F478772

General Info

Members Datasets Scaffolds Average Seq Length
744 488 1484 394

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_141156_c1|nmdc:mga0k408_141156_c1_72_1385
Length 437
Sequence LRSNKSTGRCDTEIVDIVIDLHFTRSRQTTAAPKAVAGGNGMTITQRDRDLGTGYAMKPSTTRTELTSVGRGTPMGELLRRYWHPIGLVADATDIPRKVRVLGEDLVLFRDRHGRAGLLHARCCHRGTTLYYGKVEEDGIRCCYHGWKFDTEGHCLEQPCEPEGGLFKDKVRQPWYPVQERYGLIFAYLGPAEKKPALPRYECLENMDDDEFVEADDSSIGGGGPAVIPCNWLQHFENVVDPYHVPVLHGSFSGPQFTNMMASMPEVKFETSPRGVIVRSIRHQEDGKVFYRVTEAALPTLRVVPNPRVAQFARVESIGWTLPIDDTSFRIYVAGRVKNSGDIGRMRSKFNGKFWWDMSEQEHQQFPGDYEAQVGQGPVTLHSEEHFGQSDRGILMIRRLLGDQLEAMAAGRDPIGISFGENAPPVEFEAGNFIREA

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
297 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
301 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
302 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
308 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
313 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
314 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
315 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
322 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
323 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
324 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
325 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
326 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
327 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
328 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
329 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
330 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
331 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
332 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
333 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
334 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
335 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
336 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
337 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
338 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
339 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
340 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
341 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
342 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
343 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
344 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
345 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
346 2791355199
347 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
348 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
349 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
350 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
351 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
352 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
353 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
354 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
355 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
356 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
357 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
358 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
359 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
360 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
361 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
362 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
363 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
364 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
365 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
366 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
367 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
368 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
369 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
370 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
371 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
372 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
373 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
374 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
375 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
376 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
377 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
378 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
379 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
380 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
381 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
382 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
383 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
384 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
385 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
386 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
387 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
388 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
389 2906610324
390 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
391 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
392 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
393 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
394 2922368715
395 2922425934
396 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
397 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
398 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
399 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
400 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
401 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
402 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
403 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
404 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
405 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
406 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
407 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
408 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
409 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
410 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
411 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
412 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
413 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
414 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
415 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
416 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
417 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
418 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
419 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
420 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
421 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
422 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
423 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
424 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
425 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
426 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
427 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
428 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
429 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
430 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
431 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
432 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
433 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
434 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
435 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
436 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
437 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
438 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
439 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
440 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
441 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
