metagRoot

F478645

General Info

Members	Datasets	Scaffolds	Average Seq Length
742	516	501	338

Family's Representative Sequence

Representative Sequence	3300031731\|Ga0307405_10048293\|Ga0307405_100482932
Length	388
Sequence	VTARLGFLGVGWIGRHRMQAIQASGAAEVALIADASPDAAAQXXXLAPGARVVPSLQAMLDAGVDGVVLATPSALHAEQAVAALEQGAAVFCQKPLARTAAETRAVVDAARAADRLLAVDLSYRFTAGARAIRELIARGELGEVYAVDLVFHNAYGPDKAWFRDPALAGGGCVIDLGVHLVDLALWTLGFPRVAGATSRLFAQGAPLGGRRDVVEDYALARLDLEGGAAAQLACSWHLPAGCDAVIGAAFYGTGGGAALRNVNGSFYDFVAERYLGTRRETLTEGADEWGGRAAVEWARRLAAGERYDPEVERLVEVARALDLVYGRAEEVGVRRGVEPPPRLHDADHPHRRRHLIAAGVIKAGQEAVARERGAVVEASALPFRRSTS

Samples

	Sample ID	Description	Type	Environment
1	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
2	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
3	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
4	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
5	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
6	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
7	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
8	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
9	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
10	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
11	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
12	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
13	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
14	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
15	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
16	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
17	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
18	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
19	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
20	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
21	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
22	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
23	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
24	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
25	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
26	2599185359	Sphingomonas sp. NFR04	Isolate	Rhizoplane
27	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
28	2671180139	Chelativorans sp. A52C2	Isolate	Unclassified
29	2718217882	Rhizobium sp. N741	Isolate	Nodule
30	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
31	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
32	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
33	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
34	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
35	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
36	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
37	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
38	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
39	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
40	2818991466	Sphingomonas trueperi 1152a	Isolate	Unclassified
41	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
42	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
43	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
44	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
45	2855020534	Paracoccus endophyticus SYSUP0003	Isolate	Stem Tuber
46	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
47	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
48	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
49	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
50	2879163058	Sphingomonas pokkalii L3B27	Isolate	Rhizosphere
51	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
52	2882806704	Pelagerythrobacter rhizovicinus AY-3R	Isolate	Rhizosphere
53	2884298095	Microvirga thermotolerans HR1	Isolate	Rhizosphere
54	2885429604	Sphingomonas sp. WZY 27	Isolate	Rhizosphere
55	2899259804	Paracoccus aeridis JC501	Isolate	Rhizosphere
56	2910245624	Adhaeribacter radiodurans KUDC8001	Isolate	Rhizosphere
57	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
58	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
59	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
60	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
61	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
62	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
63	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
64	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
65	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
66	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
67	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
68	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
69	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
70	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
71	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
72	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
73	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
74	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
75	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
76	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
77	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
78	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
79	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
80	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
81	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
82	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
83	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
84	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
85	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
86	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
87	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
88	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
89	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
90	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
91	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
92	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
93	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
94	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
95	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
96	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
97	2928526807	Sphingomonas trueperi 1770	Isolate	Rhizosphere
98	2928968154	Sphingomonas trueperi 1075	Isolate	Unclassified
99	2929199973	Roseomonas sp. R-73070 Hybrid assembly	Isolate	Unclassified
100	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
101	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
102	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
103	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
104	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
105	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
106	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
107	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
108	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
109	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
110	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
111	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
112	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
113	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
114	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
115	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
116	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
117	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
118	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
119	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
120	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
121	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
122	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
123	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
124	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
125	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
126	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
127	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
128	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
129	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
130	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
131	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
132	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
133	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
134	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
135	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
136	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
137	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
138	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
139	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
140	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
141	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
142	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
143	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
144	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
145	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
146	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
147	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
148	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
149	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
150	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
151	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
152	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
153	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
154	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
155	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
156	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
157	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
158	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
159	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
160	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
161	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
162	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
163	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
164	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
165	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
166	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
167	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
168	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
169	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
170	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
171	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
172	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
173	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
174	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
175	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
176	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
177	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
178	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
179	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
180	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
181	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
182	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
183	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
184	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
185	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
186	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
187	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
188	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
189	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
190	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
191	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
192	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
193	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
194	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
195	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
196	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
197	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
198	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
199	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
200	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
201	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
202	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
203	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
204	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
205	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
206	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
207	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
208	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
209	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
210	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
211	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
212	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
213	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
214	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
215	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
216	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
217	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
218	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
219	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
220	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
221	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
222	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
223	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
224	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
225	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
226	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
227	2990265787	Sphingomonas sp. SORGH_AS802	Isolate	Aerial Root
228	2993693658	Sphingomonas sp. SORGH_AS438	Isolate	Aerial Root
229	3000405567	Rhodobacteraceae bacterium LNNU 3342	Isolate	Rhizosphere
230	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
231	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
232	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
233	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
234	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
235	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
236	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
237	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
238	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
239	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
240	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
241	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
242	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
243	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
244	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
245	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
246	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
247	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
248	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
249	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
250	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
251	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
252	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
253	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
254	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
255	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
256	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
257	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
258	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
259	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
260	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
261	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
262	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
263	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
264	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
265	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
266	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
267	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
268	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
269	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
270	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
271	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
272	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
273	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
274	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
275	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
276	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
277	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
278	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
279	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
280	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
281	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
282	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
283	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
284	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
285	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
286	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
287	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
288	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
289	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
290	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
291	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
292	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
293	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
294	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
295	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
296	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
297	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
298	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
299	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
300	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
301	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
302	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
303	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
304	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
305	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
306	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
307	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
308	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
309	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
310	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
311	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
312	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
313	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
314	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
315	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
317	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
318	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
319	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
320	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
356	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
358	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
361	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
362	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
363	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
364	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
365	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
366	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
367	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
368	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
369	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
370	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
371	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
372	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
373	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
374	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
375	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
376	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
377	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
378	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
379	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
380	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
381	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
382	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
383	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
384	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
385	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
386	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
387	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
388	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
389	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
390	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
391	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
392	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
393	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
394	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
395	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
396	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
397	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
398	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
399	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
400	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
401	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
402	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
403	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
404	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
405	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
406	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
407	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
408	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
409	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
410	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
411	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
412	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
413	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
414	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
415	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
416	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
417	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
418	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
419	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
420	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
421	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
422	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
423	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
424	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
425	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
426	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
427	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
428	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
429	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
430	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
431	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
432	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
433	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
434	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
435	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
436	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
437	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
438	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
439	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
440	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
441	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
442	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
443	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
444	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
445	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
446	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
447	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
448	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
449	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
450	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
451	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
452	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
453	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
454	3300049517	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control	Metagenome	Rhizosphere
455	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
456	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
457	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
458	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
459	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
460	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
461	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
462	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
463	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
464	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
465	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
466	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
467	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
468	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
469	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
470	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
471	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
472	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
473	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
474	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
475	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
476	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
477	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
478	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
479	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
480	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
481	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
482	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
483	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
484	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
485	3300049759	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought	Metagenome	Rhizosphere
486	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
487	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
488	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
489	3300049777	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control	Metagenome	Rhizosphere
490	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
491	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
492	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
493	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
494	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
495	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
496	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
497	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
498	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
499	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
500	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
501	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
502	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
503	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
504	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
505	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
506	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
507	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
508	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
509	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
510	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
511	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
512	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
513	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
514	8055909800	Plastoroseomonas hellenica LMG 31523	Isolate	Unclassified
515	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
516	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	66.98
Metatranscriptomes	0.4
Isolates	32.61

Biome Distribution

Category	Percentage (%)
Aerial Root	0.27
Bulb	0
Endosphere	2.02
Nodule	29.92
Rhizoplane	2.43
Rhizosphere	56.6
Stem	0
Stem Tuber	0.13
Unclassified	8.63

