2894232714 Bacteria 8834183
745 8045867754 8045864390 Bacteria 5043873
746 Ga0114129_10367633
747 2214756334
748 ARcpr5oldR_c000183
749 ARSoilYngRDRAFT_c00120
750 ARcpr5yngRDRAFT_c000195
751 ARSoilOldRDRAFT_c000093
752 ARCol0oldRDRAFT_c01241
753 ARCol0yngRDRAFT_1000124
754 JGI24736J21556_1023741
755 JGI24746J21847_1000166
756 JGI24747J21853_1000502
757 JGI24740J21852_10013161
758 JGI24739J22299_10000057
759 JGI24737J22298_10000391
760 JGI24737J22298_10001583
761 JGI24750J21931_1000122
762 JGI24745J21846_1000432
763 JGI24748J21848_1008199
764 JGI24738J21930_10000767
765 JGI24749J21850_1000951
766 JGI24035J26624_1000228
767 JGI24033J26618_1000617
768 JGI24034J26672_10000108
769 JGI24742J22300_10000111
770 JGI24751J29686_10013943
771 JGI25151J46595_10000086
772 JGI25153J46596_10006736
773 Ga0055526_1000371
774 Ga0065717_1003053
775 Ga0065704_10107468
776 Ga0065712_10072616
777 Ga0065712_10103628
778 Ga0065715_10002625
779 Ga0065715_10090398
780 Ga0065715_10327286
781 Ga0065707_10135694
782 Ga0065707_10231548
783 Ga0070658_10038385
784 Ga0070658_10088474
785 Ga0070658_10153929
786 Ga0070676_10000170
787 Ga0070683_100003392
788 Ga0070690_100013276
789 Ga0070670_100021304
790 Ga0070670_100214100
791 Ga0070677_10000320
792 Ga0068869_100000181
793 Ga0068869_100538273
794 Ga0070680_100002750
795 Ga0070680_100044489
796 Ga0070680_100123385
797 Ga0070682_100000903
798 Ga0070682_100270343
799 Ga0068868_100000590
800 Ga0070660_100007288
801 Ga0070660_100043246
802 Ga0070660_100095703
803 Ga0070660_100145147
804 Ga0070689_100001256
805 Ga0070689_100015933
806 Ga0070689_100174164
807 Ga0070691_10000085
808 Ga0070691_10052867
809 Ga0070687_100000037
810 Ga0070687_100009985
811 Ga0070661_100014737
812 Ga0070692_10000038
813 Ga0070668_100012587
814 Ga0070669_100015059
815 Ga0070669_100344318
816 Ga0070675_100013975
817 Ga0070671_100010890
818 Ga0070674_100000195
819 Ga0070674_100063853
820 Ga0070674_100106305
821 Ga0070673_100000191
822 Ga0070688_100006371
823 Ga0070688_100008846
824 Ga0070688_100026022
825 Ga0070659_100001504
826 Ga0070667_100015512
827 Ga0070667_100330758
828 Ga0070709_10129111
829 Ga0070709_10199095
830 Ga0070709_10268758
831 Ga0070709_10334425
832 Ga0070714_100090919
833 Ga0070714_100410973
834 Ga0070714_100976386
835 Ga0070713_100030801
836 Ga0070701_10032655
837 Ga0070711_100098293
838 Ga0070711_100387541
839 Ga0070700_100009799
840 Ga0070700_100028282
841 Ga0070694_100019235
842 Ga0070694_100526283
843 Ga0070663_100005367
844 Ga0070663_100082466
845 Ga0070663_100148508
846 Ga0070663_100581151
847 Ga0070678_100010208
848 Ga0070678_100379491
849 Ga0070662_100001810
850 Ga0070662_100014550
851 Ga0070662_100531376
852 Ga0070681_10002441
853 Ga0070681_10007687
854 Ga0070681_10022976
855 Ga0068867_100000082
856 Ga0070685_10006868