442 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
443 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
444 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
445 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
446 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
447 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
448 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
449 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
450 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
451 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
452 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
453 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
454 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
455 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
456 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
457 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
458 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
459 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
460 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
461 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
462 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
463 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
464 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
465 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
466 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
467 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
468 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
469 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
470 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
471 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
472 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
473 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
474 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
475 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
476 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
477 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
478 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
479 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
480 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
481 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
482 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
483 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
484 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
485 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
486 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
487 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
488 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.84
Metatranscriptomes 0.14
Isolates 22.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 18.68
Rhizoplane 2.69
Rhizosphere 57.53
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_141156_c1 3300050493 Bacteria 1433
2 JGI25153J46596_10001663 3300003215 Bacteria 13186
3 JGI25153J46596_10004484 3300003215 Bacteria 7521
4 JGI25160J50197_1001105 3300003354 Bacteria 13783
5 JGI25160J50197_1030105 3300003354 Bacteria 1421
6 Ga0055531_10004186 3300003794 Bacteria 8896
7 Ga0055543_1010516 3300004625 Bacteria 1936
8 Ga0065165_1001398 3300005262 Bacteria 26335
9 Ga0065165_1007399 3300005262 Bacteria 5411
10 Ga0065165_1011681 3300005262 Bacteria 3632
11 Ga0065707_10083489 3300005295 Bacteria 8984
12 Ga0070658_10020171 3300005327 Bacteria 5340
13 Ga0070676_10011679 3300005328 Bacteria 4779
14 Ga0070676_10060843 3300005328 Bacteria 2244
15 Ga0070683_100005776 3300005329 Bacteria 10344
16 Ga0070683_100009619 3300005329 Bacteria 8276
17 Ga0070670_100021540 3300005331 Bacteria 5543
18 Ga0070670_100069586 3300005331 Bacteria 3021
19 Ga0068869_100001168 3300005334 Bacteria 15386
20 Ga0068869_100003653 3300005334 Bacteria 9450
21 Ga0070666_10039083 3300005335 Bacteria 3160
22 Ga0070680_100001345 3300005336 Bacteria 17826
23 Ga0070680_100012435 3300005336 Bacteria 6614
24 Ga0070680_100024406 3300005336 Bacteria 4830
25 Ga0070680_100105041 3300005336 Bacteria 2348
26 Ga0070682_100131429 3300005337 Bacteria 1695
27 Ga0068868_100003041 3300005338 Bacteria 11678
28 Ga0068868_100125493 3300005338 Bacteria 2096
29 Ga0068868_100126085 3300005338 Bacteria 2092
30 Ga0070660_100007142 3300005339 Bacteria 7765
31 Ga0070689_100000939 3300005340 Bacteria 18114
32 Ga0070687_100000380 3300005343 Bacteria 15140
33 Ga0070692_10022797 3300005345 Bacteria 3062
34 Ga0070668_100029461 3300005347 Bacteria 4170
35 Ga0070671_100004312 3300005355 Bacteria 11253
36 Ga0070671_100070804 3300005355 Bacteria 2909
37 Ga0070674_100036004 3300005356 Bacteria 3319
38 Ga0070713_100006135 3300005436 Bacteria 8297
39 Ga0070713_100007264 3300005436 Bacteria 7759
40 Ga0070713_100041751 3300005436 Bacteria 3739
41 Ga0070713_100297400 3300005436 Bacteria 1485
42 Ga0070710_10007911 3300005437 Bacteria 5165
43 Ga0070711_100020412 3300005439 Bacteria 4270
44 Ga0070711_100036889 3300005439 Bacteria 3277
45 Ga0070705_100003046 3300005440 Bacteria 8258
46 Ga0070694_100008887 3300005444 Bacteria 6156
47 Ga0070694_100053296 3300005444 Bacteria 2737
48 Ga0070708_100018407 3300005445 Bacteria 5846
49 Ga0070663_100052850 3300005455 Bacteria 2899
50 Ga0070663_100102440 3300005455 Bacteria 2138
51 Ga0070678_100071722 3300005456 Bacteria 2593
52 Ga0070662_100122029 3300005457 Bacteria 1998
53 Ga0070681_10037730 3300005458 Bacteria 4847
54 Ga0070681_10049133 3300005458 Bacteria 4214
55 Ga0070681_10095616 3300005458 Bacteria 2919
56 Ga0070681_10108535 3300005458 Bacteria 2715
57 Ga0070706_100005001 3300005467 Bacteria 12678
58 Ga0070706_100090759 3300005467 Bacteria 2833
59 Ga0070707_100102307 3300005468 Bacteria 2776
60 Ga0070707_100158975 3300005468 Bacteria 2201
61 Ga0070698_100097403 3300005471 Bacteria 2917
62 Ga0070699_100072428 3300005518 Bacteria 2997
63 Ga0070679_100000040 3300005530 Bacteria 96771
64 Ga0070679_100039393 3300005530 Bacteria 4697
65 Ga0070679_100039457 3300005530 Bacteria 4693
66 Ga0070679_100045817 3300005530 Bacteria 4357
67 Ga0070679_100076098 3300005530 Bacteria 3346
68 Ga0070679_100162093 3300005530 Bacteria 2210
69 Ga0070679_100175149 3300005530 Bacteria 2117
70 Ga0070697_100020846 3300005536 Bacteria 5189
71 Ga0070697_100209482 3300005536 Bacteria 1659
72 Ga0070686_100008634 3300005544 Bacteria 5709
73 Ga0070686_100062911 3300005544 Bacteria 2402
74 Ga0070695_100000728 3300005545 Bacteria 17589
75 Ga0070695_100012446 3300005545 Bacteria 5106
76 Ga0070696_100006658 3300005546 Bacteria 7718
77 Ga0070696_100074126 3300005546 Bacteria 2399
78 Ga0070693_100000072 3300005547 Bacteria 41480
79 Ga0070665_100008324 3300005548 Bacteria 10489
80 Ga0070665_100147501 3300005548 Bacteria 2355
81 Ga0070704_100003550 3300005549 Bacteria 8965
82 Ga0070704_100041040 3300005549 Bacteria 3191
83 Ga0068855_100022297 3300005563 Bacteria 7589
84 Ga0068855_100032377 3300005563 Bacteria 6243
85 Ga0068855_100043632 3300005563 Bacteria 5310
86 Ga0068855_100385704 3300005563 Bacteria 1538
87 Ga0068855_100514409 3300005563 Bacteria 1299
88 Ga0070664_100260500 3300005564 Bacteria 1560
89 Ga0068854_100309241 3300005578 Bacteria 1281
90 Ga0068856_100000206 3300005614 Bacteria 63167
91 Ga0070702_100000084 3300005615 Bacteria 27525
92 Ga0070702_100019508 3300005615 Bacteria 3538
93 Ga0070702_100120263 3300005615 Bacteria 1643
94 Ga0068852_100013115 3300005616 Bacteria 6331
95 Ga0068859_100005387 3300005617 Bacteria 13012
96 Ga0068859_100086574 3300005617 Bacteria 3180
97 Ga0068864_100110354 3300005618 Bacteria 2449
98 Ga0068866_10002137 3300005718 Bacteria 8225
99 Ga0068861_100028861 3300005719 Bacteria 4052
100 Ga0068861_100029755 3300005719 Bacteria 3997
101 Ga0068863_100022194 3300005841 Bacteria 6060
102 Ga0068860_100000015 3300005843 Bacteria 313639
103 Ga0068860_100002375 3300005843 Bacteria 19777