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24738J21930_10000568	3300002075	Bacteria	10562
2	rootH1_10043714	3300003316	Bacteria	1307
3	rootH1_10105465	3300003316	Bacteria	2283
4	rootH2_10009082	3300003320	Bacteria	1976
5	rootH2_10009599	3300003320	Bacteria	2898
6	rootH2_10026000	3300003320	Bacteria	22283
7	rootL2_10025621	3300003322	Bacteria	29729
8	rootL2_10135190	3300003322	Bacteria	2360
9	rootL2_10141224	3300003322	Bacteria	5246
10	rootH1_10000622	3300003316	Bacteria	6983
11	rootH1_10000622	3300003323	Bacteria	14716
12	rootH1_10096740	3300003323	Bacteria	6676
13	rootH1_10100249	3300003323	Bacteria	3416
14	Ga0055535_1000064	3300003761	Bacteria	116295
15	Ga0055542_1000029	3300003762	Bacteria	248836
16	Ga0055526_1005288	3300003771	Bacteria	7474
17	Ga0055528_1006721	3300003790	Bacteria	5181
18	Ga0058692_1012137	3300003856	Bacteria	2053
19	Ga0058861_10552529	3300004800	Bacteria	2751
20	Ga0058862_12468701	3300004803	Bacteria	6867
21	Ga0065712_10003968	3300005290	Bacteria	8902
22	Ga0065715_10001568	3300005293	Bacteria	9435
23	Ga0070658_10000001	3300005327	Bacteria	856789
24	Ga0070658_10068003	3300005327	Bacteria	2912
25	Ga0070658_10220232	3300005327	Bacteria	1605
26	Ga0070676_10075887	3300005328	Bacteria	2028
27	Ga0070690_100078580	3300005330	Bacteria	2156
28	Ga0070670_100005185	3300005331	Bacteria	10970
29	Ga0070670_100104614	3300005331	Bacteria	2438
30	Ga0070680_100000072	3300005336	Bacteria	53846
31	Ga0070680_100002366	3300005336	Bacteria	13931
32	Ga0068868_100063931	3300005338	Bacteria	2920
33	Ga0070660_100068919	3300005339	Bacteria	2758
34	Ga0070689_100069300	3300005340	Bacteria	2752
35	Ga0070687_100054196	3300005343	Bacteria	2088
36	Ga0070661_100012093	3300005344	Bacteria	6033
37	Ga0070661_100053762	3300005344	Bacteria	2948
38	Ga0070668_100002501	3300005347	Bacteria	13537
39	Ga0070669_100038087	3300005353	Bacteria	3490
40	Ga0070675_100008863	3300005354	Bacteria	7822
41	Ga0070671_100012945	3300005355	Bacteria	6721
42	Ga0070671_100043297	3300005355	Bacteria	3741
43	Ga0070673_100004217	3300005364	Bacteria	9071
44	Ga0070688_100039286	3300005365	Bacteria	2895
45	Ga0070667_100029205	3300005367	Bacteria	4593
46	Ga0070714_100350271	3300005435	Bacteria	1387
47	Ga0070705_100019881	3300005440	Bacteria	3541
48	Ga0070694_100005417	3300005444	Bacteria	7724
49	Ga0070663_100252241	3300005455	Unclassified	1397
50	Ga0070678_100036991	3300005456	Bacteria	3423
51	Ga0070662_100029360	3300005457	Bacteria	3838
52	Ga0070681_10001939	3300005458	Bacteria	18673
53	Ga0070681_10003106	3300005458	Bacteria	15432
54	Ga0070681_10055844	3300005458	Bacteria	3931
55	Ga0070685_10000415	3300005466	Bacteria	25229
56	Ga0070685_10003418	3300005466	Bacteria	8076
57	Ga0070679_100000193	3300005530	Bacteria	49569
58	Ga0070679_100036787	3300005530	Bacteria	4858
59	Ga0070679_100384373	3300005530	Bacteria	1350
60	Ga0068853_100008199	3300005539	Bacteria	8388
61	Ga0070686_100000092	3300005544	Bacteria	62767
62	Ga0070686_100001135	3300005544	Bacteria	15288
63	Ga0070665_100001031	3300005548	Bacteria	34955
64	Ga0070665_100052208	3300005548	Bacteria	4101
65	Ga0070665_100068263	3300005548	Bacteria	3565
66	Ga0070704_100021826	3300005549	Bacteria	4157
67	Ga0068855_100037557	3300005563	Bacteria	5759
68	Ga0068855_100085333	3300005563	Bacteria	3653
69	Ga0068857_100083414	3300005577	Bacteria	2855
70	Ga0068854_100206985	3300005578	Bacteria	1545
71	Ga0068856_100016719	3300005614	Bacteria	7106
72	Ga0068856_100156642	3300005614	Bacteria	2288
73	Ga0068852_100015547	3300005616	Bacteria	5908
74	Ga0068863_100030314	3300005841	Bacteria	5167
75	Ga0068858_100399258	3300005842	Bacteria	1321
76	Ga0068860_100016839	3300005843	Bacteria	7126
77	Ga0068862_100017182	3300005844	Bacteria	6020
78	Ga0070717_10025137	3300006028	Bacteria	4732
79	Ga0070717_10046794	3300006028	Bacteria	3541
80	Ga0075430_100061067	3300006846	Bacteria	3168
81	Ga0075431_100004901	3300006847	Bacteria	13179
82	Ga0075433_10011535	3300006852	Bacteria	7116
83	Ga0075433_10094680	3300006852	Bacteria	2643
84	Ga0075434_100002554	3300006871	Bacteria	16066
85	Ga0075429_100042452	3300006880	Bacteria	3958
86	Ga0079104_1000579	3300006946	Bacteria	36884
87	Ga0079104_1002880	3300006946	Bacteria	8594
88	Ga0079104_1019235	3300006946	Bacteria	1914
89	Ga0075435_100001246	3300007076	Bacteria	16277
90	Ga0105251_10000231	3300009011	Bacteria	56229
91	Ga0105240_10006104	3300009093	Bacteria	17778
92	Ga0114129_10067922	3300009147	Bacteria	4971
93	Ga0105238_10000013	3300009551	Bacteria	257248
94	Ga0105238_10003327	3300009551	Bacteria	16042
95	Ga0105238_10010605	3300009551	Bacteria	9252
96	Ga0105249_10010675	3300009553	Bacteria	8068
97	Ga0105239_10026650	3300010375	Bacteria	6362
98	Ga0105239_10028786	3300010375	Bacteria	6109
99	Ga0157371_10046810	3300013102	Bacteria	3075
100	Ga0157371_10093673	3300013102	Bacteria	2128
101	Ga0157370_10000377	3300013104	Bacteria	56059
102	Ga0157370_10026176	3300013104	Bacteria	5762
103	Ga0157369_10205360	3300013105	Bacteria	2066
104	Ga0157372_10003768	3300013307	Bacteria	16285
105	Ga0157372_10035987	3300013307	Bacteria	5453
106	Ga0157372_10218420	3300013307	Bacteria	2210
107	Ga0157375_10013056	3300013308	Bacteria	7381
108	Ga0182008_10022662	3300014497	Bacteria	3216
109	Ga0157376_10006836	3300014969	Bacteria	8078
110	Ga0183369_1012	3300015685	Bacteria	251554
111	Ga0163161_10205075	3300017792	Bacteria	1521
112	Ga0213873_10000001	3300021358	Bacteria	1657979
113	Ga0213873_10000008	3300021358	Bacteria	263363
114	Ga0213876_10000002	3300021384	Bacteria	1168769
115	Ga0213876_10000005	3300021384	Bacteria	727326
116	Ga0213876_10000690	3300021384	Bacteria	23786
117	Ga0213876_10034283	3300021384	Bacteria	2677
118	Ga0213876_10034887	3300021384	Bacteria	2653
119	Ga0213876_10084119	3300021384	Bacteria	1683
120	Ga0213876_10110085	3300021384	Unclassified	1462
121	Ga0224712_10000483	3300022467	Bacteria	7990
122	Ga0228711_1000005	3300022739	Bacteria	215594
123	Ga0228710_1000141	3300022740	Bacteria	66299
124	Ga0209672_100447	3300025228	Bacteria	23339
125	Ga0209258_100018	3300025242	Bacteria	567561
126	Ga0209148_1000030	3300025254	Bacteria	567582
127	Ga0207666_1000203	3300025271	Bacteria	8848
128	Ga0209673_1001180	3300025273	Bacteria	28315
129	Ga0209676_1001855	3300025292	Bacteria	17419
130	Ga0209564_1001136	3300025295	Bacteria	31269
131	Ga0209256_1001136	3300025299	Bacteria	30339
132	Ga0207697_10001245	3300025315	Bacteria	13958
133	Ga0207656_10011803	3300025321	Bacteria	3306
134	Ga0207713_1000951	3300025735	Bacteria	25905
135	Ga0207645_10113073	3300025907	Unclassified	1759
136	Ga0207705_10000002	3300025909	Bacteria	2046852
137	Ga0207705_10285711	3300025909	Bacteria	1263
138	Ga0207705_10293271	3300025909	Bacteria	1246
139	Ga0207707_10001382	3300025912	Bacteria	22527
140	Ga0207707_10005642	3300025912	Bacteria	10953
141	Ga0207707_10086070	3300025912	Bacteria	2747
142	Ga0207695_10100159	3300025913	Bacteria	2894
143	Ga0207695_10188004	3300025913	Bacteria	1984
144	Ga0207660_10019259	3300025917	Bacteria	4560
145	Ga0207660_10022569	3300025917	Bacteria	4241
146	Ga0207660_10077032	3300025917	Bacteria	2440
147	Ga0207662_10015051	3300025918	Bacteria	4346
148	Ga0207662_10029168	3300025918	Bacteria	3195
149	Ga0207657_10035381	3300025919	Bacteria	4479
150	Ga0207652_10003955	3300025921	Bacteria	12117
151	Ga0207681_10000774	3300025923	Bacteria	21043
152	Ga0207694_10000026	3300025924	Bacteria	257192
153	Ga0207694_10127192	3300025924	Bacteria	2040
154	Ga0207650_10086589	3300025925	Bacteria	2385
155	Ga0207659_10039946	3300025926	Bacteria	3277
156	Ga0207664_10338526	3300025929	Bacteria	1330
157	Ga0207644_10004138	3300025931	Bacteria	9406
158	Ga0207690_10292207	3300025932	Unclassified	1273
159	Ga0207706_10000659	3300025933	Bacteria	36314
160	Ga0207706_10000720	3300025933	Bacteria	34554
161	Ga0207706_10053015	3300025933	Bacteria	3581
162	Ga0207709_10300530	3300025935	Bacteria	1193
163	Ga0207711_10004956	3300025941	Bacteria	11299
164	Ga0207689_10286855	3300025942	Bacteria	1363
165	Ga0207661_10119263	3300025944	Bacteria	2244
166	Ga0207679_10063028	3300025945	Bacteria	2765
167	Ga0207667_10032723	3300025949	Bacteria	5598
168	Ga0207667_10057079	3300025949	Bacteria	4099
169	Ga0207667_10258107	3300025949	Bacteria	1782
170	Ga0207651_10010045	3300025960	Bacteria	5221
171	Ga0207668_10011006	3300025972	Bacteria	5486
172	Ga0207640_10021986	3300025981	Bacteria	3810
173	Ga0207658_10013008	3300025986	Bacteria	5683
174	Ga0207639_10009218	3300026041	Bacteria	6803
175	Ga0207702_10158397	3300026078	Bacteria	2066
176	Ga0207641_10022649	3300026088	Bacteria	5171
177	Ga0207674_10006773	3300026116	Bacteria	13445
178	Ga0207683_10066006	3300026121	Bacteria	3190
179	Ga0207698_10105171	3300026142	Bacteria	2351
180	Ga0209281_1000111	3300027111	Bacteria	215615
181	Ga0209281_1000185	3300027111	Bacteria	144489
182	Ga0209281_1000514	3300027111	Bacteria	50622
183	Ga0209281_1019097	3300027111	Bacteria	1358
184	Ga0209371_1012832	3300027312	Bacteria	2396
185	Ga0209371_1013630	3300027312	Bacteria	2269
186	Ga0209282_1000012	3300027666	Bacteria	215614
187	Ga0268265_10029154	3300028380	Bacteria	3959
188	Ga0268264_10006624	3300028381	Bacteria	9743
189	Ga0307515_10131752	3300028794	Bacteria	2748
190	Ga0268256_1014046	3300030500	Bacteria	2396
191	Ga0268256_1015091	3300030500	Bacteria	2269
192	Ga0316177_1065906	3300030731	Bacteria	2510
193	Ga0314311_1092240	3300030733	Bacteria	7298
194	Ga0316178_1148343	3300030735	Bacteria	2117
195	Ga0316180_1190628	3300030736	Bacteria	2309
196	Ga0316181_1005884	3300030744	Bacteria	2880
197	Ga0307408_100000134	3300031548	Bacteria	82703
198	Ga0307408_100019009	3300031548	Bacteria	4622
199	Ga0307408_100036845	3300031548	Bacteria	3441
200	Ga0307408_100040491	3300031548	Bacteria	3299
201	Ga0307408_100073902	3300031548	Bacteria	2528
202	Ga0307408_100158235	3300031548	Bacteria	1796
203	Ga0307408_100198698	3300031548	Bacteria	1621
204	Ga0307408_100263825	3300031548	Bacteria	1427
205	Ga0316576_10077115	3300031727	Bacteria	2467
206	Ga0316578_10000808	3300031728	Bacteria	11611
207	Ga0307405_10000157	3300031731	Bacteria	26000
208	Ga0307405_10016667	3300031731	Bacteria	4012
209	Ga0307405_10048293	3300031731	Bacteria	2624
210	Ga0307405_10052742	3300031731	Bacteria	2530
211	Ga0307405_10142168	3300031731	Bacteria	1675
212	Ga0307405_10226911	3300031731	Bacteria	1374
213	Ga0307413_10001452	3300031824	Bacteria	9001
214	Ga0307413_10003349	3300031824	Bacteria	6732
215	Ga0307413_10004795	3300031824	Bacteria	5941
216	Ga0307413_10014422	3300031824	Bacteria	4013
217	Ga0307413_10020389	3300031824	Bacteria	3525
218	Ga0307413_10028501	3300031824	Bacteria	3111
219	Ga0307413_10043134	3300031824	Bacteria	2656
220	Ga0307413_10059828	3300031824	Bacteria	2342
221	Ga0307413_10106797	3300031824	Bacteria	1864
222	Ga0307413_10115651	3300031824	Bacteria	1805
223	Ga0307410_10000647	3300031852	Bacteria	14363
224	Ga0307410_10001278	3300031852	Bacteria	11192
225	Ga0307410_10003242	3300031852	Bacteria	8123
226	Ga0307410_10326497	3300031852	Bacteria	1219
227	Ga0307406_10019508	3300031901	Bacteria	3980
228	Ga0307406_10034776	3300031901	Bacteria	3094
229	Ga0307406_10044395	3300031901	Bacteria	2785
230	Ga0307406_10068553	3300031901	Bacteria	2316
231	Ga0307407_10004503	3300031903	Bacteria	5928
232	Ga0307407_10004745	3300031903	Bacteria	5813
233	Ga0307407_10005841	3300031903	Bacteria	5391
234	Ga0307407_10022988	3300031903	Bacteria	3246
235	Ga0307412_10000337	3300031911	Bacteria	29485
236	Ga0307412_10051999	3300031911	Bacteria	2711
237	Ga0307412_10065028	3300031911	Bacteria	2466
238	Ga0307412_10077202	3300031911	Bacteria	2290
239	Ga0307412_10112132	3300031911	Bacteria	1949
240	Ga0307412_10123041	3300031911	Bacteria	1871
241	Ga0307412_10293141	3300031911	Bacteria	1282
242	Ga0307412_10388736	3300031911	Bacteria	1132
243	Ga0315914_1000007	3300031967	Bacteria	215597
244	Ga0307409_100000202	3300031995	Bacteria	23457
245	Ga0307409_100000682	3300031995	Bacteria	15070
246	Ga0307409_100003868	3300031995	Bacteria	8274
247	Ga0307409_100022482	3300031995	Bacteria	4349
248	Ga0307409_100034749	3300031995	Bacteria	3686
249	Ga0307409_100055486	3300031995	Bacteria	3059