857 Ga0070685_10022949
858 Ga0074259_10441056
859 Ga0070679_100006190
860 Ga0070679_100059858
861 Ga0070679_100092831
862 Ga0070684_100001355
863 Ga0070697_100046445
864 Ga0070697_100287956
865 Ga0068853_100020240
866 Ga0070672_100001052
867 Ga0070672_100083939
868 Ga0070686_100005857
869 Ga0070686_100038034
870 Ga0070686_100079120
871 Ga0070695_100024055
872 Ga0070695_100028142
873 Ga0070695_100319416
874 Ga0070696_100019040
875 Ga0070696_100019906
876 Ga0070696_100055263
877 Ga0070693_100006925
878 Ga0070693_100009627
879 Ga0070693_100043952
880 Ga0070665_100035064
881 Ga0070704_100002284
882 Ga0070704_100008914
883 Ga0068855_100066014
884 Ga0068855_100176270
885 Ga0068855_100356364
886 Ga0070664_100015140
887 Ga0070664_100417004
888 Ga0068857_100001561
889 Ga0068854_100000140
890 Ga0068854_100126224
891 Ga0068856_100014995
892 Ga0070702_100000796
893 Ga0070702_100171461
894 Ga0070702_100460682
895 Ga0068852_100009442
896 Ga0068852_100563421
897 Ga0068859_100029961
898 Ga0068864_100002090
899 Ga0068861_100062512
900 Ga0068870_10000063
901 Ga0068863_100026081
902 Ga0068863_100474921
903 Ga0068858_100025376
904 Ga0068858_100042274
905 Ga0068860_100003358
906 Ga0068862_100001746
907 Ga0081455_10000028
908 Ga0081455_10009936
909 Ga0081455_10177700
910 Ga0075363_100148315
911 Ga0075363_100148335
912 Ga0075432_10074372
913 Ga0070716_100176439
914 Ga0070712_100004132
915 Ga0075427_10008231
916 Ga0097621_100000083
917 Ga0097621_100136443
918 Ga0068871_100000067
919 Ga0068871_100097761
920 Ga0075430_100031292
921 Ga0075430_100120670
922 Ga0075430_100423031
923 Ga0075431_100252555
924 Ga0075433_10001386
925 Ga0075433_10018647
926 Ga0075433_10068230
927 Ga0075434_100001186
928 Ga0075434_100006580
929 Ga0075434_100131989
930 Ga0075429_100038699
931 Ga0075429_100535484
932 Ga0068865_100000244
933 Ga0068865_100414752
934 Ga0075436_100255479
935 Ga0097620_100029962
936 Ga0075435_100017607
937 Ga0075435_100109445
938 Ga0075435_100167915
939 Ga0075435_100472532
940 Ga0105240_10027953
941 Ga0105240_10109579
942 Ga0111539_10032831
943 Ga0111539_10091401
944 Ga0111539_10207974
945 Ga0111539_10301194
946 Ga0105245_10000762
947 Ga0105245_10204325
948 Ga0105247_10164326
949 Ga0105247_10178452
950 Ga0114129_10072717
951 Ga0114129_10263683
952 Ga0105243_10016647
953 Ga0105243_10039120
954 Ga0105243_10087167
955 Ga0105243_10124097
956 Ga0105243_10343414
957 Ga0105241_10000900
958 Ga0105241_10086615
959 Ga0105241_10247267
960 Ga0105242_10000036
961 Ga0105242_10177227
962 Ga0105248_10034721
963 Ga0105248_10050918
964 Ga0105248_10392904
965 Ga0105237_10029241
966 Ga0105238_10037849
967 Ga0105238_10101122
968 Ga0105238_10138983
969 Ga0105249_10001033
970 Ga0105249_10065149
971 Ga0105239_10035447
972 Ga0105239_10042248
973 Ga0157339_1000936