104 Ga0068860_100023161 3300005843 Bacteria 6004
105 Ga0068860_100093591 3300005843 Bacteria 2864
106 Ga0068862_100008551 3300005844 Bacteria 8468
107 Ga0068862_100009057 3300005844 Bacteria 8242
108 Ga0081455_10001290 3300005937 Bacteria 31158
109 Ga0081455_10008641 3300005937 Bacteria 10559
110 Ga0081455_10022821 3300005937 Bacteria 5837
111 Ga0081455_10033438 3300005937 Bacteria 4621
112 Ga0081540_1003994 3300005983 Bacteria 11435
113 Ga0081540_1010272 3300005983 Bacteria 6356
114 Ga0081540_1029308 3300005983 Bacteria 3069
115 Ga0081539_10000250 3300005985 Bacteria 125352
116 Ga0081539_10037991 3300005985 Bacteria 2860
117 Ga0070717_10007696 3300006028 Bacteria 8013
118 Ga0075365_10003405 3300006038 Bacteria 8181
119 Ga0075365_10187165 3300006038 Bacteria 1448
120 Ga0075368_10002193 3300006042 Bacteria 6330
121 Ga0075363_100003399 3300006048 Bacteria 6762
122 Ga0075363_100011033 3300006048 Bacteria 4313
123 Ga0075363_100061674 3300006048 Bacteria 2021
124 Ga0075364_10006868 3300006051 Bacteria 6719
125 Ga0075364_10023098 3300006051 Bacteria 3935
126 Ga0075364_10055503 3300006051 Bacteria 2592
127 Ga0075364_10089026 3300006051 Bacteria 2047
128 Ga0070716_100016348 3300006173 Bacteria 3827
129 Ga0075367_10005860 3300006178 Bacteria 6156
130 Ga0075366_10011026 3300006195 Bacteria 5089
131 Ga0097621_100000794 3300006237 Bacteria 22198
132 Ga0097621_100072611 3300006237 Bacteria 2846
133 Ga0075370_10024890 3300006353 Bacteria 3309
134 Ga0075370_10052338 3300006353 Bacteria 2316
135 Ga0068871_100040416 3300006358 Bacteria 3736
136 Ga0075434_100000073 3300006871 Bacteria 52987
137 Ga0075434_100078541 3300006871 Bacteria 3296
138 Ga0075434_100102963 3300006871 Bacteria 2863
139 Ga0075434_100159663 3300006871 Bacteria 2274
140 Ga0075436_100088422 3300006914 Bacteria 2152
141 Ga0097620_100005387 3300006931 Bacteria 13012
142 Ga0097620_100086573 3300006931 Bacteria 3180
143 Ga0099824_1010776 3300006942 Bacteria 10606
144 Ga0075435_100028335 3300007076 Bacteria 4392
145 Ga0105250_10034026 3300009092 Bacteria 2046
146 Ga0105240_10004768 3300009093 Bacteria 20468
147 Ga0105240_10005580 3300009093 Bacteria 18698
148 Ga0105240_10008475 3300009093 Bacteria 14705
149 Ga0105240_10012399 3300009093 Bacteria 11769
150 Ga0105240_10030220 3300009093 Bacteria 7043
151 Ga0105240_10043256 3300009093 Bacteria 5732
152 Ga0105240_10074562 3300009093 Bacteria 4188
153 Ga0105240_10173830 3300009093 Bacteria 2548
154 Ga0105240_10228726 3300009093 Bacteria 2163
155 Ga0105240_10233842 3300009093 Bacteria 2134
156 Ga0111539_10139702 3300009094 Bacteria 2836
157 Ga0105245_10101065 3300009098 Bacteria 2668
158 Ga0105247_10028017 3300009101 Bacteria 3407
159 Ga0105247_10063911 3300009101 Bacteria 2286
160 Ga0105247_10121643 3300009101 Bacteria 1692
161 Ga0105241_10247510 3300009174 Bacteria 1510
162 Ga0105242_10003543 3300009176 Bacteria 12137
163 Ga0105248_10003158 3300009177 Bacteria 18241
164 Ga0105248_10124709 3300009177 Bacteria 2905
165 Ga0105237_10034698 3300009545 Bacteria 5106
166 Ga0105237_10047282 3300009545 Bacteria 4326
167 Ga0105237_10053353 3300009545 Bacteria 4055
168 Ga0105237_10121173 3300009545 Bacteria 2610
169 Ga0105237_10333228 3300009545 Bacteria 1522
170 Ga0105238_10005729 3300009551 Bacteria 12282
171 Ga0105238_10019418 3300009551 Bacteria 6922
172 Ga0105238_10081344 3300009551 Bacteria 3229
173 Ga0105249_10235000 3300009553 Bacteria 1809
174 Ga0105249_10512355 3300009553 Bacteria 1246
175 Ga0105239_10045647 3300010375 Bacteria 4802
176 Ga0105239_10169244 3300010375 Bacteria 2443
177 Ga0157370_10005066 3300013104 Bacteria 14868
178 Ga0157370_10031484 3300013104 Bacteria 5187
179 Ga0157369_10001810 3300013105 Bacteria 25870
180 Ga0157369_10008037 3300013105 Bacteria 12098
181 Ga0157369_10011202 3300013105 Bacteria 10192
182 Ga0157369_10027168 3300013105 Bacteria 6347
183 Ga0157369_10045460 3300013105 Bacteria 4775
184 Ga0157369_10064102 3300013105 Bacteria 3958
185 Ga0157374_10008000 3300013296 Bacteria 9037
186 Ga0157374_10025372 3300013296 Bacteria 5322
187 Ga0157374_10191678 3300013296 Bacteria 2000
188 Ga0157378_10021279 3300013297 Bacteria 5702
189 Ga0157378_10348132 3300013297 Bacteria 1447
190 Ga0163162_10032364 3300013306 Bacteria 5194
191 Ga0163162_10110806 3300013306 Bacteria 2842
192 Ga0157375_10000509 3300013308 Bacteria 34952
193 Ga0163163_10023580 3300014325 Bacteria 5842
194 Ga0157380_10281381 3300014326 Bacteria 1522
195 Ga0182008_10000260 3300014497 Bacteria 41217
196 Ga0157376_10009314 3300014969 Bacteria 7134
197 Ga0157376_10406263 3300014969 Bacteria 1318
198 Ga0206350_10587933 3300020080 Bacteria 1250
199 Ga0213876_10051473 3300021384 Bacteria 2177
200 Ga0209563_101832 3300025230 Bacteria 5238
201 Ga0207425_1004975 3300025245 Bacteria 3871
202 Ga0209677_101013 3300025253 Bacteria 13433
203 Ga0209677_106354 3300025253 Bacteria 2813
204 Ga0209148_1002176 3300025254 Bacteria 7255
205 Ga0209233_1001809 3300025261 Bacteria 8232
206 Ga0209233_1009729 3300025261 Bacteria 2913
207 Ga0209233_1015947 3300025261 Bacteria 2079
208 Ga0209455_1004806 3300025272 Bacteria 4319
209 Ga0209455_1012099 3300025272 Bacteria 2083
210 Ga0209564_1004383 3300025295 Bacteria 8664
211 Ga0209758_1000021 3300025297 Bacteria 697691
212 Ga0209758_1003248 3300025297 Bacteria 15075
213 Ga0209758_1003460 3300025297 Bacteria 14315
214 Ga0209758_1008408 3300025297 Bacteria 6696
215 Ga0209758_1051955 3300025297 Bacteria 1422
216 Ga0209256_1001949 3300025299 Bacteria 18730
217 Ga0207426_1001467 3300025302 Bacteria 19421
218 Ga0207426_1003349 3300025302 Bacteria 8824
219 Ga0207426_1026097 3300025302 Bacteria 1961
220 Ga0209257_1003545 3300025304 Bacteria 13262
221 Ga0207653_10021954 3300025885 Bacteria 2027
222 Ga0207642_10000462 3300025899 Bacteria 12434
223 Ga0207710_10012941 3300025900 Bacteria 3514
224 Ga0207647_10003643 3300025904 Bacteria 11520
225 Ga0207685_10037861 3300025905 Bacteria 1779
226 Ga0207645_10013411 3300025907 Bacteria 5523
227 Ga0207643_10032476 3300025908 Bacteria 2916
228 Ga0207705_10059231 3300025909 Bacteria 2764
229 Ga0207684_10008541 3300025910 Bacteria 9110
230 Ga0207684_10076329 3300025910 Bacteria 2848
231 Ga0207654_10044963 3300025911 Bacteria 2511
232 Ga0207707_10000905 3300025912 Bacteria 28936
233 Ga0207707_10003136 3300025912 Bacteria 14679
234 Ga0207707_10005766 3300025912 Bacteria 10828
235 Ga0207707_10038125 3300025912 Bacteria 4200
236 Ga0207707_10146524 3300025912 Bacteria 2064
237 Ga0207695_10000278 3300025913 Bacteria 127446
238 Ga0207695_10057448 3300025913 Bacteria 4042
239 Ga0207695_10112290 3300025913 Bacteria 2703
240 Ga0207695_10223342 3300025913 Bacteria 1790
241 Ga0207695_10273079 3300025913 Bacteria 1586
242 Ga0207671_10008477 3300025914 Bacteria 8711
243 Ga0207671_10051396 3300025914 Bacteria 3054
244 Ga0207671_10115569 3300025914 Bacteria 2046
245 Ga0207660_10002278 3300025917 Bacteria 12642
246 Ga0207660_10080678 3300025917 Bacteria 2390
247 Ga0207660_10092955 3300025917 Bacteria 2240
248 Ga0207660_10097393 3300025917 Bacteria 2192
249 Ga0207657_10011301 3300025919 Bacteria 8866
250 Ga0207649_10106632 3300025920 Bacteria 1864
251 Ga0207652_10001020 3300025921 Bacteria 25786
252 Ga0207652_10041402 3300025921 Bacteria 3916
253 Ga0207652_10061635 3300025921 Unclassified 3239
254 Ga0207652_10167362 3300025921 Bacteria 1971
255 Ga0207646_10001050 3300025922 Bacteria 35163
256 Ga0207646_10050766 3300025922 Bacteria 3712
257 Ga0207694_10045467 3300025924 Bacteria 3391
258 Ga0207694_10084882 3300025924 Bacteria 2491
259 Ga0207694_10085129 3300025924 Bacteria 2488
260 Ga0207694_10091680 3300025924 Bacteria 2398
261 Ga0207687_10005853 3300025927 Bacteria 8132
262 Ga0207687_10057392 3300025927 Bacteria 2735
263 Ga0207687_10072098 3300025927 Bacteria 2470
264 Ga0207700_10000968 3300025928 Bacteria 16567
265 Ga0207700_10038978 3300025928 Bacteria 3454
266 Ga0207700_10063451 3300025928 Bacteria 2810
267 Ga0207664_10009354 3300025929 Bacteria 6873