250	Ga0307409_100059251	3300031995	Bacteria	2979
251	Ga0307409_100071234	3300031995	Bacteria	2763
252	Ga0307409_100071736	3300031995	Bacteria	2755
253	Ga0307409_100106519	3300031995	Bacteria	2340
254	Ga0307409_100271056	3300031995	Bacteria	1563
255	Ga0307416_100000247	3300032002	Bacteria	28731
256	Ga0307416_100005664	3300032002	Bacteria	7716
257	Ga0307416_100007550	3300032002	Bacteria	6929
258	Ga0307416_100008103	3300032002	Bacteria	6744
259	Ga0307416_100008482	3300032002	Bacteria	6636
260	Ga0307416_100021822	3300032002	Bacteria	4607
261	Ga0307416_100033855	3300032002	Bacteria	3880
262	Ga0307416_100044235	3300032002	Bacteria	3494
263	Ga0307416_100048950	3300032002	Bacteria	3357
264	Ga0307416_100121869	3300032002	Bacteria	2326
265	Ga0307416_100123300	3300032002	Bacteria	2315
266	Ga0307416_100145332	3300032002	Bacteria	2164
267	Ga0307416_100345956	3300032002	Bacteria	1502
268	Ga0307414_10000469	3300032004	Bacteria	21145
269	Ga0307414_10025568	3300032004	Bacteria	3785
270	Ga0307414_10045498	3300032004	Bacteria	3006
271	Ga0307414_10046204	3300032004	Bacteria	2987
272	Ga0307414_10143780	3300032004	Bacteria	1871
273	Ga0307414_10164168	3300032004	Bacteria	1768
274	Ga0307414_10184602	3300032004	Bacteria	1681
275	Ga0307411_10001263	3300032005	Bacteria	10113
276	Ga0307411_10006654	3300032005	Bacteria	5804
277	Ga0307411_10010072	3300032005	Bacteria	5017
278	Ga0307411_10029189	3300032005	Bacteria	3364
279	Ga0307411_10059223	3300032005	Bacteria	2538
280	Ga0307411_10125904	3300032005	Bacteria	1863
281	Ga0307411_10154437	3300032005	Bacteria	1710
282	Ga0307411_10364171	3300032005	Bacteria	1183
283	Ga0307411_10365358	3300032005	Bacteria	1182
284	Ga0307415_100002082	3300032126	Bacteria	9892
285	Ga0307415_100015814	3300032126	Bacteria	4480
286	Ga0307415_100031141	3300032126	Bacteria	3432
287	Ga0307415_100033340	3300032126	Bacteria	3343
288	Ga0307415_100089006	3300032126	Bacteria	2229
289	Ga0307415_100443081	3300032126	Unclassified	1121
290	Ga0316580_10011167	3300032139	Bacteria	2722
291	Ga0315913_1000003	3300033430	Bacteria	215608
292	Ga0315915_1000011	3300033464	Bacteria	215597
293	Ga0316584_0205803	3300036712	Bacteria	1450
294	Ga0395900_0065444	3300037418	Bacteria	3734
295	Ga0395898_0009011	3300037466	Bacteria	10504
296	Ga0395898_0018099	3300037466	Bacteria	7189
297	Ga0395905_0000010	3300037471	Bacteria	460729
298	Ga0395905_0001224	3300037471	Bacteria	31977
299	Ga0395905_0010280	3300037471	Bacteria	9111
300	Ga0395905_0025858	3300037471	Bacteria	5532
301	Ga0395905_0083175	3300037471	Bacteria	2999
302	Ga0436364_0249413	3300037853	Bacteria	1581
303	Ga0436364_0295246	3300037853	Bacteria	2414
304	Ga0436364_1248857	3300037853	Bacteria	3560
305	Ga0436364_1303587	3300037853	Bacteria	9494
306	Ga0395901_0000022	3300038443	Bacteria	296356
307	Ga0395901_0032006	3300038443	Bacteria	5427
308	Ga0395901_0088842	3300038443	Bacteria	3233
309	Ga0436365_0011005	3300039437	Bacteria	74317
310	Ga0436365_0190860	3300039437	Bacteria	42582
311	Ga0436365_0476201	3300039437	Bacteria	3826
312	Ga0436365_0837226	3300039437	Bacteria	1892
313	Ga0436365_0997845	3300039437	Bacteria	12342
314	Ga0436365_1097713	3300039437	Bacteria	23010
315	Ga0436365_1104251	3300039437	Bacteria	95104
316	Ga0436365_1124121	3300039437	Bacteria	24917
317	Ga0436365_1637190	3300039437	Bacteria	4386
318	Ga0436365_1812210	3300039437	Bacteria	5858
319	Ga0436362_0287059	3300039453	Bacteria	76995
320	Ga0436362_0413357	3300039453	Bacteria	1176
321	Ga0436362_0649416	3300039453	Bacteria	210038
322	Ga0436362_1001937	3300039453	Bacteria	1884
323	Ga0436362_1117829	3300039453	Bacteria	3746
324	Ga0436362_1176359	3300039453	Bacteria	8104
325	Ga0439439_0021186	3300041406	Bacteria	1619
326	Ga0451835_0374708	3300041492	Bacteria	2663
327	Ga0451849_0859234	3300041505	Bacteria	5471
328	Ga0451853_0136591	3300041512	Bacteria	27091
329	Ga0451853_2502581	3300041512	Bacteria	1188
330	Ga0451853_3966006	3300041512	Bacteria	1357
331	Ga0439449_0031880	3300042007	Bacteria	1964
332	Ga0439452_015593	3300042010	Bacteria	2080
333	Ga0439457_004674	3300042014	Bacteria	3541
334	Ga0439462_0011136	3300042015	Bacteria	2286
335	Ga0450923_005070	3300042125	Bacteria	2108
336	Ga0450896_000130	3300042133	Bacteria	5660
337	Ga0439434_0014229	3300042435	Bacteria	2367
338	Ga0439464_0018489	3300042439	Bacteria	1897
339	Ga0466969_0004319	3300044656	Bacteria	7562
340	Ga0466972_0003845	3300044658	Bacteria	7473
341	Ga0466973_0039606	3300044659	Bacteria	4454
342	Ga0466965_0012733	3300044683	Bacteria	3961
343	Ga0466966_0007556	3300044684	Bacteria	7201
344	Ga0466966_0022883	3300044684	Bacteria	4094
345	Ga0466966_0041160	3300044684	Bacteria	2970
346	Ga0466961_0002574	3300044693	Bacteria	11241
347	Ga0466961_0014011	3300044693	Bacteria	5140
348	Ga0466961_0130092	3300044693	Bacteria	1578
349	Ga0466963_0054438	3300044694	Bacteria	2659
350	Ga0466963_0163417	3300044694	Unclassified	1550
351	Ga0466964_0001414	3300044706	Bacteria	8189
352	Ga0453684_0001215	3300044712	Bacteria	79022
353	Ga0453684_0022850	3300044712	Bacteria	9256
354	Ga0453684_0030131	3300044712	Bacteria	7675
355	Ga0453684_0051415	3300044712	Bacteria	5402
356	Ga0453684_0340187	3300044712	Bacteria	1694
357	Ga0466971_0036179	3300044719	Bacteria	2214
358	Ga0466971_0123164	3300044719	Bacteria	1201
359	Ga0466968_0037269	3300044735	Bacteria	2039
360	Ga0466970_0000165	3300044765	Bacteria	31613
361	Ga0466970_0008836	3300044765	Bacteria	5077
362	Ga0466957_0001879	3300044842	Bacteria	11111
363	Ga0466957_0021562	3300044842	Bacteria	3798
364	Ga0466957_0046277	3300044842	Bacteria	2641
365	Ga0466957_0122506	3300044842	Bacteria	1659
366	Ga0466960_0041756	3300044901	Bacteria	2174
367	Ga0466959_0002727	3300045049	Bacteria	11359
368	Ga0466959_0007854	3300045049	Bacteria	7507
369	Ga0466959_0046458	3300045049	Bacteria	3195
370	Ga0466959_0050613	3300045049	Bacteria	3050
371	Ga0466959_0086972	3300045049	Bacteria	2248
372	Ga0451576_0370646	3300045051	Bacteria	1500
373	Ga0451576_0499056	3300045051	Bacteria	1278
374	Ga0466958_0037088	3300045836	Bacteria	2920
375	Ga0466958_0105433	3300045836	Bacteria	1756
376	Ga0466958_0109238	3300045836	Bacteria	1726
377	Ga0466958_0224857	3300045836	Bacteria	1198
378	Ga0466967_0067740	3300045976	Bacteria	3185
379	Ga0466967_0218176	3300045976	Bacteria	1812
380	Ga0495580_0002004	3300046472	Bacteria	17926
381	Ga0495607_0090167	3300046501	Bacteria	1663
382	Ga0495606_0014934	3300046507	Bacteria	6024
383	Ga0495610_0000741	3300046512	Bacteria	30987
384	Ga0495620_0001937	3300046515	Bacteria	12117
385	Ga0495632_0019430	3300046519	Bacteria	3702
386	Ga0495625_0012365	3300046660	Bacteria	6918
387	Ga0495636_0052574	3300047318	Bacteria	1709
388	Ga0495673_0000800	3300047469	Bacteria	29553
389	Ga0495686_0000145	3300047472	Bacteria	141946
390	Ga0495686_0000660	3300047472	Bacteria	46840
391	Ga0495686_0011196	3300047472	Bacteria	6328
392	Ga0496100_0013416	3300048903	Bacteria	4726
393	Ga0496102_0028166	3300048905	Bacteria	5018
394	Ga0496104_0001425	3300048907	Bacteria	20697
395	Ga0496105_0108278	3300048908	Bacteria	2294
396	Ga0496106_0002220	3300048909	Bacteria	14486
397	Ga0496107_0001107	3300048910	Bacteria	16221
398	Ga0496108_0009896	3300048911	Bacteria	7727
399	Ga0496108_0041328	3300048911	Bacteria	3849
400	Ga0496109_0069651	3300048912	Bacteria	3227
401	Ga0496110_0026507	3300048913	Bacteria	4961
402	Ga0496110_0113759	3300048913	Bacteria	2434
403	Ga0496111_0046598	3300048914	Bacteria	3121
404	Ga0496111_0068700	3300048914	Bacteria	2575
405	Ga0496112_0005741	3300048915	Bacteria	10786
406	Ga0496113_0030337	3300048916	Bacteria	3914
407	Ga0496113_0108581	3300048916	Bacteria	2157
408	Ga0496114_0023353	3300048917	Bacteria	5046
409	Ga0496118_0060006	3300048921	Bacteria	2828
410	Ga0496121_0003144	3300048924	Bacteria	23828
411	Ga0496122_0044054	3300048925	Bacteria	3488
412	Ga0496123_0085147	3300048926	Bacteria	1903
413	Ga0496123_0137422	3300048926	Bacteria	1342
414	Ga0496124_0000631	3300048927	Bacteria	58432
415	Ga0496124_0105281	3300048927	Bacteria	2279
416	Ga0496125_0047142	3300048928	Bacteria	3607
417	Ga0496126_0246773	3300048929	Bacteria	1489
418	Ga0501292_000046	3300049515	Bacteria	25946
419	Ga0501294_000113	3300049517	Bacteria	9100
420	Ga0501300_000089	3300049523	Bacteria	13092
421	Ga0501033_0011758	3300049570	Bacteria	6692
422	Ga0501038_0019003	3300049574	Bacteria	6201
423	Ga0501038_0030175	3300049574	Bacteria	4800
424	Ga0501039_0012902	3300049575	Bacteria	6389
425	Ga0501040_0013568	3300049576	Bacteria	5357
426	Ga0501042_0020385	3300049578	Bacteria	4614
427	Ga0501043_0023769	3300049579	Bacteria	4807
428	Ga0501043_0292922	3300049579	Bacteria	1245
429	Ga0501046_0097895	3300049580	Bacteria	2253
430	Ga0501046_0101511	3300049580	Unclassified	2206
431	Ga0501047_0070531	3300049581	Bacteria	3364
432	Ga0501047_0129484	3300049581	Bacteria	2404
433	Ga0501048_0020368	3300049582	Bacteria	4860
434	Ga0501048_0038457	3300049582	Bacteria	3433
435	Ga0501067_0004583	3300049583	Bacteria	7645
436	Ga0501067_0141768	3300049583	Bacteria	1338
437	Ga0501068_0000027	3300049584	Bacteria	54774
438	Ga0501068_0041263	3300049584	Bacteria	2772
439	Ga0501069_0119265	3300049585	Bacteria	1506
440	Ga0501070_0020475	3300049586	Bacteria	5547
441	Ga0501070_0067842	3300049586	Bacteria	2954
442	Ga0501070_0121626	3300049586	Bacteria	2157
443	Ga0501071_0012189	3300049587	Bacteria	5819
444	Ga0501071_0292388	3300049587	Bacteria	1234
445	Ga0501072_0000005	3300049588	Bacteria	263381
446	Ga0501074_0007411	3300049590	Bacteria	7938
447	Ga0501074_0165573	3300049590	Bacteria	1578
448	Ga0501075_0039004	3300049591	Bacteria	3553
449	Ga0501076_0009916	3300049592	Bacteria	7042
450	Ga0501076_0093200	3300049592	Unclassified	2423
451	Ga0501076_0652543	3300049592	Bacteria	868
452	Ga0501077_0002282	3300049593	Bacteria	11551
453	Ga0501206_000042	3300049653	Bacteria	11484
454	Ga0501222_001878	3300049662	Bacteria	2916
455	Ga0501223_002369	3300049663	Bacteria	4204
456	Ga0501235_000332	3300049669	Bacteria	8999
457	Ga0501257_003280	3300049686	Bacteria	3460
458	Ga0501257_025006	3300049686	Bacteria	1420
459	Ga0501261_000044	3300049690	Bacteria	25231
460	Ga0501225_0001373	3300049705	Bacteria	7592
461	Ga0501080_0012204	3300049742	Bacteria	7873
462	Ga0501080_0032984	3300049742	Bacteria	4831
463	Ga0501080_0076113	3300049742	Bacteria	3121
464	Ga0501080_0228286	3300049742	Bacteria	1702
465	Ga0501081_0019528	3300049743	Bacteria	4512
466	Ga0501083_0010857	3300049744	Bacteria	6406
467	Ga0501083_0015591	3300049744	Bacteria	5321
468	Ga0501083_0019357	3300049744	Bacteria	4743
469	Ga0501262_000034	3300049759	Bacteria	17713
470	Ga0501273_001426	3300049770	Bacteria	2269
471	Ga0501279_000046	3300049775	Bacteria	25767
472	Ga0501280_000310	3300049776	Bacteria	12295
473	Ga0501281_00076	3300049777	Bacteria	11473
474	Ga0501282_000171	3300049778	Bacteria	7894
475	Ga0501283_000710	3300049779	Bacteria	4389
476	Ga0501035_0000330	3300049822	Bacteria	55037
477	Ga0501035_0021485	3300049822	Bacteria	5933
478	Ga0501035_0047354	3300049822	Bacteria	3860
479	Ga0501035_0060130	3300049822	Bacteria	3383
480	Ga0501035_0066798	3300049822	Bacteria	3191
481	Ga0501035_0079822	3300049822	Bacteria	2890
482	Ga0501035_0182392	3300049822	Bacteria	1808
483	Ga0501044_0051242	3300049823	Bacteria	4256
484	Ga0501044_0086334	3300049823	Bacteria	3170
485	Ga0501044_0098734	3300049823	Bacteria	2939
486	Ga0501045_0091918	3300049824	Unclassified	2243
487	nmdc:mga0qj67_53971_c1	3300050509	Bacteria	3182
488	nmdc:mga0n895_14432_c1	3300050512	Bacteria	7175
489	nmdc:mga0n895_617275_c1	3300050512	Bacteria	1085
490	nmdc:mga0rr50_3927_c1	3300050513	Bacteria	8645
491	nmdc:mga0a205_4764_c1	3300050515	Bacteria	12190
492	Ga0500556_0000207	3300053104	Bacteria	48431
493	Ga0500556_0001296	3300053104	Bacteria	11269
494	Ga0500573_0011874	3300053140	Bacteria	4882
495	Ga0500616_0001172	3300053153	Bacteria	26685
496	Ga0501084_0000013	3300054114	Bacteria	172423
497	Ga0501084_0044239	3300054114	Bacteria	3727
498	Ga0501082_0000093	3300060353	Bacteria	68617
499	Ga0501082_0219927	3300060353	Bacteria	1652
500	Ga0466962_0105750	3300061719	Bacteria	1353
501	Ga0530510_0112423	3300061734	Unclassified	1995

