F478644
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 371 | 730 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300031616|Ga0307508_10001328|Ga0307508_1000132819 |
| Length | 274 |
| Sequence | MGRADEARAGASRGILDSRLRGNDGYTEHTMDRMIYLSMSGAKAMMQRQDTLANNLANVSTPGFRAELQAFRAVPVQGSGASTRVYSLETTPGYSAAPGVVSETGRNLDVAVKGNAWLSVQALDGTEAYTRGGALDINSEGALTTLSGLPVMGDGGPIQVPPQTEVSIGGDGTITGKAITGKISVIGKLKLVTPTADTPLERGEDGLFRGADGAELPADPTARVQDGALEGSNVSPVETMVSMITAARQFEAQMKMLQTAEGDEKAAAQLLSMS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 3 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 4 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 5 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 6 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 7 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 8 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 11 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 12 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 13 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 81 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 82 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 83 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 98 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 195 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 212 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 237 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 243 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 244 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 245 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 246 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 247 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 248 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 249 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 250 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 251 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 268 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 323 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 338 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 339 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 340 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 342 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 344 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 345 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 346 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 347 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 348 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 353 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 354 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 357 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 362 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 363 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 364 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 370 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.9 |
| Metatranscriptomes | 1.35 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.23 |
| Nodule | 0.54 |
| Rhizoplane | 3.1 |
| Rhizosphere | 73.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000819 | 3300002705 | Bacteria | 15840 |
| 2 | JGI25156J39149_1008311 | 3300002705 | Bacteria | 2628 |
| 3 | JGI25154J39366_1000824 | 3300002738 | Bacteria | 13459 |