268 Ga0207644_10009072 3300025931 Bacteria 6521
269 Ga0207644_10107991 3300025931 Bacteria 2100
270 Ga0207644_10184357 3300025931 Bacteria 1638
271 Ga0207706_10205946 3300025933 Bacteria 1725
272 Ga0207709_10075457 3300025935 Bacteria 2155
273 Ga0207670_10011269 3300025936 Bacteria 5182
274 Ga0207670_10051402 3300025936 Bacteria 2767
275 Ga0207670_10157782 3300025936 Bacteria 1690
276 Ga0207669_10031536 3300025937 Bacteria 2963
277 Ga0207665_10000681 3300025939 Bacteria 22932
278 Ga0207661_10000608 3300025944 Bacteria 22916
279 Ga0207661_10031992 3300025944 Bacteria 4071
280 Ga0207661_10059096 3300025944 Bacteria 3088
281 Ga0207667_10048370 3300025949 Bacteria 4497
282 Ga0207667_10287082 3300025949 Bacteria 1681
283 Ga0207668_10206977 3300025972 Bacteria 1566
284 Ga0207640_10024207 3300025981 Bacteria 3661
285 Ga0207640_10292036 3300025981 Bacteria 1286
286 Ga0207658_10022481 3300025986 Bacteria 4391
287 Ga0207677_10009261 3300026023 Bacteria 5533
288 Ga0207703_10096392 3300026035 Bacteria 2497
289 Ga0207703_10232564 3300026035 Bacteria 1653
290 Ga0207678_10058480 3300026067 Bacteria 3317
291 Ga0207678_10186927 3300026067 Bacteria 1770
292 Ga0207678_10232799 3300026067 Bacteria 1577
293 Ga0207708_10000164 3300026075 Bacteria 52172
294 Ga0207708_10128014 3300026075 Bacteria 1983
295 Ga0207702_10000516 3300026078 Bacteria 43552
296 Ga0207702_10071890 3300026078 Bacteria 2980
297 Ga0207641_10103158 3300026088 Bacteria 2516
298 Ga0207641_10196662 3300026088 Bacteria 1856
299 Ga0207648_10121807 3300026089 Bacteria 2294
300 Ga0207676_10005436 3300026095 Bacteria 9011
301 Ga0207676_10072937 3300026095 Bacteria 2761
302 Ga0207674_10022133 3300026116 Bacteria 6832
303 Ga0207675_100001661 3300026118 Bacteria 22258
304 Ga0207675_100040645 3300026118 Bacteria 4343
305 Ga0207675_100059188 3300026118 Bacteria 3575
306 Ga0207675_100128893 3300026118 Bacteria 2398
307 Ga0207683_10098307 3300026121 Bacteria 2611
308 Ga0207698_10014229 3300026142 Bacteria 5281
309 Ga0207698_10136738 3300026142 Bacteria 2104
310 Ga0209589_1000003 3300027357 Bacteria 629130
311 Ga0209489_100003 3300027361 Bacteria 663105
312 Ga0209700_100003 3300027363 Bacteria 663105
313 Ga0268266_10003299 3300028379 Bacteria 16216
314 Ga0268266_10005357 3300028379 Bacteria 11989
315 Ga0268266_10054619 3300028379 Bacteria 3432
316 Ga0268266_10261949 3300028379 Bacteria 1602
317 Ga0268264_10000002 3300028381 Bacteria 1153045
318 Ga0268264_10000014 3300028381 Bacteria 509962
319 Ga0268264_10000022 3300028381 Bacteria 476624
320 Ga0307515_10048142 3300028794 Bacteria 6455
321 Ga0265338_10006948 3300028800 Bacteria 14236
322 Ga0265338_10014030 3300028800 Bacteria 8973
323 Ga0265338_10032716 3300028800 Bacteria 5063
324 Ga0307511_10024391 3300030521 Bacteria 5606
325 Ga0265330_10015883 3300031235 Bacteria 3479
326 Ga0265340_10003393 3300031247 Bacteria 8995
327 Ga0265340_10040313 3300031247 Bacteria 2301
328 Ga0265331_10030748 3300031250 Bacteria 2672
329 Ga0307509_10000003 3300031507 Bacteria 577578
330 Ga0307508_10000038 3300031616 Bacteria 150186
331 Ga0307508_10018871 3300031616 Bacteria 6266
332 Ga0265314_10026787 3300031711 Bacteria 4326
333 Ga0265314_10128512 3300031711 Bacteria 1584
334 Ga0307416_100215608 3300032002 Bacteria 1836
335 Ga0307507_10033705 3300033179 Bacteria 5310
336 Ga0307510_10002750 3300033180 Bacteria 20142
337 Ga0307510_10027366 3300033180 Bacteria 6533
338 Ga0307510_10028002 3300033180 Bacteria 6442
339 Ga0307510_10147645 3300033180 Bacteria 1979
340 Ga0315911_1000001 3300033442 Bacteria 1088602
341 Ga0373930_0002261 3300034816 Bacteria 2968
342 Ga0373958_0002012 3300034819 Bacteria 2802
343 Ga0373934_0036869 3300035086 Bacteria 1926
344 Ga0373940_0005186 3300035088 Bacteria 2807
345 Ga0373951_0007362 3300035091 Bacteria 2500
346 Ga0373952_0007982 3300035092 Bacteria 1998
347 Ga0373923_0022016 3300035111 Bacteria 2494
348 Ga0373932_0002181 3300035112 Bacteria 5054
349 Ga0373939_0003147 3300035114 Bacteria 3881
350 Ga0373953_0016423 3300035117 Bacteria 2701
351 Ga0373943_0010280 3300035170 Bacteria 4198
352 Ga0373955_0019663 3300035172 Bacteria 3379
353 Ga0373931_0000219 3300035691 Bacteria 24390
354 Ga0373935_0013366 3300035692 Bacteria 4952
355 Ga0373927_0048347 3300035695 Bacteria 2751
356 Ga0373927_0155902 3300035695 Bacteria 1495
357 Ga0373937_0037517 3300036401 Bacteria 4417
358 Ga0373937_0356141 3300036401 Bacteria 1387
359 Ga0373925_0058421 3300037068 Bacteria 2892
360 Ga0395900_0071413 3300037418 Bacteria 3569
361 Ga0395898_0013627 3300037466 Bacteria 8367
362 Ga0436364_1523349 3300037853 Bacteria 4836
363 Ga0436365_0325557 3300039437 Bacteria 3529
364 Ga0436365_0589284 3300039437 Bacteria 2591
365 Ga0436361_0179933 3300039447 Bacteria 5750
366 Ga0436363_0705849 3300039450 Bacteria 2780
367 Ga0439441_004079 3300042001 Bacteria 2193
368 Ga0439434_0059728 3300042435 Bacteria 1191
369 Ga0451577_0011048 3300042876 Bacteria 8575
370 Ga0451577_0136687 3300042876 Unclassified 2201
371 Ga0453683_0008631 3300044673 Bacteria 6833
372 Ga0466964_0008304 3300044706 Bacteria 3897
373 Ga0453684_0020543 3300044712 Bacteria 9949
374 Ga0466957_0045421 3300044842 Bacteria 2665
375 Ga0466959_0011746 3300045049 Bacteria 6303
376 Ga0466959_0088085 3300045049 Bacteria 2232
377 Ga0451576_0020504 3300045051 Bacteria 7195
378 Ga0451576_0020965 3300045051 Bacteria 7111
379 Ga0451576_0185033 3300045051 Bacteria 2175
380 Ga0451576_0568763 3300045051 Bacteria 1191
381 Ga0466967_0032830 3300045976 Bacteria 4388
382 Ga0495603_0013599 3300046455 Bacteria 4924
383 Ga0495629_0004944 3300046459 Bacteria 9998
384 Ga0495629_0034362 3300046459 Bacteria 3585
385 Ga0495638_0062450 3300046460 Bacteria 2299
386 Ga0495651_0032814 3300046462 Bacteria 4050
387 Ga0495651_0054244 3300046462 Bacteria 3083
388 Ga0495664_0056389 3300046477 Bacteria 2337
389 Ga0495664_0166571 3300046477 Bacteria 1337
390 Ga0495606_0004280 3300046507 Bacteria 14399
391 Ga0495606_0012362 3300046507 Bacteria 6853
392 Ga0495610_0075751 3300046512 Bacteria 1557
393 Ga0495618_0054760 3300046514 Bacteria 2525
394 Ga0495618_0118611 3300046514 Bacteria 1695
395 Ga0495620_0021005 3300046515 Bacteria 3178
396 Ga0495628_0103018 3300046516 Bacteria 2201
397 Ga0495628_0219260 3300046516 Bacteria 1429
398 Ga0495630_0073525 3300046517 Bacteria 2574
399 Ga0495643_0058280 3300046522 Bacteria 2055
400 Ga0495648_0031742 3300046524 Bacteria 3475
401 Ga0495665_0062901 3300046531 Bacteria 1959
402 Ga0495640_0033573 3300046533 Bacteria 3644
403 Ga0495598_0010006 3300046537 Bacteria 2259
404 Ga0495621_0003227 3300046539 Bacteria 4480
405 Ga0495645_0019140 3300046543 Bacteria 4929
406 Ga0495622_0012050 3300046557 Bacteria 3997
407 Ga0495622_0085012 3300046557 Bacteria 1455
408 Ga0495667_0019808 3300046559 Bacteria 4540
409 Ga0495656_0034658 3300046615 Bacteria 2068
410 Ga0495634_0052159 3300046642 Bacteria 2742
411 Ga0495588_0134345 3300046674 Bacteria 1306
412 Ga0495657_0003001 3300046675 Bacteria 13961
413 Ga0495623_0010683 3300046679 Bacteria 5944
414 Ga0495658_0005587 3300046683 Bacteria 6178
415 Ga0495613_0064203 3300046689 Bacteria 2686
416 Ga0495649_0010418 3300046694 Bacteria 5482
417 Ga0495600_0008626 3300046809 Bacteria 6268
418 Ga0495604_0002947 3300047317 Bacteria 13625
419 Ga0495604_0014662 3300047317 Bacteria 6246
420 Ga0495636_0003555 3300047318 Bacteria 6040
421 Ga0495636_0017371 3300047318 Bacteria 2880
422 Ga0495674_0035963 3300047319 Bacteria 4463
423 Ga0495674_0072288 3300047319 Bacteria 2975
424 Ga0495680_0016791 3300047322 Bacteria 6276
425 Ga0495673_0026433 3300047469 Bacteria 2776
426 Ga0495593_0047469 3300047673 Bacteria 2284
427 Ga0495602_0016228 3300048088 Bacteria 7492
428 Ga0496101_0052632 3300048904 Bacteria 2936
429 Ga0496102_0005812 3300048905 Bacteria 10489
430 Ga0496102_0158483 3300048905 Bacteria 2128
431 Ga0496104_0114550 3300048907 Bacteria 2586
432 Ga0496104_0176894 3300048907 Bacteria 2044