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049592	Ga0501076_0652543	Ga0501076_0652543_24_857	275
2	3300049824	Ga0501045_0091918	Ga0501045_0091918_18_881	280
3	3300021358	Ga0213873_10000008	Ga0213873_1000000814	286
4	3300021384	Ga0213876_10000005	Ga0213876_10000005590	286
5	3300039437	Ga0436365_0011005	Ga0436365_0011005_5799_6788	286
6	3300039453	Ga0436362_0287059	Ga0436362_0287059_5799_6788	286
7	3300039437	Ga0436365_0190860	Ga0436365_0190860_13109_13993	292
8	3300039453	Ga0436362_0649416	Ga0436362_0649416_170014_170898	292
9	3300049770	Ga0501273_001426	Ga0501273_001426_53_1063	292
10	3300031548	Ga0307408_100040491	Ga0307408_1000404913	304
11	3300031824	Ga0307413_10004795	Ga0307413_100047954	304
12	3300031903	Ga0307407_10004503	Ga0307407_100045033	304
13	3300031995	Ga0307409_100000202	Ga0307409_10000020211	304
14	3300032002	Ga0307416_100048950	Ga0307416_1000489502	304
15	3300032004	Ga0307414_10025568	Ga0307414_100255683	304
16	3300031824	Ga0307413_10014422	Ga0307413_100144221	305
17	3300031852	Ga0307410_10000647	Ga0307410_100006474	305
18	3300031901	Ga0307406_10068553	Ga0307406_100685532	305
19	3300031903	Ga0307407_10005841	Ga0307407_100058413	305
20	3300031911	Ga0307412_10112132	Ga0307412_101121321	305
21	3300031995	Ga0307409_100003868	Ga0307409_1000038684	305
22	3300032002	Ga0307416_100007550	Ga0307416_1000075504	305
23	3300037471	Ga0395905_0000010	Ga0395905_0000010_316711_317745	305
24	3300032004	Ga0307414_10143780	Ga0307414_101437802	306
25	3300005440	Ga0070705_100019881	Ga0070705_1000198812	308
26	3300005444	Ga0070694_100005417	Ga0070694_1000054175	308
27	3300005544	Ga0070686_100001135	Ga0070686_1000011359	308
28	3300005549	Ga0070704_100021826	Ga0070704_1000218265	308
29	3300009553	Ga0105249_10010675	Ga0105249_100106754	308
30	3300032004	Ga0307414_10045498	Ga0307414_100454982	308
31	3300044712	Ga0453684_0022850	Ga0453684_0022850_99_1124	308
32	3300044712	Ga0453684_0051415	Ga0453684_0051415_4321_5334	308
33	3300005336	Ga0070680_100000072	Ga0070680_10000007222	310
34	3300025949	Ga0207667_10057079	Ga0207667_100570793	310
35	3300046501	Ga0495607_0090167	Ga0495607_0090167_451_1446	310
36	3300046515	Ga0495620_0001937	Ga0495620_0001937_5993_6964	310
37	3300031548	Ga0307408_100263825	Ga0307408_1002638251	311
38	3300031731	Ga0307405_10052742	Ga0307405_100527422	311
39	3300031901	Ga0307406_10019508	Ga0307406_100195083	311
40	3300037853	Ga0436364_1303587	Ga0436364_1303587_2982_3920	311
41	3300039437	Ga0436365_1812210	Ga0436365_1812210_524_1462	311
42	3300039453	Ga0436362_1001937	Ga0436362_1001937_885_1823	311
43	3300041512	Ga0451853_2502581	Ga0451853_2502581_142_1080	311
44	3300039437	Ga0436365_0997845	Ga0436365_0997845_9502_10446	312
45	3300039453	Ga0436362_0413357	Ga0436362_0413357_106_1050	312
46	3300044693	Ga0466961_0002574	Ga0466961_0002574_1082_2125	312
47	3300045836	Ga0466958_0109238	Ga0466958_0109238_67_1011	312
48	3300031901	Ga0307406_10044395	Ga0307406_100443952	314
49	3300031995	Ga0307409_100071736	Ga0307409_1000717363	314
50	3300045976	Ga0466967_0067740	Ga0466967_0067740_967_1983	314
51	3300053140	Ga0500573_0011874	Ga0500573_0011874_3688_4743	314
52	3300044712	Ga0453684_0001215	Ga0453684_0001215_48555_49601	315
53	3300021358	Ga0213873_10000001	Ga0213873_100000011459	316
54	3300021384	Ga0213876_10000002	Ga0213876_1000000280	316
55	3300042435	Ga0439434_0014229	Ga0439434_0014229_550_1533	317
56	3300045051	Ga0451576_0370646	Ga0451576_0370646_40_1071	317
57	3300049570	Ga0501033_0011758	Ga0501033_0011758_4138_5202	317
58	3300049580	Ga0501046_0101511	Ga0501046_0101511_633_1697	317
59	3300049584	Ga0501068_0041263	Ga0501068_0041263_188_1252	317
60	3300049591	Ga0501075_0039004	Ga0501075_0039004_2179_3243	317
61	3300049822	Ga0501035_0021485	Ga0501035_0021485_327_1391	317
62	3300050509	nmdc:mga0qj67_53971_c1	nmdc:mga0qj67_53971_c1_1898_2881	317
63	3300005466	Ga0070685_10000415	Ga0070685_1000041511	318
64	3300044712	Ga0453684_0030131	Ga0453684_0030131_5815_6837	319
65	3300049574	Ga0501038_0019003	Ga0501038_0019003_3455_4519	320
66	3300049575	Ga0501039_0012902	Ga0501039_0012902_761_1825	320
67	3300049576	Ga0501040_0013568	Ga0501040_0013568_4205_5269	320
68	3300049578	Ga0501042_0020385	Ga0501042_0020385_3328_4392	320
69	3300049579	Ga0501043_0023769	Ga0501043_0023769_3227_4291	320
70	3300049582	Ga0501048_0020368	Ga0501048_0020368_2179_3243	320
71	3300049587	Ga0501071_0012189	Ga0501071_0012189_1728_2792	320
72	3300049590	Ga0501074_0007411	Ga0501074_0007411_4696_5760	320
73	3300049592	Ga0501076_0093200	Ga0501076_0093200_761_1825	320
74	3300049742	Ga0501080_0012204	Ga0501080_0012204_2828_3892	320
75	3300049743	Ga0501081_0019528	Ga0501081_0019528_3383_4447	320
76	3300049744	Ga0501083_0015591	Ga0501083_0015591_2771_3835	320
77	3300054114	Ga0501084_0044239	Ga0501084_0044239_1749_2813	320
78	3300061734	Ga0530510_0112423	Ga0530510_0112423_299_1363	320
79	iso_pu_bacteria	2599185359	2600225166	320
80	iso_pu_bacteria	2818991466	2819713448	320
81	iso_pu_bacteria	2928526807	2928530307	320
82	iso_pu_bacteria	2928968154	2928971860	320
83	3300031995	Ga0307409_100055486	Ga0307409_1000554863	321
84	3300039437	Ga0436365_0837226	Ga0436365_0837226_19_1002	321
85	3300041512	Ga0451853_3966006	Ga0451853_3966006_150_1118	321
86	3300045976	Ga0466967_0218176	Ga0466967_0218176_31_1017	321
87	iso_pu_bacteria	2882806704	2882806981	321
88	iso_pu_bacteria	2885429604	2885430323	321
89	iso_pu_bacteria	2879163058	2879164751	322
90	3300003316	rootH1_10043714	rootH1_100437141	323
91	3300025909	Ga0207705_10293271	Ga0207705_102932712	323
92	3300038443	Ga0395901_0032006	Ga0395901_0032006_56_1027	323
93	3300042007	Ga0439449_0031880	Ga0439449_0031880_196_1167	323
94	3300005577	Ga0068857_100083414	Ga0068857_1000834141	324
95	3300025292	Ga0209676_1001855	Ga0209676_100185513	324
96	3300027312	Ga0209371_1012832	Ga0209371_10128322	324
97	3300030500	Ga0268256_1014046	Ga0268256_10140462	324
98	3300031911	Ga0307412_10065028	Ga0307412_100650283	324
99	3300044693	Ga0466961_0130092	Ga0466961_0130092_394_1377	324
100	3300045049	Ga0466959_0046458	Ga0466959_0046458_430_1407	324
101	3300045836	Ga0466958_0037088	Ga0466958_0037088_1520_2497	324
102	3300048925	Ga0496122_0044054	Ga0496122_0044054_929_1903	324
103	3300048926	Ga0496123_0137422	Ga0496123_0137422_328_1302	324
104	3300048927	Ga0496124_0000631	Ga0496124_0000631_47487_48461	324
105	3300005841	Ga0068863_100030314	Ga0068863_1000303141	325
106	3300026088	Ga0207641_10022649	Ga0207641_100226496	325
107	3300031731	Ga0307405_10142168	Ga0307405_101421682	325
108	3300031911	Ga0307412_10077202	Ga0307412_100772022	325
109	3300031911	Ga0307412_10293141	Ga0307412_102931412	325
110	3300048921	Ga0496118_0060006	Ga0496118_0060006_264_1256	325
111	iso_pu_bacteria	2855020534	2855020709	325
112	3300003316	rootH1_10105465	rootH1_101054651	326
113	3300017792	Ga0163161_10205075	Ga0163161_102050752	326
114	3300025924	Ga0207694_10000026	Ga0207694_10000026188	326
115	3300031548	Ga0307408_100019009	Ga0307408_1000190092	326
116	3300031548	Ga0307408_100073902	Ga0307408_1000739022	326
117	3300031731	Ga0307405_10226911	Ga0307405_102269112	326
118	3300031824	Ga0307413_10028501	Ga0307413_100285012	326
119	3300031824	Ga0307413_10059828	Ga0307413_100598282	326
120	3300031852	Ga0307410_10003242	Ga0307410_100032426	326
121	3300031903	Ga0307407_10004745	Ga0307407_100047452	326
122	3300031911	Ga0307412_10123041	Ga0307412_101230412	326
123	3300031995	Ga0307409_100034749	Ga0307409_1000347492	326
124	3300032002	Ga0307416_100008103	Ga0307416_1000081032	326
125	3300032002	Ga0307416_100008482	Ga0307416_1000084826	326
126	3300032004	Ga0307414_10184602	Ga0307414_101846021	326
127	3300032005	Ga0307411_10010072	Ga0307411_100100725	326
128	3300032005	Ga0307411_10364171	Ga0307411_103641711	326
129	3300032126	Ga0307415_100031141	Ga0307415_1000311414	326
130	3300047472	Ga0495686_0000660	Ga0495686_0000660_3703_4731	326
131	3300049580	Ga0501046_0097895	Ga0501046_0097895_262_1260	326
132	iso_pu_bacteria	2990265787	2990267452	326
133	iso_pu_bacteria	2993693658	2993695312	326
134	3300037471	Ga0395905_0083175	Ga0395905_0083175_1183_2208	327
135	3300044656	Ga0466969_0004319	Ga0466969_0004319_3601_4584	327
136	3300044684	Ga0466966_0022883	Ga0466966_0022883_2071_3054	327
137	3300045049	Ga0466959_0007854	Ga0466959_0007854_680_1663	327
138	3300049515	Ga0501292_000046	Ga0501292_000046_4648_5631	327
139	3300049517	Ga0501294_000113	Ga0501294_000113_4400_5383	327
140	3300049523	Ga0501300_000089	Ga0501300_000089_8162_9145	327
141	3300049587	Ga0501071_0292388	Ga0501071_0292388_143_1201	327
142	3300049653	Ga0501206_000042	Ga0501206_000042_937_1920	327
143	3300049662	Ga0501222_001878	Ga0501222_001878_139_1122	327
144	3300049663	Ga0501223_002369	Ga0501223_002369_664_1647	327
145	3300049669	Ga0501235_000332	Ga0501235_000332_7014_7997	327
146	3300049686	Ga0501257_003280	Ga0501257_003280_679_1662	327
147	3300049690	Ga0501261_000044	Ga0501261_000044_4354_5337	327
148	3300049705	Ga0501225_0001373	Ga0501225_0001373_2178_3161	327
149	3300049775	Ga0501279_000046	Ga0501279_000046_4413_5396	327
150	3300049776	Ga0501280_000310	Ga0501280_000310_7054_8037	327
151	3300049777	Ga0501281_00076	Ga0501281_00076_6124_7107	327
152	3300049778	Ga0501282_000171	Ga0501282_000171_2209_3192	327
153	3300049779	Ga0501283_000710	Ga0501283_000710_1053_2036	327
154	3300005327	Ga0070658_10000001	Ga0070658_10000001129	328
155	3300021384	Ga0213876_10000690	Ga0213876_1000069020	328
156	3300025909	Ga0207705_10000002	Ga0207705_100000021750	328
157	3300025935	Ga0207709_10300530	Ga0207709_103005302	328
158	3300032002	Ga0307416_100021822	Ga0307416_1000218223	328
159	3300032002	Ga0307416_100123300	Ga0307416_1001233002	328
160	3300032005	Ga0307411_10154437	Ga0307411_101544372	328
161	3300032126	Ga0307415_100002082	Ga0307415_1000020829	328
162	3300039437	Ga0436365_1104251	Ga0436365_1104251_68076_69062	328
163	3300044712	Ga0453684_0340187	Ga0453684_0340187_486_1475	328
164	3300044735	Ga0466968_0037269	Ga0466968_0037269_148_1164	328
165	3300045051	Ga0451576_0499056	Ga0451576_0499056_72_1076	328
166	3300046507	Ga0495606_0014934	Ga0495606_0014934_3679_4668	328
167	3300046512	Ga0495610_0000741	Ga0495610_0000741_12006_12995	328
168	3300046519	Ga0495632_0019430	Ga0495632_0019430_2674_3663	328
169	3300046660	Ga0495625_0012365	Ga0495625_0012365_3459_4448	328
170	3300047469	Ga0495673_0000800	Ga0495673_0000800_15405_16394	328
171	3300047472	Ga0495686_0011196	Ga0495686_0011196_2840_3829	328
172	3300049586	Ga0501070_0020475	Ga0501070_0020475_380_1387	328