974 Ga0157373_10432321
975 Ga0157371_10037194
976 Ga0157371_10075390
977 Ga0157369_10102581
978 Ga0157369_10207590
979 Ga0157374_10009715
980 Ga0157378_10002181
981 Ga0157378_10066591
982 Ga0157378_10644994
983 Ga0163162_10011076
984 Ga0163162_10021532
985 Ga0157372_10039877
986 Ga0157372_10543544
987 Ga0157372_10725265
988 Ga0157375_10003806
989 Ga0157375_10188167
990 Ga0163163_10016530
991 Ga0163163_10088960
992 Ga0163163_10284043
993 Ga0163163_11022761
994 Ga0157380_10001301
995 Ga0157380_10097749
996 Ga0157377_10000124
997 Ga0157379_10000275
998 Ga0157379_10377201
999 Ga0157376_10000115
1000 Ga0163161_10010835
1001 Ga0163161_10175659
1002 Ga0163161_10298124
1003 Ga0213876_10060758
1004 Ga0207666_1000050
1005 Ga0207666_1000394
1006 Ga0207673_1000083
1007 Ga0209758_1009129
1008 Ga0207697_10000039
1009 Ga0207697_10044924
1010 Ga0207682_10000121
1011 Ga0207692_10116613
1012 Ga0207692_10173098
1013 Ga0207642_10001013
1014 Ga0207710_10104614
1015 Ga0207710_10206923
1016 Ga0207710_10213179
1017 Ga0207688_10000073
1018 Ga0207688_10001691
1019 Ga0207688_10041092
1020 Ga0207680_10062152
1021 Ga0207647_10013109
1022 Ga0207647_10023727
1023 Ga0207699_10147743
1024 Ga0207645_10000114
1025 Ga0207645_10080713
1026 Ga0207643_10000134
1027 Ga0207705_10076166
1028 Ga0207705_10107127
1029 Ga0207654_10000527
1030 Ga0207707_10017884
1031 Ga0207707_10072873
1032 Ga0207707_10149287
1033 Ga0207707_10165869
1034 Ga0207695_10079997
1035 Ga0207671_10015778
1036 Ga0207671_10077531
1037 Ga0207693_10002351
1038 Ga0207693_10149824
1039 Ga0207693_10236824
1040 Ga0207693_10396546
1041 Ga0207663_10288072
1042 Ga0207660_10000034
1043 Ga0207660_10101409
1044 Ga0207660_10413467
1045 Ga0207662_10008712
1046 Ga0207657_10005404
1047 Ga0207657_10014984
1048 Ga0207657_10037686
1049 Ga0207657_10148869
1050 Ga0207649_10000142
1051 Ga0207652_10002021
1052 Ga0207652_10028137
1053 Ga0207652_10084695
1054 Ga0207652_10196609
1055 Ga0207652_10210104
1056 Ga0207681_10000065
1057 Ga0207694_10061870
1058 Ga0207694_10176142
1059 Ga0207650_10013410
1060 Ga0207659_10000078
1061 Ga0207687_10007258
1062 Ga0207687_10055950
1063 Ga0207644_10023497
1064 Ga0207690_10000200
1065 Ga0207690_10469920
1066 Ga0207706_10023274
1067 Ga0207706_10264061
1068 Ga0207706_10541153
1069 Ga0207686_10007002
1070 Ga0207709_10000183
1071 Ga0207709_10178892
1072 Ga0207670_10006498
1073 Ga0207670_10486686
1074 Ga0207669_10000248
1075 Ga0207669_10185446
1076 Ga0207669_10194135
1077 Ga0207704_10000719
1078 Ga0207704_10061999
1079 Ga0207704_10288214
1080 Ga0207665_10110238
1081 Ga0207665_10226841
1082 Ga0207691_10000990
1083 Ga0207691_10162026
1084 Ga0207711_10031108
1085 Ga0207711_10117161
1086 Ga0207689_10000144
1087 Ga0207689_10070952
1088 Ga0207689_10164753
1089 Ga0207661_10001264
1090 Ga0207661_10169458