433 Ga0496105_0003152 3300048908 Bacteria 12139
434 Ga0496105_0006533 3300048908 Bacteria 8971
435 Ga0496106_0024036 3300048909 Bacteria 4529
436 Ga0496108_0002970 3300048911 Bacteria 13628
437 Ga0496109_0008142 3300048912 Bacteria 8890
438 Ga0496109_0066604 3300048912 Bacteria 3298
439 Ga0496111_0253381 3300048914 Bacteria 1306
440 Ga0496112_0043179 3300048915 Bacteria 4413
441 Ga0496112_0091638 3300048915 Bacteria 3008
442 Ga0496112_0107896 3300048915 Bacteria 2754
443 Ga0496112_0181644 3300048915 Bacteria 2067
444 Ga0496113_0174036 3300048916 Bacteria 1705
445 Ga0496115_0000957 3300048918 Bacteria 20941
446 Ga0496115_0006709 3300048918 Bacteria 8443
447 Ga0496115_0054839 3300048918 Bacteria 3201
448 Ga0496116_0034667 3300048919 Bacteria 3557
449 Ga0496116_0036580 3300048919 Bacteria 3433
450 Ga0496117_0023249 3300048920 Bacteria 4948
451 Ga0496117_0055895 3300048920 Bacteria 2754
452 Ga0496118_0003921 3300048921 Bacteria 18212
453 Ga0496119_0011916 3300048922 Bacteria 7132
454 Ga0496119_0084686 3300048922 Bacteria 1817
455 Ga0496121_0001096 3300048924 Bacteria 47791
456 Ga0496121_0005239 3300048924 Bacteria 16773
457 Ga0496121_0019856 3300048924 Bacteria 6692
458 Ga0496121_0036296 3300048924 Bacteria 4394
459 Ga0496121_0043277 3300048924 Bacteria 3903
460 Ga0496121_0086718 3300048924 Bacteria 2459
461 Ga0496121_0116299 3300048924 Bacteria 2028
462 Ga0496124_0005282 3300048927 Bacteria 14613
463 Ga0496124_0100546 3300048927 Bacteria 2344
464 Ga0496125_0000953 3300048928 Bacteria 45480
465 Ga0496125_0018556 3300048928 Bacteria 6605
466 Ga0496125_0043801 3300048928 Bacteria 3793
467 Ga0496125_0097533 3300048928 Bacteria 2178
468 Ga0496126_0017403 3300048929 Bacteria 7160
469 Ga0496126_0021292 3300048929 Bacteria 6334
470 Ga0496126_0030130 3300048929 Bacteria 5145
471 Ga0496126_0035620 3300048929 Bacteria 4662
472 Ga0496126_0126285 3300048929 Bacteria 2214
473 Ga0501033_0013948 3300049570 Bacteria 6114
474 Ga0501033_0113233 3300049570 Bacteria 1973
475 Ga0501033_0184474 3300049570 Bacteria 1495
476 Ga0501039_0032512 3300049575 Bacteria 4023
477 Ga0501039_0089426 3300049575 Bacteria 2400
478 Ga0501039_0184115 3300049575 Bacteria 1642
479 Ga0501039_0234480 3300049575 Bacteria 1443
480 Ga0501040_0024997 3300049576 Bacteria 4013
481 Ga0501040_0074114 3300049576 Bacteria 2352
482 Ga0501040_0114292 3300049576 Bacteria 1890
483 Ga0501041_0046530 3300049577 Bacteria 2639
484 Ga0501041_0100015 3300049577 Bacteria 1794
485 Ga0501042_0140867 3300049578 Bacteria 1739
486 Ga0501046_0114252 3300049580 Bacteria 2060
487 Ga0501048_0032023 3300049582 Bacteria 3802
488 Ga0501067_0055357 3300049583 Bacteria 2198
489 Ga0501069_0060364 3300049585 Bacteria 2117
490 Ga0501070_0004355 3300049586 Bacteria 12170
491 Ga0501070_0142892 3300049586 Bacteria 1976
492 Ga0501072_0036154 3300049588 Bacteria 3871
493 Ga0501074_0026796 3300049590 Bacteria 4179
494 Ga0501074_0046410 3300049590 Bacteria 3141
495 Ga0501074_0058735 3300049590 Bacteria 2771
496 Ga0501075_0022280 3300049591 Bacteria 4626
497 Ga0501075_0061994 3300049591 Bacteria 2818
498 Ga0501076_0010534 3300049592 Bacteria 6862
499 Ga0501076_0035092 3300049592 Bacteria 3923
500 Ga0501076_0112658 3300049592 Bacteria 2200
501 Ga0501076_0136774 3300049592 Bacteria 1989
502 Ga0501077_0020082 3300049593 Bacteria 4228
503 Ga0501077_0032889 3300049593 Bacteria 3303
504 Ga0501077_0126067 3300049593 Bacteria 1623
505 Ga0501077_0131755 3300049593 Bacteria 1585
506 Ga0501079_0024099 3300049741 Bacteria 4669
507 Ga0501079_0035868 3300049741 Bacteria 3818
508 Ga0501079_0037047 3300049741 Bacteria 3758
509 Ga0501079_0098579 3300049741 Bacteria 2265
510 Ga0501080_0003031 3300049742 Bacteria 14819
511 Ga0501080_0041841 3300049742 Bacteria 4268
512 Ga0501080_0053067 3300049742 Bacteria 3774
513 Ga0501081_0007199 3300049743 Bacteria 7237
514 Ga0501081_0032629 3300049743 Bacteria 3533
515 Ga0501035_0057127 3300049822 Bacteria 3480
516 Ga0501035_0083626 3300049822 Bacteria 2816
517 Ga0501044_0027518 3300049823 Bacteria 6008
518 Ga0501045_0041209 3300049824 Bacteria 3360
519 nmdc:mga00v17_57479_c1 3300050491 Bacteria 2380
520 nmdc:mga00v17_98601_c1 3300050491 Bacteria 1843
521 nmdc:mga0yw44_10533_c2 3300050492 Bacteria 4196
522 nmdc:mga0k408_3294_c1 3300050493 Bacteria 8542
523 nmdc:mga0k408_62554_c1 3300050493 Bacteria 2165
524 nmdc:mga06z11_12238_c1 3300050494 Bacteria 3727
525 nmdc:mga06z11_24905_c1 3300050494 Bacteria 2829
526 nmdc:mga06z11_33231_c1 3300050494 Bacteria 2522
527 nmdc:mga05p37_36890_c1 3300050507 Bacteria 5995
528 nmdc:mga06r32_230004_c1 3300050510 Bacteria 1842
529 nmdc:mga0n895_15164_c1 3300050512 Bacteria 7023
530 nmdc:mga0rr50_304197_c1 3300050513 Bacteria 1334
531 nmdc:mga0rr50_955_c1 3300050513 Bacteria 15665
532 nmdc:mga08x19_65037_c1 3300050514 Bacteria 2368
533 nmdc:mga0a205_108790_c1 3300050515 Bacteria 2670
534 nmdc:mga0a205_27317_c1 3300050515 Bacteria 5450
535 nmdc:mga0sz30_19502_c1 3300050516 Bacteria 2727
536 nmdc:mga0sz30_47689_c1 3300050516 Bacteria 1811
537 Ga0495619_0005576 3300053085 Bacteria 7984
538 Ga0500643_000073 3300053087 Bacteria 112517
539 Ga0500647_0033544 3300053091 Bacteria 2449
540 Ga0500583_0064839 3300053092 Bacteria 1733
541 Ga0500566_0003586 3300053094 Bacteria 9250
542 Ga0500566_0013445 3300053094 Bacteria 4818
543 Ga0500566_0035900 3300053094 Bacteria 2879
544 Ga0500641_0011089 3300053096 Bacteria 3268
545 Ga0500557_000075 3300053105 Bacteria 38272
546 Ga0500572_009649 3300053111 Bacteria 2287
547 Ga0500595_001031 3300053119 Bacteria 15533
548 Ga0500595_002021 3300053119 Bacteria 10379
549 Ga0500595_015944 3300053119 Bacteria 2808
550 Ga0500642_0000200 3300053130 Bacteria 24539
551 Ga0500658_0018167 3300053134 Bacteria 2633
552 Ga0500568_0005733 3300053139 Bacteria 6362
553 Ga0500573_0070155 3300053140 Bacteria 1999
554 Ga0500577_0057320 3300053142 Bacteria 1486
555 Ga0500616_0025137 3300053153 Bacteria 3305
556 Ga0500616_0035363 3300053153 Bacteria 2717
557 Ga0500619_031043 3300053154 Bacteria 1628
558 Ga0500622_0024541 3300053156 Bacteria 3188
559 Ga0500634_0104267 3300053161 Bacteria 1413
560 Ga0500638_029600 3300053162 Bacteria 2635
561 Ga0500636_0002419 3300053177 Bacteria 10334
562 Ga0500636_0131635 3300053177 Bacteria 1392
563 Ga0500636_0163053 3300053177 Bacteria 1213
564 Ga0500637_0000464 3300053178 Bacteria 15643
565 Ga0500645_042003 3300053730 Bacteria 1349
566 Ga0500601_001554 3300053737 Bacteria 2489
567 Ga0501084_0012686 3300054114 Bacteria 6982
568 Ga0500661_000204 3300055283 Bacteria 10512
569 Ga0500661_016636 3300055283 Bacteria 1315
570 Ga0501082_0018135 3300060353 Bacteria 6061
571 Ga0501082_0059874 3300060353 Bacteria 3281
572 Ga0501082_0128518 3300060353 Bacteria 2198
573 Ga0501082_0149347 3300060353 Bacteria 2029
574 Ga0530510_0022686 3300061734 Bacteria 4472
575 Ga0530510_0126285 3300061734 Bacteria 1880
576 2507509355 2507262055 Bacteria 8048963
577 2508543411 2508501009 Bacteria 7784016
578 2508698815 2508501042 Bacteria 8719808
579 2511123205 2510917020 Bacteria 5657507
580 2511396866 2511231028 Bacteria 8046582
581 2513646640 2513237095 Bacteria 8976980
582 2513656693 2513237096 Bacteria 8722461
583 2513718509 2513237104 Bacteria 10034502
584 2513858516 2513237137 Bacteria 9558895
585 2513876447 2513237139 Bacteria 8737671
586 2513895031 2513237141 Bacteria 8496279
587 2513917878 2513237145 Bacteria 8979722
588 2514010787 2513237161 Bacteria 8871253
589 2515628947 2515154112 Bacteria 8294334
590 2517102010 2517093001 Bacteria 9002274
591 2517893076 2517572143 Bacteria 9484767
592 2524436559 2524023205 Bacteria 8918781
593 2524536806 2524023228 Bacteria 10118060
594 2528851545 2528768022 Bacteria 10457665
595 2617352300 2617270735 Bacteria 9163226
596 2728753232 2728368998 Bacteria 8720350
597 2745081149 2744054633 Bacteria 8678936
598 2793064048 2791355196 Bacteria 7323613
599 2793070091 2791355197 Bacteria 8420563
600 2793077262
601 2805919726 2802429603 Bacteria 8777136