173	3300049586	Ga0501070_0121626	Ga0501070_0121626_792_1799	328
174	3300060353	Ga0501082_0219927	Ga0501082_0219927_546_1553	328
175	iso_pu_bacteria	2929199973	2929206165	328
176	iso_pu_bacteria	8055909800	8055912677	328
177	3300003322	rootL2_10135190	rootL2_101351902	329
178	3300005435	Ga0070714_100350271	Ga0070714_1003502712	329
179	3300021384	Ga0213876_10110085	Ga0213876_101100852	329
180	3300025929	Ga0207664_10338526	Ga0207664_103385261	329
181	3300031731	Ga0307405_10016667	Ga0307405_100166671	329
182	3300031824	Ga0307413_10115651	Ga0307413_101156512	329
183	3300031995	Ga0307409_100022482	Ga0307409_1000224822	329
184	3300032002	Ga0307416_100044235	Ga0307416_1000442352	329
185	3300032002	Ga0307416_100121869	Ga0307416_1001218692	329
186	3300032005	Ga0307411_10006654	Ga0307411_100066544	329
187	3300037471	Ga0395905_0010280	Ga0395905_0010280_5401_6390	329
188	3300038443	Ga0395901_0088842	Ga0395901_0088842_2019_3008	329
189	3300041492	Ga0451835_0374708	Ga0451835_0374708_1383_2429	329
190	3300041505	Ga0451849_0859234	Ga0451849_0859234_3482_4528	329
191	3300041512	Ga0451853_0136591	Ga0451853_0136591_4584_5630	329
192	3300044658	Ga0466972_0003845	Ga0466972_0003845_2164_3153	329
193	3300044659	Ga0466973_0039606	Ga0466973_0039606_2203_3225	329
194	3300044683	Ga0466965_0012733	Ga0466965_0012733_2427_3416	329
195	3300044693	Ga0466961_0014011	Ga0466961_0014011_372_1361	329
196	3300044706	Ga0466964_0001414	Ga0466964_0001414_2751_3740	329
197	3300044765	Ga0466970_0008836	Ga0466970_0008836_2588_3577	329
198	3300044901	Ga0466960_0041756	Ga0466960_0041756_697_1686	329
199	3300045049	Ga0466959_0002727	Ga0466959_0002727_5269_6258	329
200	3300045836	Ga0466958_0105433	Ga0466958_0105433_226_1224	329
201	3300045836	Ga0466958_0224857	Ga0466958_0224857_103_1092	329
202	3300047472	Ga0495686_0000145	Ga0495686_0000145_30692_31681	329
203	3300021384	Ga0213876_10034887	Ga0213876_100348872	330
204	3300021384	Ga0213876_10084119	Ga0213876_100841192	330
205	3300031731	Ga0307405_10048293	Ga0307405_100482932	330
206	3300039437	Ga0436365_1124121	Ga0436365_1124121_10606_11607	330
207	3300039453	Ga0436362_1117829	Ga0436362_1117829_139_1140	330
208	3300039453	Ga0436362_1176359	Ga0436362_1176359_1479_2537	330
209	3300044684	Ga0466966_0041160	Ga0466966_0041160_88_1092	330
210	3300044694	Ga0466963_0163417	Ga0466963_0163417_308_1312	330
211	iso_pu_bacteria	2671180139	2671693811	330
212	3300003320	rootH2_10009599	rootH2_100095994	331
213	3300006028	Ga0070717_10046794	Ga0070717_100467943	331
214	3300025942	Ga0207689_10286855	Ga0207689_102868552	331
215	3300028794	Ga0307515_10131752	Ga0307515_101317522	331
216	3300049583	Ga0501067_0141768	Ga0501067_0141768_37_1059	331
217	3300049585	Ga0501069_0119265	Ga0501069_0119265_316_1338	331
218	3300049744	Ga0501083_0019357	Ga0501083_0019357_617_1636	331
219	iso_pu_bacteria	2842694124	2842697424	331
220	3300005614	Ga0068856_100016719	Ga0068856_1000167194	332
221	3300039437	Ga0436365_1097713	Ga0436365_1097713_1322_2353	332
222	3300053104	Ga0500556_0001296	Ga0500556_0001296_8812_9840	332
223	iso_pu_bacteria	3000405567	3000407282	332
224	3300005331	Ga0070670_100104614	Ga0070670_1001046141	333
225	3300025925	Ga0207650_10086589	Ga0207650_100865892	333
226	3300030735	Ga0316178_1148343	Ga0316178_11483431	333
227	3300030736	Ga0316180_1190628	Ga0316180_11906283	333
228	3300049822	Ga0501035_0047354	Ga0501035_0047354_2445_3449	333
229	3300049823	Ga0501044_0051242	Ga0501044_0051242_893_1897	333
230	iso_pu_bacteria	2510065057	2510303127	333
231	iso_pu_bacteria	2511231052	2511497125	333
232	iso_pu_bacteria	2512047086	2512529597	333
233	iso_pu_bacteria	2512875026	2512968845	333
234	iso_pu_bacteria	2513237086	2513582704	333
235	iso_pu_bacteria	2513237089	2513606454	333
236	iso_pu_bacteria	2513237091	2513614758	333
237	iso_pu_bacteria	2513237140	2513882274	333
238	iso_pu_bacteria	2513237143	2513901789	333
239	iso_pu_bacteria	2513237156	2513986743	333
240	iso_pu_bacteria	2513237160	2514006104	333
241	iso_pu_bacteria	2515154107	2515611719	333
242	iso_pu_bacteria	2517487022	2517566403	333
243	iso_pu_bacteria	2524023207	2524449377	333
244	iso_pu_bacteria	2551306084	2551678884	333
245	iso_pu_bacteria	2551306084	2551682122	333
246	iso_pu_bacteria	2551306085	2551683436	333
247	iso_pu_bacteria	2551306089	2551712413	333
248	iso_pu_bacteria	2551306092	2551737213	333
249	iso_pu_bacteria	2551306093	2551743185	333
250	iso_pu_bacteria	2791355091	2792622822	333
251	iso_pu_bacteria	2791355092	2792629073	333
252	iso_pu_bacteria	2802428858	2802719691	333
253	iso_pu_bacteria	2802428859	2802728311	333
254	iso_pu_bacteria	2802428860	2802733521	333
255	iso_pu_bacteria	2802428861	2802738751	333
256	iso_pu_bacteria	2802428862	2802745649	333
257	iso_pu_bacteria	2802428863	2802751414	333
258	iso_pu_bacteria	2899259804	2899261498	333
259	iso_pu_bacteria	2960631154	2960631471	333
260	3300005327	Ga0070658_10220232	Ga0070658_102202322	334
261	3300005614	Ga0068856_100156642	Ga0068856_1001566422	334
262	3300006846	Ga0075430_100061067	Ga0075430_1000610673	334
263	3300006946	Ga0079104_1002880	Ga0079104_10028806	334
264	3300006946	Ga0079104_1019235	Ga0079104_10192351	334
265	3300022739	Ga0228711_1000005	Ga0228711_1000005170	334
266	3300022740	Ga0228710_1000141	Ga0228710_100014130	334
267	3300025909	Ga0207705_10285711	Ga0207705_102857112	334
268	3300026078	Ga0207702_10158397	Ga0207702_101583972	334
269	3300027111	Ga0209281_1000111	Ga0209281_1000111170	334
270	3300027111	Ga0209281_1000185	Ga0209281_100018580	334
271	3300027666	Ga0209282_1000012	Ga0209282_1000012170	334
272	3300031548	Ga0307408_100198698	Ga0307408_1001986982	334
273	3300031852	Ga0307410_10326497	Ga0307410_103264972	334
274	3300031911	Ga0307412_10388736	Ga0307412_103887361	334
275	3300031967	Ga0315914_1000007	Ga0315914_100000744	334
276	3300033430	Ga0315913_1000003	Ga0315913_1000003170	334
277	3300033464	Ga0315915_1000011	Ga0315915_100001144	334
278	3300037418	Ga0395900_0065444	Ga0395900_0065444_1257_2264	334
279	3300037466	Ga0395898_0009011	Ga0395898_0009011_1819_2826	334
280	3300037853	Ga0436364_0295246	Ga0436364_0295246_477_1481	334
281	3300042125	Ga0450923_005070	Ga0450923_005070_1069_2076	334
282	3300042133	Ga0450896_000130	Ga0450896_000130_1004_2011	334
283	3300042439	Ga0439464_0018489	Ga0439464_0018489_31_1038	334
284	3300044842	Ga0466957_0046277	Ga0466957_0046277_1223_2230	334
285	3300044842	Ga0466957_0122506	Ga0466957_0122506_158_1165	334
286	3300048903	Ga0496100_0013416	Ga0496100_0013416_1178_2188	334
287	3300048905	Ga0496102_0028166	Ga0496102_0028166_3127_4137	334
288	3300048907	Ga0496104_0001425	Ga0496104_0001425_7698_8708	334
289	3300048908	Ga0496105_0108278	Ga0496105_0108278_599_1609	334
290	3300048909	Ga0496106_0002220	Ga0496106_0002220_11661_12671	334
291	3300048910	Ga0496107_0001107	Ga0496107_0001107_77_1087	334
292	3300048911	Ga0496108_0009896	Ga0496108_0009896_510_1520	334
293	3300048911	Ga0496108_0041328	Ga0496108_0041328_613_1623	334
294	3300048912	Ga0496109_0069651	Ga0496109_0069651_854_1864	334
295	3300048913	Ga0496110_0026507	Ga0496110_0026507_472_1482	334
296	3300048913	Ga0496110_0113759	Ga0496110_0113759_454_1464	334
297	3300048914	Ga0496111_0046598	Ga0496111_0046598_901_1911	334
298	3300048914	Ga0496111_0068700	Ga0496111_0068700_1056_2066	334
299	3300048915	Ga0496112_0005741	Ga0496112_0005741_593_1603	334
300	3300048916	Ga0496113_0030337	Ga0496113_0030337_1908_2918	334
301	3300048916	Ga0496113_0108581	Ga0496113_0108581_242_1252	334
302	3300048917	Ga0496114_0023353	Ga0496114_0023353_3068_4078	334
303	3300050512	nmdc:mga0n895_617275_c1	nmdc:mga0n895_617275_c1_52_1062	334
304	iso_pu_bacteria	2516653046	2516895645	334
305	iso_pu_bacteria	2551306086	2551690651	334
306	iso_pu_bacteria	2551306087	2551701587	334
307	iso_pu_bacteria	2551306090	2551718846	334
308	iso_pu_bacteria	2551306091	2551724322	334
309	iso_pu_bacteria	2791355094	2792640635	334
310	iso_pu_bacteria	2818991448	2819610838	334
311	iso_pu_bacteria	2838074704	2838075948	334
312	iso_pu_bacteria	2855825444	2855829539	334
313	iso_pu_bacteria	2855839649	2855844638	334
314	iso_pu_bacteria	2857531043	2857537210	334
315	iso_pu_bacteria	2858800743	2858805901	334
316	iso_pu_bacteria	2910245624	2910248544	334
317	iso_pu_bacteria	2915980308	2915982101	334
318	iso_pu_bacteria	2915986958	2915988342	334
319	iso_pu_bacteria	2915993759	2916000513	334
320	iso_pu_bacteria	2916000859	2916003429	334
321	iso_pu_bacteria	2916007675	2916007746	334
322	iso_pu_bacteria	2916014648	2916016004	334
323	iso_pu_bacteria	2916021584	2916021848	334
324	iso_pu_bacteria	2916028427	2916030954	334
325	iso_pu_bacteria	2916035215	2916037345	334
326	iso_pu_bacteria	2916041962	2916042199	334
327	iso_pu_bacteria	2916048683	2916048971	334
328	iso_pu_bacteria	2916055098	2916057227	334
329	iso_pu_bacteria	2916061851	2916066137	334
330	iso_pu_bacteria	2916068649	2916068650	334
331	iso_pu_bacteria	2916076590	2916079097	334
332	iso_pu_bacteria	2920760137	2920760584	334
333	iso_pu_bacteria	2921201388	2921202286	334
334	iso_pu_bacteria	2921208531	2921213840	334
335	iso_pu_bacteria	2921237296	2921242130	334
336	iso_pu_bacteria	2921244191	2921246307	334
337	iso_pu_bacteria	2921250672	2921256739	334
338	iso_pu_bacteria	2921257292	2921259273	334
339	iso_pu_bacteria	2921263974	2921269796	334
340	iso_pu_bacteria	2921282425	2921286705	334
341	iso_pu_bacteria	2921289301	2921292365	334
342	iso_pu_bacteria	2921296804	2921300580	334
343	iso_pu_bacteria	2924144063	2924147962	334
344	iso_pu_bacteria	2924150972	2924152847	334
345	iso_pu_bacteria	2924158325	2924161888	334
346	iso_pu_bacteria	2924165586	2924165724	334
347	iso_pu_bacteria	2924172951	2924175681	334
348	iso_pu_bacteria	2924179722	2924184255	334
349	iso_pu_bacteria	2924186466	2924186682	334
350	iso_pu_bacteria	2924193448	2924197930	334
351	iso_pu_bacteria	2924200457	2924200717	334
352	iso_pu_bacteria	2924207177	2924207340	334
353	iso_pu_bacteria	2924214083	2924214136	334
354	iso_pu_bacteria	2924221636	2924222489	334
355	iso_pu_bacteria	2924228884	2924229057	334
356	iso_pu_bacteria	2936996657	2936997128	334
357	iso_pu_bacteria	2937002841	2937003181	334
358	iso_pu_bacteria	2937009748	2937010029	334
359	iso_pu_bacteria	2937016420	2937020467	334
360	iso_pu_bacteria	2937023124	2937025349	334
361	iso_pu_bacteria	2937029754	2937034135	334
362	iso_pu_bacteria	2937036028	2937040259	334
363	iso_pu_bacteria	2937042894	2937045273	334
364	iso_pu_bacteria	2937049772	2937054393	334
365	iso_pu_bacteria	2937056579	2937060355	334