1091 Ga0207661_10269667
1092 Ga0207679_10000064
1093 Ga0207679_10188373
1094 Ga0207667_10140537
1095 Ga0207667_10271242
1096 Ga0207667_10275509
1097 Ga0207651_10000420
1098 Ga0207651_10234872
1099 Ga0207712_10001661
1100 Ga0207712_10105751
1101 Ga0207712_10136291
1102 Ga0207668_10193755
1103 Ga0207668_10362044
1104 Ga0207640_10004058
1105 Ga0207658_10022503
1106 Ga0207677_10008968
1107 Ga0207703_10010897
1108 Ga0207703_10380122
1109 Ga0207703_10668501
1110 Ga0207639_10379319
1111 Ga0207678_10003913
1112 Ga0207678_10028306
1113 Ga0207678_10043085
1114 Ga0207678_10067329
1115 Ga0207708_10016908
1116 Ga0207708_10029616
1117 Ga0207708_10161778
1118 Ga0207702_10032108
1119 Ga0207702_10122792
1120 Ga0207702_10795749
1121 Ga0207641_10001821
1122 Ga0207648_10023701
1123 Ga0207648_10491555
1124 Ga0207676_10000079
1125 Ga0207676_10162583
1126 Ga0207674_10000323
1127 Ga0207675_100000270
1128 Ga0207675_100048918
1129 Ga0207683_10000037
1130 Ga0207683_10012300
1131 Ga0207698_10001179
1132 Ga0209973_1001076
1133 Ga0209982_1014937
1134 Ga0210002_1000055
1135 Ga0209971_1012497
1136 Ga0209966_1010800
1137 Ga0209998_10003279
1138 Ga0209998_10006433
1139 Ga0209974_10001624
1140 Ga0207428_10000216
1141 Ga0207428_10000947
1142 Ga0207428_10135243
1143 Ga0207428_10169255
1144 Ga0268266_10050353
1145 Ga0268265_10001593
1146 Ga0268265_10163574
1147 Ga0268265_10459201
1148 Ga0268264_10002487
1149 Ga0268264_10185461
1150 Ga0265338_10034833
1151 Ga0265338_10075788
1152 Ga0265324_10073106
1153 Ga0265330_10119049
1154 Ga0265325_10000104
1155 Ga0265325_10012604
1156 Ga0265329_10042660
1157 Ga0265339_10001035
1158 Ga0265339_10150744
1159 Ga0265339_10171751
1160 Ga0265331_10074499
1161 Ga0265313_10000825
1162 Ga0265313_10009755
1163 Ga0265313_10033183
1164 Ga0265313_10057445
1165 Ga0316575_10021842
1166 Ga0265314_10039560
1167 Ga0265342_10000807
1168 Ga0265342_10004144
1169 Ga0265342_10185477
1170 Ga0265342_10236214
1171 Ga0307416_100578520
1172 Ga0307414_10315019
1173 Ga0307411_10064652
1174 Ga0316583_10029508
1175 Ga0373930_0002122
1176 Ga0373930_0041699
1177 Ga0373948_0015571
1178 Ga0373948_0017194
1179 Ga0373938_0000060
1180 Ga0373926_0052232
1181 Ga0373928_0002099
1182 Ga0373928_0002309
1183 Ga0373929_0016449
1184 Ga0373940_0012286
1185 Ga0373940_0027836
1186 Ga0373944_0090275
1187 Ga0373949_0006592
1188 Ga0373949_0024510
1189 Ga0373949_0074800
1190 Ga0373951_0017842
1191 Ga0373951_0064848
1192 Ga0373952_0003451
1193 Ga0373952_0003689
1194 Ga0373952_0032655
1195 Ga0373923_0046600
1196 Ga0373923_0136853
1197 Ga0373932_0002546
1198 Ga0373932_0003334
1199 Ga0373936_0074531
1200 Ga0373939_0000354
1201 Ga0373939_0003245
1202 Ga0373939_0005961
1203 Ga0373941_0000729
1204 Ga0373941_0018605
1205 Ga0373945_0024660
1206 Ga0373945_0130469
1207 Ga0373954_0003357