602 2818240166 2816332527 Bacteria 8933356
603 2824656619 2824653114 Bacteria 8493680
604 2824667874 2824661429 Bacteria 9877870
605 2824678946 2824671348 Bacteria 8369588
606 2824695513 2824687955 Bacteria 8360029
607 2824701561 2824696289 Bacteria 8335049
608 2824710227 2824704595 Bacteria 9667483
609 2824758599 2824753945 Bacteria 9787441
610 2824768338 2824763712 Bacteria 9792355
611 2824779157 2824773399 Bacteria 8360218
612 2841947211 2841941048 Bacteria 8688029
613 2841950654 2841949485 Bacteria 8680857
614 2841966969 2841966195 Bacteria 8673214
615 2841975718 2841974524 Bacteria 8931498
616 2842039768 2842038055 Bacteria 8002051
617 2842047286 2842045827 Bacteria 8006841
618 2844318368 2844315083 Bacteria 8138177
619 2847945851 2847939898 Bacteria 8606328
620 2874597464 2874590934 Bacteria 8299676
621 2874609618 2874604998 Bacteria 7834745
622 2874612834 2874612657 Bacteria 8252029
623 2874636259 2874628541 Bacteria 8630250
624 2874648540 2874645413 Bacteria 8214782
625 2876770734 2876761206 Bacteria 10111113
626 2876777739 2876771140 Bacteria 8287509
627 2876822502 2876818435 Bacteria 8274608
628 2879078147 2879074833 Bacteria 8279565
629 2879102612 2879099564 Bacteria 10442239
630 2879134512 2879127579 Bacteria 8294491
631 2879149953 2879142872 Bacteria 8267021
632 2885381997 2885374607 Bacteria 8927485
633 2885416989 2885409591 Bacteria 9235467
634 2888383312 2888378607 Bacteria 9652610
635 2888394609 2888388044 Bacteria 7304136
636 2888423700 2888419890 Bacteria 7857137
637 2889040580 2889033259 Bacteria 9099371
638 2903729316 2903727486 Bacteria 8281579
639 2903755807 2903748898 Bacteria 9972761
640 2904696240 2904690495 Bacteria 9412302
641 2904717155 2904711408 Bacteria 9771557
642 2906606043 2906602504 Bacteria 8295279
643 2906617923
644 2906640700 2906635258 Bacteria 8601019
645 2906661414 2906660503 Bacteria 8595048
646 2908743465 2908739725 Bacteria 8628932
647 2908760974 2908756301 Bacteria 8864324
648 2922373469
649 2922429421
650 2929617215 2929615660 Bacteria 9193770
651 2929626919 2929624759 Bacteria 9339455
652 2932796490 2932794094 Bacteria 7915132
653 2932803514 2932801729 Bacteria 7987968
654 2932813077 2932809354 Bacteria 9135765
655 2932821007 2932818245 Bacteria 9955613
656 2932835206 2932828146 Bacteria 9745859
657 2933579172 2933577622 Bacteria 9116884
658 2935611755 2935608549 Bacteria 8203142
659 2935621585 2935616580 Bacteria 9032984
660 2935645518 2935638405 Bacteria 10015038
661 2935651825 2935648319 Bacteria 8801166
662 2935660635 2935656913 Bacteria 8965014
663 2935667636 2935665750 Bacteria 9571747
664 2935681798 2935675223 Bacteria 9928132
665 2935688384 2935684952 Bacteria 9590419
666 2935695728 2935694250 Bacteria 9291695
667 2935706477 2935703347 Bacteria 10242284
668 2935715403 2935713505 Bacteria 9608509
669 2935726033 2935722832 Bacteria 9608746
670 2935734222 2935732158 Bacteria 9706831
671 2935743601 2935741537 Bacteria 9707219
672 2935754362 2935750917 Bacteria 9590372
673 2935768522 2935760218 Bacteria 9817913
674 2935774017 2935769743 Bacteria 7878163
675 2935780563 2935777560 Bacteria 8077691
676 2935789589 2935785616 Bacteria 7962367
677 2935797366 2935793552 Bacteria 8012592
678 2935806556 2935801545 Bacteria 9301974
679 2935813149 2935810662 Bacteria 9401221
680 2935821233 2935819856 Bacteria 8261050
681 2935830802 2935827899 Bacteria 10038562
682 2935840828 2935837841 Bacteria 9454360
683 2935850506 2935847175 Bacteria 8228321
684 2935859832 2935855204 Bacteria 9035059
685 2935869068 2935864058 Bacteria 9784707
686 2935880712 2935873716 Bacteria 9632195
687 2935886584 2935883170 Bacteria 7964738
688 2935914109 2935908558 Bacteria 8568796
689 2935921279 2935916978 Bacteria 9113783
690 2935931702 2935926038 Bacteria 8601059
691 2935940363 2935934488 Bacteria 8602579
692 2935947812 2935942939 Bacteria 8599779
693 2935956647 2935951376 Bacteria 8602333
694 2935960461 2935959822 Bacteria 7869783
695 2935973440 2935967501 Bacteria 8603075
696 2935980944 2935975950 Bacteria 8347125
697 2935989608 2935984226 Bacteria 8302647
698 2935999360 2935992306 Bacteria 9802711
699 2936006657 2936002035 Bacteria 9362176
700 2936014691 2936011229 Bacteria 8801034
701 2936023512 2936019824 Bacteria 8804134
702 2936032540 2936028420 Bacteria 8965941
703 2936043701 2936037263 Bacteria 9446081
704 2936050432 2936046547 Bacteria 8903709
705 2936059076 2936055302 Bacteria 8785755
706 2940560262 2940556831 Bacteria 9590747
707 2941534127 2941531003 Bacteria 7653939
708 2941541041 2941538514 Bacteria 9402094
709 3005479584 3005474847 Bacteria 9259049
710 3005598460 3005594810 Bacteria 8716512
711 3005714143 3005710791 Bacteria 7622528
712 3005721648 3005718088 Bacteria 8283608
713 8006941543 8006933436 Bacteria 10410654
714 8006981252 8006973647 Bacteria 10679141
715 8006988137 8006984368 Bacteria 9651211
716 8016514206 8016511872 Bacteria 9921665
717 8016535666 8016530956 Bacteria 8155261
718 8016539952 8016539877 Bacteria 8155419
719 8016553283 8016548790 Bacteria 8155074
720 8016574001 8016566248 Bacteria 8158151
721 8016578121 8016575299 Bacteria 8154085
722 8016599497 8016595262 Bacteria 8149947
723 8016611493 8016603502 Bacteria 8731218
724 8016631809 8016630954 Bacteria 9217207
725 8017062215 8017057580 Bacteria 10023680
726 8019535390 8019530166 Bacteria 8155624
727 8019544108 8019538911 Bacteria 7872763
728 8019554693 8019547302 Bacteria 7996444
729 8019567848 8019565922 Bacteria 9639779
730 8019581665 8019576017 Bacteria 10049540
731 8019589329 8019586578 Bacteria 10212056
732 8019601931 8019597564 Bacteria 10041141
733 8019616621 8019608314 Bacteria 10042931
734 8019635238 8019629233 Bacteria 8687553
735 8019644485 8019638758 Bacteria 9062356
736 8019663081 8019659431 Bacteria 8577854
737 8019672681 8019668869 Bacteria 8791617
738 8019683480 8019678201 Bacteria 8863603
739 8019689226 8019687851 Bacteria 8712826
740 8055747170 8055742211 Bacteria 9226248
741 8056690172 8056689827 Bacteria 6712655
742 8056972727 8056967851 Bacteria 9038162
743 nmdc:mga0k408_141156_c1
744 JGI25153J46596_10001663
745 JGI25153J46596_10004484
746 JGI25160J50197_1001105
747 JGI25160J50197_1030105
748 Ga0055531_10004186
749 Ga0055543_1010516
750 Ga0065165_1001398
751 Ga0065165_1007399
752 Ga0065165_1011681
753 Ga0065707_10083489
754 Ga0070658_10020171
755 Ga0070676_10011679
756 Ga0070676_10060843
757 Ga0070683_100005776
758 Ga0070683_100009619
759 Ga0070670_100021540
760 Ga0070670_100069586
761 Ga0068869_100001168
762 Ga0068869_100003653
763 Ga0070666_10039083
764 Ga0070680_100001345
765 Ga0070680_100012435
766 Ga0070680_100024406
767 Ga0070680_100105041
768 Ga0070682_100131429
769 Ga0068868_100003041
770 Ga0068868_100125493
771 Ga0068868_100126085
772 Ga0070660_100007142
773 Ga0070689_100000939
774 Ga0070687_100000380
775 Ga0070692_10022797
776 Ga0070668_100029461
777 Ga0070671_100004312
778 Ga0070671_100070804
779 Ga0070674_100036004
780 Ga0070713_100006135
781 Ga0070713_100007264
782 Ga0070713_100041751
783 Ga0070713_100297400
784 Ga0070710_10007911
785 Ga0070711_100020412
786 Ga0070711_100036889
787 Ga0070705_100003046
788 Ga0070694_100008887
789 Ga0070694_100053296
790 Ga0070708_100018407
791 Ga0070663_100052850
792 Ga0070663_100102440
793 Ga0070678_100071722
794 Ga0070662_100122029
795 Ga0070681_10037730
796 Ga0070681_10049133
797 Ga0070681_10095616
798 Ga0070681_10108535
799 Ga0070706_100005001
800 Ga0070706_100090759
801 Ga0070707_100102307
802 Ga0070707_100158975
803 Ga0070698_100097403
804 Ga0070699_100072428
805 Ga0070679_100000040
806 Ga0070679_100039393
807 Ga0070679_100039457
808 Ga0070679_100045817
809 Ga0070679_100076098
810 Ga0070679_100162093
811 Ga0070679_100175149
812 Ga0070697_100020846
813 Ga0070697_100209482
814 Ga0070686_100008634
815 Ga0070686_100062911
816 Ga0070695_100000728
817 Ga0070695_100012446
818 Ga0070696_100006658
819 Ga0070696_100074126
820 Ga0070693_100000072