366	iso_pu_bacteria	2937063883	2937064107	334
367	iso_pu_bacteria	2937071275	2937071842	334
368	iso_pu_bacteria	2937078374	2937084616	334
369	iso_pu_bacteria	2937084907	2937087918	334
370	iso_pu_bacteria	2937091812	2937096295	334
371	iso_pu_bacteria	2937098957	2937100961	334
372	iso_pu_bacteria	2937106411	2937109852	334
373	iso_pu_bacteria	2937113482	2937115611	334
374	iso_pu_bacteria	2937119839	2937119909	334
375	iso_pu_bacteria	2937126314	2937132491	334
376	iso_pu_bacteria	2957375807	2957381136	334
377	iso_pu_bacteria	2957382221	2957382456	334
378	iso_pu_bacteria	2957388812	2957391670	334
379	iso_pu_bacteria	2957395598	2957400128	334
380	iso_pu_bacteria	2957402308	2957404098	334
381	iso_pu_bacteria	2957408893	2957411484	334
382	iso_pu_bacteria	2957415311	2957416399	334
383	iso_pu_bacteria	2957422303	2957429580	334
384	iso_pu_bacteria	2957430029	2957432772	334
385	iso_pu_bacteria	2957437181	2957440733	334
386	iso_pu_bacteria	2957443900	2957445824	334
387	iso_pu_bacteria	2957450854	2957450927	334
388	iso_pu_bacteria	2957457609	2957460252	334
389	iso_pu_bacteria	2957464669	2957465393	334
390	iso_pu_bacteria	2957471148	2957474408	334
391	iso_pu_bacteria	2957478035	2957478829	334
392	iso_pu_bacteria	2957484790	2957485323	334
393	iso_pu_bacteria	2957491536	2957493370	334
394	iso_pu_bacteria	2957498199	2957498539	334
395	iso_pu_bacteria	2957505466	2957508891	334
396	iso_pu_bacteria	2960584000	2960588033	334
397	iso_pu_bacteria	2960591022	2960597028	334
398	iso_pu_bacteria	2960597568	2960600099	334
399	iso_pu_bacteria	2960603979	2960607319	334
400	iso_pu_bacteria	2960610863	2960611130	334
401	iso_pu_bacteria	2960617483	2960622489	334
402	iso_pu_bacteria	2960624210	2960625200	334
403	iso_pu_bacteria	2960637947	2960644280	334
404	iso_pu_bacteria	2960645483	2960647319	334
405	iso_pu_bacteria	2960652885	2960657803	334
406	iso_pu_bacteria	2960660292	2960663876	334
407	iso_pu_bacteria	2960667422	2960667688	334
408	iso_pu_bacteria	2960674078	2960679204	334
409	iso_pu_bacteria	2960680706	2960682232	334
410	iso_pu_bacteria	2960687367	2960691861	334
411	iso_pu_bacteria	2960693952	2960699233	334
412	iso_pu_bacteria	2964607997	2964615043	334
413	iso_pu_bacteria	2964615318	2964620197	334
414	iso_pu_bacteria	2964621998	2964626707	334
415	iso_pu_bacteria	2964628898	2964629140	334
416	iso_pu_bacteria	2964636051	2964636251	334
417	iso_pu_bacteria	2964643177	2964643247	334
418	iso_pu_bacteria	2964649959	2964652507	334
419	iso_pu_bacteria	2964656573	2964662105	334
420	iso_pu_bacteria	2964663802	2964663874	334
421	iso_pu_bacteria	2964670856	2964677733	334
422	iso_pu_bacteria	2964678106	2964678220	334
423	iso_pu_bacteria	2964685014	2964685199	334
424	iso_pu_bacteria	2964691889	2964694198	334
425	iso_pu_bacteria	2964698721	2964699041	334
426	iso_pu_bacteria	2964705432	2964710849	334
427	iso_pu_bacteria	2964712639	2964716629	334
428	iso_pu_bacteria	2967664464	2967671149	334
429	iso_pu_bacteria	2967671571	2967671642	334
430	iso_pu_bacteria	2967678726	2967685583	334
431	iso_pu_bacteria	2967686174	2967689538	334
432	iso_pu_bacteria	2967693043	2967695625	334
433	iso_pu_bacteria	2967706974	2967708126	334
434	iso_pu_bacteria	2967714385	2967717487	334
435	iso_pu_bacteria	2967721400	2967721538	334
436	iso_pu_bacteria	2967728569	2967730309	334
437	iso_pu_bacteria	2967735183	2967737278	334
438	iso_pu_bacteria	2967742019	2967748794	334
439	iso_pu_bacteria	2967748971	2967749043	334
440	iso_pu_bacteria	2967755722	2967755793	334
441	iso_pu_bacteria	2967762386	2967764642	334
442	iso_pu_bacteria	2967769361	2967769581	334
443	iso_pu_bacteria	2967775926	2967781739	334
444	iso_pu_bacteria	2970019648	2970025942	334
445	iso_pu_bacteria	2970026789	2970028944	334
446	iso_pu_bacteria	2970033650	2970033722	334
447	iso_pu_bacteria	2970040964	2970043391	334
448	iso_pu_bacteria	2970047711	2970050119	334
449	iso_pu_bacteria	2970054988	2970057700	334
450	iso_pu_bacteria	2970061556	2970062838	334
451	iso_pu_bacteria	2970068827	2970068898	334
452	iso_pu_bacteria	2970076120	2970078145	334
453	iso_pu_bacteria	2970082768	2970084330	334
454	iso_pu_bacteria	2970088815	2970092034	334
455	iso_pu_bacteria	2970095765	2970095837	334
456	iso_pu_bacteria	2970102677	2970102748	334
457	iso_pu_bacteria	2970109326	2970111210	334
458	iso_pu_bacteria	2970116247	2970117655	334
459	iso_pu_bacteria	2970122695	2970125702	334
460	iso_pu_bacteria	2970129317	2970132124	334
461	iso_pu_bacteria	2970136068	2970136187	334
462	iso_pu_bacteria	2970143518	2970149433	334
463	iso_pu_bacteria	2970149975	2970151998	334
464	iso_pu_bacteria	2970156795	2970160017	334
465	iso_pu_bacteria	2970164137	2970168983	334
466	iso_pu_bacteria	2970170962	2970171034	334
467	iso_pu_bacteria	2970177841	2970183781	334
468	iso_pu_bacteria	2970184632	2970189531	334
469	iso_pu_bacteria	2970191845	2970191988	334
470	iso_pu_bacteria	2977516862	2977518389	334
471	iso_pu_bacteria	2977523885	2977526400	334
472	iso_pu_bacteria	2977530762	2977535592	334
473	iso_pu_bacteria	2977537788	2977539702	334
474	iso_pu_bacteria	2977544691	2977548926	334
475	iso_pu_bacteria	2977551784	2977556022	334
476	iso_pu_bacteria	2977558990	2977560548	334
477	iso_pu_bacteria	2977565890	2977566214	334
478	iso_pu_bacteria	2977572785	2977575394	334
479	iso_pu_bacteria	2977579622	2977582400	334
480	iso_pu_bacteria	3005409236	3005416554	334
481	iso_pu_bacteria	648276728	648735649	334
482	iso_pu_bacteria	8003992118	8003997163	334
483	iso_pu_bacteria	8003999396	8004004874	334
484	iso_pu_bacteria	8005645114	8005651485	334
485	iso_pu_bacteria	8056673599	8056676636	334
486	3300003323	rootH1_10100249	rootH1_101002493	335
487	3300003761	Ga0055535_1000064	Ga0055535_100006444	335
488	3300003762	Ga0055542_1000029	Ga0055542_1000029110	335
489	3300005458	Ga0070681_10003106	Ga0070681_1000310613	335
490	3300005530	Ga0070679_100036787	Ga0070679_1000367872	335
491	3300006028	Ga0070717_10025137	Ga0070717_100251372	335
492	3300009093	Ga0105240_10006104	Ga0105240_100061044	335
493	3300009551	Ga0105238_10003327	Ga0105238_100033277	335
494	3300013105	Ga0157369_10205360	Ga0157369_102053602	335
495	3300022467	Ga0224712_10000483	Ga0224712_100004836	335
496	3300025912	Ga0207707_10001382	Ga0207707_100013825	335
497	3300025917	Ga0207660_10077032	Ga0207660_100770322	335
498	3300025924	Ga0207694_10127192	Ga0207694_101271922	335
499	3300025949	Ga0207667_10032723	Ga0207667_100327234	335
500	3300031911	Ga0307412_10051999	Ga0307412_100519992	335
501	3300037471	Ga0395905_0001224	Ga0395905_0001224_17405_18430	335
502	3300049582	Ga0501048_0038457	Ga0501048_0038457_1124_2149	335
503	3300049822	Ga0501035_0000330	Ga0501035_0000330_18966_19982	335
504	iso_pu_bacteria	2615840624	2616294512	335
505	iso_pu_bacteria	2718217882	2719184565	335
506	iso_pu_bacteria	8005688590	8005693332	335
507	iso_pu_bacteria	8018127388	8018129086	335
508	iso_pu_bacteria	8056875544	8056877713	335
509	3300003320	rootH2_10026000	rootH2_100260003	336
510	3300003322	rootL2_10025621	rootL2_1002562110	336
511	3300003323	rootH1_10096740	rootH1_100967403	336
512	3300005331	Ga0070670_100005185	Ga0070670_1000051857	336
513	3300005347	Ga0070668_100002501	Ga0070668_10000250110	336
514	3300005353	Ga0070669_100038087	Ga0070669_1000380872	336
515	3300005355	Ga0070671_100043297	Ga0070671_1000432972	336
516	3300005367	Ga0070667_100029205	Ga0070667_1000292053	336
517	3300005548	Ga0070665_100001031	Ga0070665_10000103125	336
518	3300005842	Ga0068858_100399258	Ga0068858_1003992581	336
519	3300005843	Ga0068860_100016839	Ga0068860_1000168392	336
520	3300005844	Ga0068862_100017182	Ga0068862_1000171825	336
521	3300009011	Ga0105251_10000231	Ga0105251_1000023128	336
522	3300009551	Ga0105238_10000013	Ga0105238_1000001357	336
523	3300013102	Ga0157371_10093673	Ga0157371_100936732	336
524	3300013307	Ga0157372_10218420	Ga0157372_102184202	336
525	3300015685	Ga0183369_1012	Ga0183369_101230	336
526	3300025228	Ga0209672_100447	Ga0209672_10044715	336
527	3300025242	Ga0209258_100018	Ga0209258_100018286	336
528	3300025254	Ga0209148_1000030	Ga0209148_1000030286	336
529	3300025735	Ga0207713_1000951	Ga0207713_100095122	336
530	3300025923	Ga0207681_10000774	Ga0207681_100007742	336
531	3300025931	Ga0207644_10004138	Ga0207644_100041384	336
532	3300025941	Ga0207711_10004956	Ga0207711_100049564	336
533	3300025972	Ga0207668_10011006	Ga0207668_100110063	336
534	3300025986	Ga0207658_10013008	Ga0207658_100130084	336
535	3300028380	Ga0268265_10029154	Ga0268265_100291542	336
536	3300028381	Ga0268264_10006624	Ga0268264_100066247	336
537	3300031824	Ga0307413_10020389	Ga0307413_100203893	336
538	3300031995	Ga0307409_100071234	Ga0307409_1000712342	336
539	3300032002	Ga0307416_100145332	Ga0307416_1001453322	336
540	3300032002	Ga0307416_100345956	Ga0307416_1003459562	336
541	3300032004	Ga0307414_10046204	Ga0307414_100462042	336
542	3300032126	Ga0307415_100033340	Ga0307415_1000333402	336
543	3300032126	Ga0307415_100089006	Ga0307415_1000890062	336
544	3300047318	Ga0495636_0052574	Ga0495636_0052574_478_1497	336
545	3300048924	Ga0496121_0003144	Ga0496121_0003144_7744_8766	336
546	3300048926	Ga0496123_0085147	Ga0496123_0085147_648_1670	336
547	3300048927	Ga0496124_0105281	Ga0496124_0105281_1071_2093	336
548	3300048928	Ga0496125_0047142	Ga0496125_0047142_543_1565	336
549	3300048929	Ga0496126_0246773	Ga0496126_0246773_134_1156	336
550	3300049822	Ga0501035_0060130	Ga0501035_0060130_1160_2179	336
551	3300049822	Ga0501035_0079822	Ga0501035_0079822_877_1896	336
552	iso_pu_bacteria	2534681796	2535517976	336
553	iso_pu_bacteria	8005289223	8005292292	336
554	iso_pu_bacteria	8005542996	8005548846	336
555	3300003320	rootH2_10009082	rootH2_100090823	337
556	3300003771	Ga0055526_1005288	Ga0055526_10052882	337
557	3300003790	Ga0055528_1006721	Ga0055528_10067213	337
558	3300005343	Ga0070687_100054196	Ga0070687_1000541962	337
559	3300005457	Ga0070662_100029360	Ga0070662_1000293602	337
560	3300005548	Ga0070665_100068263	Ga0070665_1000682634	337
561	3300025273	Ga0209673_1001180	Ga0209673_100118010	337
562	3300025295	Ga0209564_1001136	Ga0209564_100113615	337
563	3300025299	Ga0209256_1001136	Ga0209256_100113616	337
564	3300025918	Ga0207662_10015051	Ga0207662_100150512	337
565	3300025918	Ga0207662_10029168	Ga0207662_100291682	337
566	3300025933	Ga0207706_10000659	Ga0207706_1000065935	337
567	3300032002	Ga0307416_100033855	Ga0307416_1000338555	337
568	3300032126	Ga0307415_100443081	Ga0307415_1004430812	337
569	3300037853	Ga0436364_0249413	Ga0436364_0249413_30_1055	337