| 4 | JGI25157J39369_1000027 | 3300002741 | Bacteria | 147448 |
| 5 | JGI25164J39214_1003672 | 3300002772 | Bacteria | 1891 |
| 6 | JGI25152J39213_1001390 | 3300002773 | Bacteria | 10482 |
| 7 | JGI25150J39212_1012465 | 3300002774 | Bacteria | 1505 |
| 8 | JGI25153J46596_10003685 | 3300003215 | Bacteria | 8471 |
| 9 | rootH1_10004916 | 3300003316 | Bacteria | 1512 |
| 10 | rootH1_10004916 | 3300003323 | Bacteria | 4708 |
| 11 | rootH1_10006365 | 3300003316 | Bacteria | 19108 |
| 12 | rootH2_10047071 | 3300003320 | Bacteria | 3455 |
| 13 | rootL2_10003861 | 3300003322 | Bacteria | 52646 |
| 14 | rootL2_10009273 | 3300003322 | Bacteria | 31971 |
| 15 | rootH1_10006621 | 3300003323 | Bacteria | 4004 |
| 16 | rootH1_10019349 | 3300003323 | Bacteria | 13289 |
| 17 | rootH1_10027533 | 3300003323 | Bacteria | 3244 |
| 18 | rootH1_10031598 | 3300003323 | Bacteria | 3903 |
| 19 | Ga0055539_1004569 | 3300003752 | Bacteria | 1838 |
| 20 | Ga0055539_1004861 | 3300003752 | Bacteria | 1771 |
| 21 | Ga0055533_1000073 | 3300003756 | Bacteria | 142476 |
| 22 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 23 | Ga0055525_1000687 | 3300003759 | Bacteria | 12627 |
| 24 | Ga0055535_1000229 | 3300003761 | Bacteria | 58945 |
| 25 | Ga0055529_1000064 | 3300003763 | Bacteria | 178831 |
| 26 | Ga0055526_1002388 | 3300003771 | Bacteria | 12716 |
| 27 | Ga0055530_10029662 | 3300003791 | Bacteria | 1460 |
| 28 | Ga0055540_1009954 | 3300003792 | Bacteria | 3213 |
| 29 | Ga0055540_1024456 | 3300003792 | Bacteria | 1498 |
| 30 | Ga0055531_10003179 | 3300003794 | Bacteria | 10559 |
| 31 | Ga0055531_10028054 | 3300003794 | Bacteria | 1953 |
| 32 | Ga0055543_1002234 | 3300004625 | Bacteria | 6575 |
| 33 | Ga0055543_1013363 | 3300004625 | Bacteria | 1625 |
| 34 | Ga0065165_1000283 | 3300005262 | Bacteria | 86141 |
| 35 | Ga0070658_10112110 | 3300005327 | Bacteria | 2261 |
| 36 | Ga0070658_10162910 | 3300005327 | Bacteria | 1871 |
| 37 | Ga0070658_10186426 | 3300005327 | Bacteria | 1747 |
| 38 | Ga0070658_10336633 | 3300005327 | Bacteria | 1290 |
| 39 | Ga0070658_10386740 | 3300005327 | Bacteria | 1201 |
| 40 | Ga0070676_10001564 | 3300005328 | Bacteria | 11610 |
| 41 | Ga0070676_10008248 | 3300005328 | Bacteria | 5609 |
| 42 | Ga0070676_10021053 | 3300005328 | Bacteria | 3648 |
| 43 | Ga0070676_10203141 | 3300005328 | Bacteria | 1300 |
| 44 | Ga0070683_100049545 | 3300005329 | Bacteria | 3885 |
| 45 | Ga0070670_100058457 | 3300005331 | Bacteria | 3310 |
| 46 | Ga0070670_100078920 | 3300005331 | Bacteria | 2828 |
| 47 | Ga0070670_100164150 | 3300005331 | Bacteria | 1925 |
| 48 | Ga0068869_100006946 | 3300005334 | Bacteria | 7204 |
| 49 | Ga0068869_100032102 | 3300005334 | Bacteria | 3698 |
| 50 | Ga0070666_10010360 | 3300005335 | Bacteria | 5829 |
| 51 | Ga0070682_100011477 | 3300005337 | Bacteria | 5064 |
| 52 | Ga0068868_100015353 | 3300005338 | Bacteria | 5663 |
| 53 | Ga0068868_100150412 | 3300005338 | Bacteria | 1917 |
| 54 | Ga0070691_10093657 | 3300005341 | Bacteria | 1484 |
| 55 | Ga0070661_100000220 | 3300005344 | Bacteria | 47213 |
| 56 | Ga0070661_100122816 | 3300005344 | Bacteria | 1946 |
| 57 | Ga0070661_100471212 | 3300005344 | Bacteria | 1001 |
| 58 | Ga0070668_100017395 | 3300005347 | Bacteria | 5386 |
| 59 | Ga0070668_100404298 | 3300005347 | Bacteria | 1166 |
| 60 | Ga0070669_100009995 | 3300005353 | Bacteria | 6745 |