1208 Ga0373956_0032682
1209 Ga0373957_0048971
1210 Ga0373960_0000114
1211 Ga0373960_0010353
1212 Ga0373943_0025585
1213 Ga0373946_0021196
1214 Ga0373946_0129034
1215 Ga0373955_0096661
1216 Ga0373942_0030402
1217 Ga0373961_0007426
1218 Ga0373961_0039634
1219 Ga0373961_0095828
1220 Ga0373962_0001858
1221 Ga0373962_0010726
1222 Ga0373962_0021825
1223 Ga0373924_0052097
1224 Ga0373931_0005088
1225 Ga0373931_0005770
1226 Ga0373931_0011401
1227 Ga0373931_0067706
1228 Ga0373931_0171890
1229 Ga0373935_0039868
1230 Ga0373935_0115969
1231 Ga0373935_0225194
1232 Ga0373935_0229770
1233 Ga0373935_0233538
1234 Ga0373927_0033962
1235 Ga0373927_0185762
1236 Ga0373933_0456464
1237 Ga0373947_0017482
1238 Ga0373937_0110446
1239 Ga0373937_0232459
1240 Ga0373937_0354592
1241 Ga0373925_0332372
1242 Ga0395899_0002674
1243 Ga0395900_0003303
1244 Ga0395898_0006986
1245 Ga0395898_0008249
1246 Ga0395901_0245506
1247 Ga0436365_0070766
1248 Ga0436365_0379418
1249 Ga0436363_0417802
1250 Ga0439455_0031484
1251 Ga0439464_0056907
1252 Ga0466961_0131588
1253 Ga0466963_0237663
1254 Ga0466957_0081528
1255 Ga0466960_0127631
1256 Ga0466967_0030498
1257 Ga0466967_0182759
1258 Ga0466967_0357229
1259 Ga0495592_0056089
1260 Ga0495592_0103108
1261 Ga0495603_0049063
1262 Ga0495629_0001773
1263 Ga0495641_0077498
1264 Ga0495641_0091317
1265 Ga0495651_0008470
1266 Ga0495653_0044857
1267 Ga0495653_0049099
1268 Ga0495653_0073549
1269 Ga0495653_0245034
1270 Ga0495580_0082718
1271 Ga0495580_0185405
1272 Ga0495580_0300229
1273 Ga0495639_0010519
1274 Ga0495639_0058195
1275 Ga0495662_0000862
1276 Ga0495662_0006475
1277 Ga0495662_0104251
1278 Ga0495664_0003765
1279 Ga0495585_0015702
1280 Ga0495594_0025402
1281 Ga0495607_0028101
1282 Ga0495608_0057938
1283 Ga0495618_0140557
1284 Ga0495628_0049236
1285 Ga0495628_0344817
1286 Ga0495630_0300509
1287 Ga0495644_0001471
1288 Ga0495666_0076114
1289 Ga0495652_0021427
1290 Ga0495652_0045513
1291 Ga0495652_0139129
1292 Ga0495665_0075844
1293 Ga0495640_0072445
1294 Ga0495640_0096683
1295 Ga0495587_0069138
1296 Ga0495587_0093676
1297 Ga0495609_0119402
1298 Ga0495621_0056368
1299 Ga0495645_0031035
1300 Ga0495645_0149353
1301 Ga0495645_0157530
1302 Ga0495645_0302413
1303 Ga0495633_0005211
1304 Ga0495667_0042465
1305 Ga0495667_0132750
1306 Ga0495656_0007359
1307 Ga0495634_0009441
1308 Ga0495634_0094322
1309 Ga0495611_0125324
1310 Ga0495635_0012909
1311 Ga0495635_0021945
1312 Ga0495635_0118712
1313 Ga0495635_0364867
1314 Ga0495588_0152784
1315 Ga0495646_0009338
1316 Ga0495647_0040938
1317 Ga0495647_0056768
1318 Ga0495658_0005766
1319 Ga0495669_0002627
1320 Ga0495613_0010751
1321 Ga0495613_0423506
1322 Ga0495624_0022669
1323 Ga0495624_0092800
1324 Ga0495670_0002981
1325 Ga0495581_0071081
1326 Ga0495581_0174252
1327 Ga0495604_0105375