570	3300037853	Ga0436364_1248857	Ga0436364_1248857_2320_3348	337
571	3300039437	Ga0436365_1637190	Ga0436365_1637190_2026_3051	337
572	3300046472	Ga0495580_0002004	Ga0495580_0002004_11395_12432	337
573	3300049574	Ga0501038_0030175	Ga0501038_0030175_1427_2458	337
574	3300049579	Ga0501043_0292922	Ga0501043_0292922_22_1053	337
575	3300049581	Ga0501047_0070531	Ga0501047_0070531_137_1168	337
576	3300049583	Ga0501067_0004583	Ga0501067_0004583_1229_2260	337
577	3300049584	Ga0501068_0000027	Ga0501068_0000027_28645_29676	337
578	3300049586	Ga0501070_0067842	Ga0501070_0067842_14_1045	337
579	3300049588	Ga0501072_0000005	Ga0501072_0000005_64126_65157	337
580	3300049590	Ga0501074_0165573	Ga0501074_0165573_76_1113	337
581	3300049592	Ga0501076_0009916	Ga0501076_0009916_305_1336	337
582	3300049593	Ga0501077_0002282	Ga0501077_0002282_10454_11485	337
583	3300049742	Ga0501080_0032984	Ga0501080_0032984_1017_2048	337
584	3300049742	Ga0501080_0076113	Ga0501080_0076113_1198_2235	337
585	3300049742	Ga0501080_0228286	Ga0501080_0228286_598_1635	337
586	3300049744	Ga0501083_0010857	Ga0501083_0010857_421_1452	337
587	3300049822	Ga0501035_0066798	Ga0501035_0066798_1542_2579	337
588	3300049822	Ga0501035_0182392	Ga0501035_0182392_686_1714	337
589	3300049823	Ga0501044_0086334	Ga0501044_0086334_667_1704	337
590	3300049823	Ga0501044_0098734	Ga0501044_0098734_1427_2458	337
591	3300054114	Ga0501084_0000013	Ga0501084_0000013_25082_26113	337
592	3300060353	Ga0501082_0000093	Ga0501082_0000093_43426_44457	337
593	iso_pu_bacteria	2835312727	2835317608	337
594	iso_pu_bacteria	2882456835	2882457436	337
595	iso_pu_bacteria	2884298095	2884301400	337
596	3300005290	Ga0065712_10003968	Ga0065712_100039681	338
597	3300005293	Ga0065715_10001568	Ga0065715_100015688	338
598	3300005327	Ga0070658_10068003	Ga0070658_100680033	338
599	3300005328	Ga0070676_10075887	Ga0070676_100758872	338
600	3300005330	Ga0070690_100078580	Ga0070690_1000785802	338
601	3300005338	Ga0068868_100063931	Ga0068868_1000639313	338
602	3300005339	Ga0070660_100068919	Ga0070660_1000689192	338
603	3300005340	Ga0070689_100069300	Ga0070689_1000693002	338
604	3300005354	Ga0070675_100008863	Ga0070675_1000088636	338
605	3300005355	Ga0070671_100012945	Ga0070671_1000129456	338
606	3300005364	Ga0070673_100004217	Ga0070673_1000042172	338
607	3300005365	Ga0070688_100039286	Ga0070688_1000392863	338
608	3300005455	Ga0070663_100252241	Ga0070663_1002522412	338
609	3300005456	Ga0070678_100036991	Ga0070678_1000369912	338
610	3300005466	Ga0070685_10003418	Ga0070685_100034187	338
611	3300005548	Ga0070665_100052208	Ga0070665_1000522082	338
612	3300010375	Ga0105239_10026650	Ga0105239_100266505	338
613	3300013308	Ga0157375_10013056	Ga0157375_100130566	338
614	3300014969	Ga0157376_10006836	Ga0157376_100068362	338
615	3300021384	Ga0213876_10034283	Ga0213876_100342832	338
616	3300025271	Ga0207666_1000203	Ga0207666_10002032	338
617	3300025315	Ga0207697_10001245	Ga0207697_1000124510	338
618	3300025907	Ga0207645_10113073	Ga0207645_101130731	338
619	3300025926	Ga0207659_10039946	Ga0207659_100399463	338
620	3300025932	Ga0207690_10292207	Ga0207690_102922072	338
621	3300025933	Ga0207706_10053015	Ga0207706_100530153	338
622	3300025960	Ga0207651_10010045	Ga0207651_100100452	338
623	3300026121	Ga0207683_10066006	Ga0207683_100660063	338
624	3300032004	Ga0307414_10164168	Ga0307414_101641682	338
625	3300032005	Ga0307411_10059223	Ga0307411_100592232	338
626	3300039437	Ga0436365_0476201	Ga0436365_0476201_963_2003	338
627	3300049581	Ga0501047_0129484	Ga0501047_0129484_670_1719	338
628	3300049686	Ga0501257_025006	Ga0501257_025006_93_1151	338
629	iso_pu_bacteria	2945945610	2945948627	338
630	iso_pu_bacteria	2945984333	2945986665	338
631	3300003323	rootH1_10000622	rootH1_100006229	339
632	3300003856	Ga0058692_1012137	Ga0058692_10121373	339
633	3300006852	Ga0075433_10011535	Ga0075433_100115354	339
634	3300006871	Ga0075434_100002554	Ga0075434_10000255411	339
635	3300007076	Ga0075435_100001246	Ga0075435_10000124611	339
636	3300025944	Ga0207661_10119263	Ga0207661_101192632	339
637	3300027312	Ga0209371_1013630	Ga0209371_10136302	339
638	3300030500	Ga0268256_1015091	Ga0268256_10150913	339
639	3300031824	Ga0307413_10106797	Ga0307413_101067972	339
640	3300037466	Ga0395898_0018099	Ga0395898_0018099_2673_3704	339
641	3300037471	Ga0395905_0025858	Ga0395905_0025858_1893_2924	339
642	3300038443	Ga0395901_0000022	Ga0395901_0000022_69654_70685	339
643	3300044694	Ga0466963_0054438	Ga0466963_0054438_1189_2250	339
644	3300044719	Ga0466971_0123164	Ga0466971_0123164_120_1181	339
645	3300044765	Ga0466970_0000165	Ga0466970_0000165_8580_9641	339
646	3300044842	Ga0466957_0001879	Ga0466957_0001879_5076_6137	339
647	3300045049	Ga0466959_0050613	Ga0466959_0050613_1650_2711	339
648	3300050512	nmdc:mga0n895_14432_c1	nmdc:mga0n895_14432_c1_407_1450	339
649	3300050513	nmdc:mga0rr50_3927_c1	nmdc:mga0rr50_3927_c1_5494_6537	339
650	3300050515	nmdc:mga0a205_4764_c1	nmdc:mga0a205_4764_c1_5730_6773	339
651	3300053104	Ga0500556_0000207	Ga0500556_0000207_27096_28115	339
652	3300061719	Ga0466962_0105750	Ga0466962_0105750_52_1113	339
653	3300004800	Ga0058861_10552529	Ga0058861_105525292	340
654	3300004803	Ga0058862_12468701	Ga0058862_124687014	340
655	3300005336	Ga0070680_100002366	Ga0070680_10000236612	340
656	3300005344	Ga0070661_100012093	Ga0070661_1000120933	340
657	3300005458	Ga0070681_10001939	Ga0070681_100019398	340
658	3300005458	Ga0070681_10055844	Ga0070681_100558442	340
659	3300005530	Ga0070679_100000193	Ga0070679_10000019314	340
660	3300005530	Ga0070679_100384373	Ga0070679_1003843731	340
661	3300005544	Ga0070686_100000092	Ga0070686_10000009214	340
662	3300005563	Ga0068855_100037557	Ga0068855_1000375573	340
663	3300005578	Ga0068854_100206985	Ga0068854_1002069852	340
664	3300005616	Ga0068852_100015547	Ga0068852_1000155472	340
665	3300006946	Ga0079104_1000579	Ga0079104_100057911	340
666	3300009551	Ga0105238_10010605	Ga0105238_100106053	340
667	3300013104	Ga0157370_10026176	Ga0157370_100261764	340
668	3300013307	Ga0157372_10035987	Ga0157372_100359874	340
669	3300014497	Ga0182008_10022662	Ga0182008_100226623	340
670	3300025912	Ga0207707_10005642	Ga0207707_100056427	340
671	3300025912	Ga0207707_10086070	Ga0207707_100860702	340
672	3300025913	Ga0207695_10188004	Ga0207695_101880042	340
673	3300025917	Ga0207660_10019259	Ga0207660_100192592	340
674	3300025917	Ga0207660_10022569	Ga0207660_100225694	340
675	3300025919	Ga0207657_10035381	Ga0207657_100353812	340
676	3300025921	Ga0207652_10003955	Ga0207652_100039559	340
677	3300025949	Ga0207667_10258107	Ga0207667_102581072	340
678	3300025981	Ga0207640_10021986	Ga0207640_100219862	340
679	3300026142	Ga0207698_10105171	Ga0207698_101051712	340
680	3300027111	Ga0209281_1000514	Ga0209281_100051436	340
681	3300027111	Ga0209281_1019097	Ga0209281_10190972	340
682	3300030731	Ga0316177_1065906	Ga0316177_10659062	340
683	3300030733	Ga0314311_1092240	Ga0314311_10922402	340
684	3300030744	Ga0316181_1005884	Ga0316181_10058842	340
685	3300031548	Ga0307408_100036845	Ga0307408_1000368452	340
686	3300031548	Ga0307408_100158235	Ga0307408_1001582352	340
687	3300031995	Ga0307409_100059251	Ga0307409_1000592511	340
688	3300031995	Ga0307409_100106519	Ga0307409_1001065192	340
689	3300032005	Ga0307411_10125904	Ga0307411_101259042	340
690	3300032005	Ga0307411_10365358	Ga0307411_103653581	340
691	3300041406	Ga0439439_0021186	Ga0439439_0021186_494_1540	340
692	3300042010	Ga0439452_015593	Ga0439452_015593_905_1951	340
693	3300042014	Ga0439457_004674	Ga0439457_004674_404_1450	340
694	3300042015	Ga0439462_0011136	Ga0439462_0011136_494_1540	340
695	3300044684	Ga0466966_0007556	Ga0466966_0007556_283_1317	340
696	3300044719	Ga0466971_0036179	Ga0466971_0036179_22_1053	340
697	3300044842	Ga0466957_0021562	Ga0466957_0021562_2499_3530	340
698	3300045049	Ga0466959_0086972	Ga0466959_0086972_531_1562	340
699	3300049759	Ga0501262_000034	Ga0501262_000034_10845_11894	340
700	3300053153	Ga0500616_0001172	Ga0500616_0001172_22647_23684	340
701	iso_pu_bacteria	2842677519	2842678493	340
702	iso_pu_bacteria	2919462493	2919465081	340
703	3300031727	Ga0316576_10077115	Ga0316576_100771152	342
704	3300031728	Ga0316578_10000808	Ga0316578_1000080810	342
705	3300031824	Ga0307413_10001452	Ga0307413_100014524	342
706	3300031824	Ga0307413_10043134	Ga0307413_100431342	342
707	3300031901	Ga0307406_10034776	Ga0307406_100347763	342
708	3300031903	Ga0307407_10022988	Ga0307407_100229882	342
709	3300031995	Ga0307409_100000682	Ga0307409_10000068211	342
710	3300031995	Ga0307409_100271056	Ga0307409_1002710562	342
711	3300032002	Ga0307416_100005664	Ga0307416_1000056642	342
712	3300032005	Ga0307411_10029189	Ga0307411_100291893	342
713	3300032126	Ga0307415_100015814	Ga0307415_1000158146	342
714	3300032139	Ga0316580_10011167	Ga0316580_100111672	342
715	3300036712	Ga0316584_0205803	Ga0316584_0205803_148_1209	342
716	3300002075	JGI24738J21930_10000568	JGI24738J21930_100005687	343
717	3300003322	rootL2_10141224	rootL2_101412244	343
718	3300005344	Ga0070661_100053762	Ga0070661_1000537623	343
719	3300005539	Ga0068853_100008199	Ga0068853_1000081996	343
720	3300005563	Ga0068855_100085333	Ga0068855_1000853332	343
721	3300006847	Ga0075431_100004901	Ga0075431_1000049018	343
722	3300006852	Ga0075433_10094680	Ga0075433_100946802	343
723	3300006880	Ga0075429_100042452	Ga0075429_1000424522	343
724	3300009147	Ga0114129_10067922	Ga0114129_100679223	343
725	3300010375	Ga0105239_10028786	Ga0105239_100287865	343
726	3300013102	Ga0157371_10046810	Ga0157371_100468102	343
727	3300013104	Ga0157370_10000377	Ga0157370_1000037725	343
728	3300013307	Ga0157372_10003768	Ga0157372_1000376812	343
729	3300025321	Ga0207656_10011803	Ga0207656_100118033	343
730	3300025913	Ga0207695_10100159	Ga0207695_101001592	343
731	3300025933	Ga0207706_10000720	Ga0207706_1000072035	343
732	3300025945	Ga0207679_10063028	Ga0207679_100630282	343
733	3300026041	Ga0207639_10009218	Ga0207639_100092187	343
734	3300026116	Ga0207674_10006773	Ga0207674_1000677311	343
735	3300031548	Ga0307408_100000134	Ga0307408_10000013451	343
736	3300031731	Ga0307405_10000157	Ga0307405_1000015711	343
737	3300031824	Ga0307413_10003349	Ga0307413_100033493	343
738	3300031852	Ga0307410_10001278	Ga0307410_100012788	343
739	3300031911	Ga0307412_10000337	Ga0307412_1000033730	343
740	3300032002	Ga0307416_100000247	Ga0307416_1000002474	343
741	3300032004	Ga0307414_10000469	Ga0307414_100004697	343
742	3300032005	Ga0307411_10001263	Ga0307411_100012638	343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