821 Ga0070665_100008324
822 Ga0070665_100147501
823 Ga0070704_100003550
824 Ga0070704_100041040
825 Ga0068855_100022297
826 Ga0068855_100032377
827 Ga0068855_100043632
828 Ga0068855_100385704
829 Ga0068855_100514409
830 Ga0070664_100260500
831 Ga0068854_100309241
832 Ga0068856_100000206
833 Ga0070702_100000084
834 Ga0070702_100019508
835 Ga0070702_100120263
836 Ga0068852_100013115
837 Ga0068859_100005387
838 Ga0068859_100086574
839 Ga0068864_100110354
840 Ga0068866_10002137
841 Ga0068861_100028861
842 Ga0068861_100029755
843 Ga0068863_100022194
844 Ga0068860_100000015
845 Ga0068860_100002375
846 Ga0068860_100023161
847 Ga0068860_100093591
848 Ga0068862_100008551
849 Ga0068862_100009057
850 Ga0081455_10001290
851 Ga0081455_10008641
852 Ga0081455_10022821
853 Ga0081455_10033438
854 Ga0081540_1003994
855 Ga0081540_1010272
856 Ga0081540_1029308
857 Ga0081539_10000250
858 Ga0081539_10037991
859 Ga0070717_10007696
860 Ga0075365_10003405
861 Ga0075365_10187165
862 Ga0075368_10002193
863 Ga0075363_100003399
864 Ga0075363_100011033
865 Ga0075363_100061674
866 Ga0075364_10006868
867 Ga0075364_10023098
868 Ga0075364_10055503
869 Ga0075364_10089026
870 Ga0070716_100016348
871 Ga0075367_10005860
872 Ga0075366_10011026
873 Ga0097621_100000794
874 Ga0097621_100072611
875 Ga0075370_10024890
876 Ga0075370_10052338
877 Ga0068871_100040416
878 Ga0075434_100000073
879 Ga0075434_100078541
880 Ga0075434_100102963
881 Ga0075434_100159663
882 Ga0075436_100088422
883 Ga0097620_100005387
884 Ga0097620_100086573
885 Ga0099824_1010776
886 Ga0075435_100028335
887 Ga0105250_10034026
888 Ga0105240_10004768
889 Ga0105240_10005580
890 Ga0105240_10008475
891 Ga0105240_10012399
892 Ga0105240_10030220
893 Ga0105240_10043256
894 Ga0105240_10074562
895 Ga0105240_10173830
896 Ga0105240_10228726
897 Ga0105240_10233842
898 Ga0111539_10139702
899 Ga0105245_10101065
900 Ga0105247_10028017
901 Ga0105247_10063911
902 Ga0105247_10121643
903 Ga0105241_10247510
904 Ga0105242_10003543
905 Ga0105248_10003158
906 Ga0105248_10124709
907 Ga0105237_10034698
908 Ga0105237_10047282
909 Ga0105237_10053353
910 Ga0105237_10121173
911 Ga0105237_10333228
912 Ga0105238_10005729
913 Ga0105238_10019418
914 Ga0105238_10081344
915 Ga0105249_10235000
916 Ga0105249_10512355
917 Ga0105239_10045647
918 Ga0105239_10169244
919 Ga0157370_10005066
920 Ga0157370_10031484
921 Ga0157369_10001810
922 Ga0157369_10008037
923 Ga0157369_10011202
924 Ga0157369_10027168
925 Ga0157369_10045460
926 Ga0157369_10064102
927 Ga0157374_10008000
928 Ga0157374_10025372
929 Ga0157374_10191678
930 Ga0157378_10021279
931 Ga0157378_10348132
932 Ga0163162_10032364
933 Ga0163162_10110806
934 Ga0157375_10000509
935 Ga0163163_10023580
936 Ga0157380_10281381
937 Ga0182008_10000260
938 Ga0157376_10009314
939 Ga0157376_10406263
940 Ga0206350_10587933
941 Ga0213876_10051473
942 Ga0209563_101832
943 Ga0207425_1004975
944 Ga0209677_101013
945 Ga0209677_106354
946 Ga0209148_1002176
947 Ga0209233_1001809
948 Ga0209233_1009729
949 Ga0209233_1015947
950 Ga0209455_1004806
951 Ga0209455_1012099
952 Ga0209564_1004383
953 Ga0209758_1000021
954 Ga0209758_1003248
955 Ga0209758_1003460
956 Ga0209758_1008408
957 Ga0209758_1051955
958 Ga0209256_1001949
959 Ga0207426_1001467
960 Ga0207426_1003349
961 Ga0207426_1026097
962 Ga0209257_1003545
963 Ga0207653_10021954
964 Ga0207642_10000462
965 Ga0207710_10012941
966 Ga0207647_10003643
967 Ga0207685_10037861
968 Ga0207645_10013411
969 Ga0207643_10032476
970 Ga0207705_10059231
971 Ga0207684_10008541
972 Ga0207684_10076329
973 Ga0207654_10044963
974 Ga0207707_10000905
975 Ga0207707_10003136
976 Ga0207707_10005766
977 Ga0207707_10038125
978 Ga0207707_10146524
979 Ga0207695_10000278
980 Ga0207695_10057448
981 Ga0207695_10112290
982 Ga0207695_10223342
983 Ga0207695_10273079
984 Ga0207671_10008477
985 Ga0207671_10051396
986 Ga0207671_10115569
987 Ga0207660_10002278
988 Ga0207660_10080678
989 Ga0207660_10092955
990 Ga0207660_10097393
991 Ga0207657_10011301
992 Ga0207649_10106632
993 Ga0207652_10001020
994 Ga0207652_10041402
995 Ga0207652_10061635
996 Ga0207652_10167362
997 Ga0207646_10001050
998 Ga0207646_10050766
999 Ga0207694_10045467
1000 Ga0207694_10084882
1001 Ga0207694_10085129
1002 Ga0207694_10091680
1003 Ga0207687_10005853
1004 Ga0207687_10057392
1005 Ga0207687_10072098
1006 Ga0207700_10000968
1007 Ga0207700_10038978
1008 Ga0207700_10063451
1009 Ga0207664_10009354
1010 Ga0207644_10009072
1011 Ga0207644_10107991
1012 Ga0207644_10184357
1013 Ga0207706_10205946
1014 Ga0207709_10075457
1015 Ga0207670_10011269
1016 Ga0207670_10051402
1017 Ga0207670_10157782
1018 Ga0207669_10031536
1019 Ga0207665_10000681
1020 Ga0207661_10000608
1021 Ga0207661_10031992
1022 Ga0207661_10059096
1023 Ga0207667_10048370
1024 Ga0207667_10287082
1025 Ga0207668_10206977
1026 Ga0207640_10024207
1027 Ga0207640_10292036
1028 Ga0207658_10022481
1029 Ga0207677_10009261
1030 Ga0207703_10096392
1031 Ga0207703_10232564
1032 Ga0207678_10058480
1033 Ga0207678_10186927
1034 Ga0207678_10232799
1035 Ga0207708_10000164
1036 Ga0207708_10128014
1037 Ga0207702_10000516
1038 Ga0207702_10071890
1039 Ga0207641_10103158
1040 Ga0207641_10196662
1041 Ga0207648_10121807
1042 Ga0207676_10005436
1043 Ga0207676_10072937
1044 Ga0207674_10022133
1045 Ga0207675_100001661
1046 Ga0207675_100040645
1047 Ga0207675_100059188
1048 Ga0207675_100128893
1049 Ga0207683_10098307
1050 Ga0207698_10014229
1051 Ga0207698_10136738
1052 Ga0209589_1000003
1053 Ga0209489_100003
1054 Ga0209700_100003
1055 Ga0268266_10003299
1056 Ga0268266_10005357
1057 Ga0268266_10054619
1058 Ga0268266_10261949
1059 Ga0268264_10000002
1060 Ga0268264_10000014
1061 Ga0268264_10000022
1062 Ga0307515_10048142
1063 Ga0265338_10006948
1064 Ga0265338_10014030
1065 Ga0265338_10032716
1066 Ga0307511_10024391
1067 Ga0265330_10015883
1068 Ga0265340_10003393
1069 Ga0265340_10040313
1070 Ga0265331_10030748
1071 Ga0307509_10000003
1072 Ga0307508_10000038
1073 Ga0307508_10018871
1074 Ga0265314_10026787
1075 Ga0265314_10128512
1076 Ga0307416_100215608
1077 Ga0307507_10033705
1078 Ga0307510_10002750
1079 Ga0307510_10027366
1080 Ga0307510_10028002
1081 Ga0307510_10147645
1082 Ga0315911_1000001
1083 Ga0373930_0002261
1084 Ga0373958_0002012
1085 Ga0373934_0036869
1086 Ga0373940_0005186
1087 Ga0373951_0007362
1088 Ga0373952_0007982
1089 Ga0373923_0022016
1090 Ga0373932_0002181
1091 Ga0373939_0003147
1092 Ga0373953_0016423
1093 Ga0373943_0010280
1094 Ga0373955_0019663
1095 Ga0373931_0000219
1096 Ga0373935_0013366
1097 Ga0373927_0048347
1098 Ga0373927_0155902
1099 Ga0373937_0037517
1100 Ga0373937_0356141
1101 Ga0373925_0058421
1102 Ga0395900_0071413
1103 Ga0395898_0013627
1104 Ga0436364_1523349
1105 Ga0436365_0325557
1106 Ga0436365_0589284
1107 Ga0436361_0179933
1108 Ga0436363_0705849
1109 Ga0439441_004079
1110 Ga0439434_0059728
1111 Ga0451577_0011048
1112 Ga0451577_0136687
1113 Ga0453683_0008631
1114 Ga0466964_0008304
1115 Ga0453684_0020543
1116 Ga0466957_0045421
1117 Ga0466959_0011746
1118 Ga0466959_0088085
1119 Ga0451576_0020504
1120 Ga0451576_0020965
1121 Ga0451576_0185033
1122 Ga0451576_0568763
1123 Ga0466967_0032830
1124 Ga0495603_0013599
1125 Ga0495629_0004944
1126 Ga0495629_0034362
1127 Ga0495638_0062450
1128 Ga0495651_0032814
1129 Ga0495651_0054244
1130 Ga0495664_0056389
1131 Ga0495664_0166571
1132 Ga0495606_0004280
1133 Ga0495606_0012362
1134 Ga0495610_0075751
1135 Ga0495618_0054760
1136 Ga0495618_0118611
1137 Ga0495620_0021005
1138 Ga0495628_0103018
1139 Ga0495628_0219260
1140 Ga0495630_0073525
1141 Ga0495643_0058280
1142 Ga0495648_0031742
1143 Ga0495665_0062901
1144 Ga0495640_0033573
1145 Ga0495598_0010006
1146 Ga0495621_0003227
1147 Ga0495645_0019140
1148 Ga0495622_0012050
1149 Ga0495622_0085012
1150 Ga0495667_0019808
1151 Ga0495656_0034658
1152 Ga0495634_0052159
1153 Ga0495588_0134345
1154 Ga0495657_0003001
1155 Ga0495623_0010683
1156 Ga0495658_0005587
1157 Ga0495613_0064203
1158 Ga0495649_0010418