1328 Ga0495604_0260266
1329 Ga0495604_0311425
1330 Ga0495674_0013643
1331 Ga0495674_0099852
1332 Ga0495676_0093487
1333 Ga0495676_0207648
1334 Ga0495676_0251510
1335 Ga0495680_0149439
1336 Ga0495680_0202209
1337 Ga0495677_0069897
1338 Ga0495684_0002658
1339 Ga0495684_0018177
1340 Ga0495593_0014389
1341 Ga0495593_0400814
1342 Ga0495602_0153107
1343 Ga0495614_0140945
1344 Ga0496100_0005485
1345 Ga0496101_0185246
1346 Ga0496102_0000857
1347 Ga0496102_0416944
1348 Ga0496103_0001402
1349 Ga0496103_0099258
1350 Ga0496103_0169505
1351 Ga0496104_0003432
1352 Ga0496104_0009004
1353 Ga0496104_0075925
1354 Ga0496104_0191154
1355 Ga0496104_0242307
1356 Ga0496104_0541858
1357 Ga0496105_0025746
1358 Ga0496105_0251297
1359 Ga0496105_0285638
1360 Ga0496105_0468577
1361 Ga0496106_0026946
1362 Ga0496106_0039849
1363 Ga0496106_0129103
1364 Ga0496107_0035893
1365 Ga0496107_0081619
1366 Ga0496107_0323170
1367 Ga0496108_0003866
1368 Ga0496109_0005368
1369 Ga0496109_0029090
1370 Ga0496109_0143389
1371 Ga0496110_0012589
1372 Ga0496110_0056112
1373 Ga0496110_0184148
1374 Ga0496110_0204685
1375 Ga0496110_0230537
1376 Ga0496110_0330239
1377 Ga0496111_0046069
1378 Ga0496111_0053597
1379 Ga0496111_0152709
1380 Ga0496111_0235983
1381 Ga0496112_0004182
1382 Ga0496112_0138306
1383 Ga0496112_0227365
1384 Ga0496112_0487329
1385 Ga0496112_0505139
1386 Ga0496113_0018247
1387 Ga0496113_0052028
1388 Ga0496113_0319161
1389 Ga0496114_0001715
1390 Ga0496114_0738561
1391 Ga0496115_0003668
1392 Ga0496115_0005508
1393 Ga0496115_0051574
1394 Ga0496115_0440846
1395 Ga0496126_0187964
1396 Ga0501318_013502
1397 Ga0501031_0053884
1398 Ga0501032_0295081
1399 Ga0501034_0005441
1400 Ga0501034_0022069
1401 Ga0501034_0104559
1402 Ga0501034_0451479
1403 Ga0501037_0023203
1404 Ga0501037_0073718
1405 Ga0501038_0101979
1406 Ga0501038_0150082
1407 Ga0501038_0372742
1408 Ga0501043_0051671
1409 Ga0501047_0000218
1410 Ga0501047_0007054
1411 Ga0501047_0452222
1412 Ga0501048_0000762
1413 Ga0501067_0099398
1414 Ga0501069_0109809
1415 Ga0501070_0011908
1416 Ga0501070_0064609
1417 Ga0501070_0565039
1418 Ga0501073_0016647
1419 Ga0501073_0072277
1420 Ga0501074_0203616
1421 Ga0501079_0195819
1422 Ga0501079_0327996
1423 Ga0501080_0000489
1424 Ga0501080_0174437
1425 Ga0501083_0035521
1426 Ga0501083_0073874
1427 Ga0501035_0294672
1428 Ga0501044_0000822
1429 Ga0501044_0000931
1430 Ga0501044_0028137
1431 Ga0501044_0054761
1432 nmdc:mga06z11_86137_c1
1433 nmdc:mga07m45_82627_c1
1434 nmdc:mga05p37_238950_c1
1435 nmdc:mga05p37_415996_c1
1436 nmdc:mga09592_224785_c1
1437 nmdc:mga09592_487620_c1
1438 nmdc:mga0qj67_11473_c1
1439 nmdc:mga0qj67_274379_c1
1440 nmdc:mga0qj67_98625_c1
1441 nmdc:mga06r32_112677_c1
1442 nmdc:mga06r32_117970_c1
1443 nmdc:mga06r32_65348_c1
1444 nmdc:mga08y16_137324_c1
1445 nmdc:mga08y16_248815_c1