3

121

0.95 PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

129

258

0.88 PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

133

258

0.83 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3rc7-assembly1.cif.gz_A	crystal structure of the y186f mutant of kijd10, a 3-ketoreductase from actinomadura kijaniata in complex with tdp-benzene and nadp	0.8836	15	339
7xre-assembly1.cif.gz_B	crystal structure of dgpa	0.8829	15	340
3rc1-assembly1.cif.gz_A	crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with nadp and tdp-benzene	0.8809	15	339
3rcb-assembly1.cif.gz_A	crystal structure of the k102e mutant of kijd10, a 3-ketoreductase from actinomadura kijaniata in complex with tdp-benzene and nadp	0.8775	15	339
3rc9-assembly1.cif.gz_A	crystal structure of the k102a mutant of kijd10, a 3-ketoreductase from actinomadura kijaniata in complex with tdp-benzene and nadp	0.875	15	339

ID	Description	Score	Start	End	Superfamily
af_Q2G1E6_2_122_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9371	16	130	3.40.50.720
af_P42599_1_134_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9313	16	137	3.40.50.720
af_I1MZG8_3_134_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9287	15	133	3.40.50.720
3e18B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9183	15	133	3.40.50.720
4hktB01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9179	16	132	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A2V7Y9N5-F1-model_v4	Oxidoreductase	0.9746	13	337	GO:0000166 GO:0016491
AF-A0A7V3D321-F1-model_v4	Gfo/Idh/MocA family oxidoreductase	0.9646	15	157	GO:0000166
AF-A0A2V5M9I1-F1-model_v4	Gfo/Idh/MocA family oxidoreductase	0.9529	15	155	GO:0000166
AF-A0A151BEY2-F1-model_v4	Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein	0.9521	15	157	GO:0000166
AF-A0A7V5A0I5-F1-model_v4	Gfo/Idh/MocA family oxidoreductase	0.9458	16	139	GO:0000166

Feature Viewer

pLDDT	pTM	Quality
94.81	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F478645

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

3

121

0.95

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

129

258

0.88

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

133

258

0.83

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map