1159 Ga0495600_0008626
1160 Ga0495604_0002947
1161 Ga0495604_0014662
1162 Ga0495636_0003555
1163 Ga0495636_0017371
1164 Ga0495674_0035963
1165 Ga0495674_0072288
1166 Ga0495680_0016791
1167 Ga0495673_0026433
1168 Ga0495593_0047469
1169 Ga0495602_0016228
1170 Ga0496101_0052632
1171 Ga0496102_0005812
1172 Ga0496102_0158483
1173 Ga0496104_0114550
1174 Ga0496104_0176894
1175 Ga0496105_0003152
1176 Ga0496105_0006533
1177 Ga0496106_0024036
1178 Ga0496108_0002970
1179 Ga0496109_0008142
1180 Ga0496109_0066604
1181 Ga0496111_0253381
1182 Ga0496112_0043179
1183 Ga0496112_0091638
1184 Ga0496112_0107896
1185 Ga0496112_0181644
1186 Ga0496113_0174036
1187 Ga0496115_0000957
1188 Ga0496115_0006709
1189 Ga0496115_0054839
1190 Ga0496116_0034667
1191 Ga0496116_0036580
1192 Ga0496117_0023249
1193 Ga0496117_0055895
1194 Ga0496118_0003921
1195 Ga0496119_0011916
1196 Ga0496119_0084686
1197 Ga0496121_0001096
1198 Ga0496121_0005239
1199 Ga0496121_0019856
1200 Ga0496121_0036296
1201 Ga0496121_0043277
1202 Ga0496121_0086718
1203 Ga0496121_0116299
1204 Ga0496124_0005282
1205 Ga0496124_0100546
1206 Ga0496125_0000953
1207 Ga0496125_0018556
1208 Ga0496125_0043801
1209 Ga0496125_0097533
1210 Ga0496126_0017403
1211 Ga0496126_0021292
1212 Ga0496126_0030130
1213 Ga0496126_0035620
1214 Ga0496126_0126285
1215 Ga0501033_0013948
1216 Ga0501033_0113233
1217 Ga0501033_0184474
1218 Ga0501039_0032512
1219 Ga0501039_0089426
1220 Ga0501039_0184115
1221 Ga0501039_0234480
1222 Ga0501040_0024997
1223 Ga0501040_0074114
1224 Ga0501040_0114292
1225 Ga0501041_0046530
1226 Ga0501041_0100015
1227 Ga0501042_0140867
1228 Ga0501046_0114252
1229 Ga0501048_0032023
1230 Ga0501067_0055357
1231 Ga0501069_0060364
1232 Ga0501070_0004355
1233 Ga0501070_0142892
1234 Ga0501072_0036154
1235 Ga0501074_0026796
1236 Ga0501074_0046410
1237 Ga0501074_0058735
1238 Ga0501075_0022280
1239 Ga0501075_0061994
1240 Ga0501076_0010534
1241 Ga0501076_0035092
1242 Ga0501076_0112658
1243 Ga0501076_0136774
1244 Ga0501077_0020082
1245 Ga0501077_0032889
1246 Ga0501077_0126067
1247 Ga0501077_0131755
1248 Ga0501079_0024099
1249 Ga0501079_0035868
1250 Ga0501079_0037047
1251 Ga0501079_0098579
1252 Ga0501080_0003031
1253 Ga0501080_0041841
1254 Ga0501080_0053067
1255 Ga0501081_0007199
1256 Ga0501081_0032629
1257 Ga0501035_0057127
1258 Ga0501035_0083626
1259 Ga0501044_0027518
1260 Ga0501045_0041209
1261 nmdc:mga00v17_57479_c1
1262 nmdc:mga00v17_98601_c1
1263 nmdc:mga0yw44_10533_c2
1264 nmdc:mga0k408_3294_c1
1265 nmdc:mga0k408_62554_c1
1266 nmdc:mga06z11_12238_c1
1267 nmdc:mga06z11_24905_c1
1268 nmdc:mga06z11_33231_c1
1269 nmdc:mga05p37_36890_c1
1270 nmdc:mga06r32_230004_c1
1271 nmdc:mga0n895_15164_c1
1272 nmdc:mga0rr50_304197_c1
1273 nmdc:mga0rr50_955_c1
1274 nmdc:mga08x19_65037_c1
1275 nmdc:mga0a205_108790_c1
1276 nmdc:mga0a205_27317_c1
1277 nmdc:mga0sz30_19502_c1
1278 nmdc:mga0sz30_47689_c1
1279 Ga0495619_0005576
1280 Ga0500643_000073
1281 Ga0500647_0033544
1282 Ga0500583_0064839
1283 Ga0500566_0003586
1284 Ga0500566_0013445
1285 Ga0500566_0035900
1286 Ga0500641_0011089
1287 Ga0500557_000075
1288 Ga0500572_009649
1289 Ga0500595_001031
1290 Ga0500595_002021
1291 Ga0500595_015944
1292 Ga0500642_0000200
1293 Ga0500658_0018167
1294 Ga0500568_0005733
1295 Ga0500573_0070155
1296 Ga0500577_0057320
1297 Ga0500616_0025137
1298 Ga0500616_0035363
1299 Ga0500619_031043
1300 Ga0500622_0024541
1301 Ga0500634_0104267
1302 Ga0500638_029600
1303 Ga0500636_0002419
1304 Ga0500636_0131635
1305 Ga0500636_0163053
1306 Ga0500637_0000464
1307 Ga0500645_042003
1308 Ga0500601_001554
1309 Ga0501084_0012686
1310 Ga0500661_000204
1311 Ga0500661_016636
1312 Ga0501082_0018135
1313 Ga0501082_0059874
1314 Ga0501082_0128518
1315 Ga0501082_0149347
1316 Ga0530510_0022686
1317 Ga0530510_0126285
1318 2507509355
1319 2508543411
1320 2508698815
1321 2511123205
1322 2511396866
1323 2513646640
1324 2513656693
1325 2513718509
1326 2513858516
1327 2513876447
1328 2513895031
1329 2513917878
1330 2514010787
1331 2515628947
1332 2517102010
1333 2517893076
1334 2524436559
1335 2524536806
1336 2528851545
1337 2617352300
1338 2728753232
1339 2745081149
1340 2793064048
1341 2793070091
1342 2793077262
1343 2805919726
1344 2818240166
1345 2824656619
1346 2824667874
1347 2824678946
1348 2824695513
1349 2824701561
1350 2824710227
1351 2824758599
1352 2824768338
1353 2824779157
1354 2841947211
1355 2841950654
1356 2841966969
1357 2841975718
1358 2842039768
1359 2842047286
1360 2844318368
1361 2847945851
1362 2874597464
1363 2874609618
1364 2874612834
1365 2874636259
1366 2874648540
1367 2876770734
1368 2876777739
1369 2876822502
1370 2879078147
1371 2879102612
1372 2879134512
1373 2879149953
1374 2885381997
1375 2885416989
1376 2888383312
1377 2888394609
1378 2888423700
1379 2889040580
1380 2903729316
1381 2903755807
1382 2904696240
1383 2904717155
1384 2906606043
1385 2906617923
1386 2906640700
1387 2906661414
1388 2908743465
1389 2908760974
1390 2922373469
1391 2922429421
1392 2929617215
1393 2929626919
1394 2932796490
1395 2932803514
1396 2932813077
1397 2932821007
1398 2932835206
1399 2933579172
1400 2935611755
1401 2935621585
1402 2935645518
1403 2935651825
1404 2935660635
1405 2935667636
1406 2935681798
1407 2935688384
1408 2935695728
1409 2935706477
1410 2935715403
1411 2935726033
1412 2935734222
1413 2935743601
1414 2935754362
1415 2935768522
1416 2935774017
1417 2935780563
1418 2935789589
1419 2935797366
1420 2935806556
1421 2935813149
1422 2935821233
1423 2935830802
1424 2935840828
1425 2935850506
1426 2935859832
1427 2935869068
1428 2935880712
1429 2935886584
1430 2935914109
1431 2935921279
1432 2935931702
1433 2935940363
1434 2935947812
1435 2935956647
1436 2935960461
1437 2935973440
1438 2935980944
1439 2935989608
1440 2935999360
1441 2936006657
1442 2936014691
1443 2936023512
1444 2936032540
1445 2936043701
1446 2936050432
1447 2936059076
1448 2940560262
1449 2941534127
1450 2941541041
1451 3005479584
1452 3005598460
1453 3005714143
1454 3005721648
1455 8006941543
1456 8006981252
1457 8006988137
1458 8016514206
1459 8016535666
1460 8016539952
1461 8016553283
1462 8016574001
1463 8016578121
1464 8016599497
1465 8016611493
1466 8016631809
1467 8017062215
1468 8019535390
1469 8019544108
1470 8019554693
1471 8019567848
1472 8019581665
1473 8019589329
1474 8019601931
1475 8019616621
1476 8019635238
1477 8019644485
1478 8019663081
1479 8019672681
1480 8019683480
1481 8019689226
1482 8055747170
1483 8056690172
1484 8056972727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

82

178

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.8665 42 148
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.8489 42 149
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.8355 42 148
1vm9-assembly1.cif.gz_A the x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1 0.8281 42 146
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.8277 42 150
ID Description Score Start End Superfamily
3gobA01 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9147 39 154 2.102.10.10
af_Q6DHJ3_118_252_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9009 42 147 2.102.10.10
af_A0A1D6LW04_260_361_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.898 63 149 2.102.10.10
af_I1JZ61_209_331_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8919 38 158 2.102.10.10
af_Q17938_76_212_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8917 42 147 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A7Y9RLS4-F1-model_v4 Phenylpropionate dioxygenase-like ring-hydroxylating dioxygenase large terminal subunit 0.9955 130 396 GO:0051213
AF-A0A7Y9RLS4-F1-model_v4 Phenylpropionate dioxygenase-like ring-hydroxylating dioxygenase large terminal subunit 0.9918 130 396 GO:0051213
AF-L7VV98-F1-model_v4 Alpha-ketoglutarate-dependent taurine dioxygenase (EC 1.14.11.17) 0.9861 35 395 GO:0000908
GO:0005506
GO:0051537
AF-A0A3A1WE34-F1-model_v4 deleted 0.9824 1 396
AF-A0A3A1WE34-F1-model_v4 deleted 0.9799 1 396

Map