1446 nmdc:mga0n895_1013778_c1
1447 nmdc:mga0n895_145344_c1
1448 nmdc:mga0n895_216859_c1
1449 nmdc:mga0n895_292442_c1
1450 nmdc:mga0n895_6097_c1
1451 nmdc:mga0n895_6117_c1
1452 nmdc:mga0n895_902858_c1
1453 nmdc:mga0rr50_108460_c1
1454 nmdc:mga0rr50_296815_c1
1455 nmdc:mga0rr50_479651_c1
1456 nmdc:mga0rr50_482060_c1
1457 nmdc:mga0rr50_7816_c1
1458 nmdc:mga08x19_275320_c1
1459 nmdc:mga08x19_354033_c1
1460 nmdc:mga0a205_18984_c1
1461 nmdc:mga0a205_386734_c1
1462 nmdc:mga0a205_8435_c1
1463 Ga0495601_0005540
1464 Ga0495601_0005957
1465 Ga0495601_0012093
1466 Ga0495601_0098247
1467 Ga0495601_0098855
1468 Ga0495601_0134512
1469 Ga0495612_0004268
1470 Ga0495612_0026304
1471 Ga0495612_0066058
1472 Ga0495595_0003051
1473 Ga0495595_0038503
1474 Ga0495619_0000043
1475 Ga0495619_0003707
1476 Ga0495619_0007997
1477 Ga0495619_0010056
1478 Ga0495619_0072311
1479 Ga0500616_0171940
1480 2509078414
1481 2513591060
1482 2774872609
1483 2776259625
1484 2835315454
1485 2841911909
1486 2841921362
1487 2882458206
1488 2884299824
1489 2894239667
1490 8045867754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

159

223

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

32

112

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

41

113

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

136

228

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

36

117

0.87

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

146

232

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9669 17 218
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9641 17 216
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9635 17 217
6tah-assembly1.cif.gz_CAA crystal structure of a nu-class glutathione-s-transferase from pseudomonas aeruginosa pacs2 bound to glutathione 0.959 15 218
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9549 18 215
ID Description Score Start End Superfamily
4ecjB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9733 102 209 1.20.1050.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9718 18 100 3.40.30.10
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9706 17 98 3.40.30.10
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9706 102 204 1.20.1050.10
4f0bB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9652 104 209 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A523FIZ1-F1-model_v4 Glutathione S-transferase family protein 0.9965 17 87 GO:0016740
AF-A0A348G006-F1-model_v4 Thiol:disulfide oxidoreductase 0.9883 14 224
AF-A0A5M6HID1-F1-model_v4 Glutathione S-transferase family protein 0.9874 14 224 GO:0016740
AF-A0A833LL52-F1-model_v4 Glutathione S-transferase family protein 0.9862 13 218 GO:0016740
AF-A0A383DJX2-F1-model_v4 GST N-terminal domain-containing protein 0.9841 17 115

Map