| 61 | Ga0070669_100012537 | 3300005353 | Bacteria | 6011 |
| 62 | Ga0070675_100005126 | 3300005354 | Bacteria | 9998 |
| 63 | Ga0070675_100018606 | 3300005354 | Bacteria | 5530 |
| 64 | Ga0070675_100065579 | 3300005354 | Bacteria | 3003 |
| 65 | Ga0070675_100067887 | 3300005354 | Bacteria | 2951 |
| 66 | Ga0070675_100085117 | 3300005354 | Bacteria | 2641 |
| 67 | Ga0070675_100235705 | 3300005354 | Bacteria | 1598 |
| 68 | Ga0070671_100027816 | 3300005355 | Bacteria | 4655 |
| 69 | Ga0070671_100164531 | 3300005355 | Bacteria | 1875 |
| 70 | Ga0070674_100010227 | 3300005356 | Bacteria | 5660 |
| 71 | Ga0070674_100015369 | 3300005356 | Bacteria | 4778 |
| 72 | Ga0070674_100034505 | 3300005356 | Bacteria | 3380 |
| 73 | Ga0070673_100007297 | 3300005364 | Bacteria | 7276 |
| 74 | Ga0070673_100018847 | 3300005364 | Bacteria | 4944 |
| 75 | Ga0070673_100027663 | 3300005364 | Bacteria | 4206 |
| 76 | Ga0070688_100323478 | 3300005365 | Bacteria | 1121 |
| 77 | Ga0070659_100011721 | 3300005366 | Bacteria | 6490 |
| 78 | Ga0070659_100279317 | 3300005366 | Bacteria | 1389 |
| 79 | Ga0070659_100541699 | 3300005366 | Bacteria | 996 |
| 80 | Ga0070667_100015900 | 3300005367 | Bacteria | 6225 |
| 81 | Ga0070667_100413156 | 3300005367 | Bacteria | 1229 |
| 82 | Ga0070667_100644164 | 3300005367 | Bacteria | 978 |
| 83 | Ga0070700_100072194 | 3300005441 | Bacteria | 2206 |
| 84 | Ga0070708_100224098 | 3300005445 | Bacteria | 1764 |
| 85 | Ga0070663_100000511 | 3300005455 | Bacteria | 20575 |
| 86 | Ga0070663_100040338 | 3300005455 | Bacteria | 3267 |
| 87 | Ga0070663_100047246 | 3300005455 | Bacteria | 3049 |
| 88 | Ga0070663_100147313 | 3300005455 | Bacteria | 1802 |
| 89 | Ga0070678_100094551 | 3300005456 | Bacteria | 2301 |
| 90 | Ga0070678_100299788 | 3300005456 | Bacteria | 1365 |
| 91 | Ga0070678_100383983 | 3300005456 | Bacteria | 1216 |
| 92 | Ga0070662_100011606 | 3300005457 | Bacteria | 5814 |
| 93 | Ga0070662_100025773 | 3300005457 | Bacteria | 4064 |
| 94 | Ga0070662_100059050 | 3300005457 | Bacteria | 2793 |
| 95 | Ga0070662_100075848 | 3300005457 | Bacteria | 2491 |
| 96 | Ga0070662_100162304 | 3300005457 | Bacteria | 1749 |
| 97 | Ga0070662_100179951 | 3300005457 | Bacteria | 1666 |
| 98 | Ga0070662_100182899 | 3300005457 | Bacteria | 1653 |
| 99 | Ga0070681_10803284 | 3300005458 | Bacteria | 858 |
| 100 | Ga0068867_100000790 | 3300005459 | Bacteria | 21397 |
| 101 | Ga0068867_100013500 | 3300005459 | Bacteria | 5785 |
| 102 | Ga0068867_100026443 | 3300005459 | Bacteria | 4167 |
| 103 | Ga0068867_100036682 | 3300005459 | Bacteria | 3561 |
| 104 | Ga0068867_100052050 | 3300005459 | Bacteria | 3021 |
| 105 | Ga0068867_100159120 | 3300005459 | Bacteria | 1780 |
| 106 | Ga0070706_100006257 | 3300005467 | Bacteria | 11259 |
| 107 | Ga0070706_100091805 | 3300005467 | Bacteria | 2817 |
| 108 | Ga0070698_100147344 | 3300005471 | Bacteria | 2302 |
| 109 | Ga0070699_100039909 | 3300005518 | Bacteria | 4065 |
| 110 | Ga0070684_100184945 | 3300005535 | Bacteria | 1895 |
| 111 | Ga0070684_100431796 | 3300005535 | Bacteria | 1216 |
| 112 | Ga0068853_100054053 | 3300005539 | Bacteria | 3460 |
| 113 | Ga0070672_100007320 | 3300005543 | Bacteria | 7483 |
| 114 | Ga0070672_100025782 | 3300005543 | Bacteria | 4367 |
| 115 | Ga0070672_100077068 | 3300005543 | Bacteria | 2665 |
| 116 | Ga0070672_100201268 | 3300005543 | Bacteria | 1665 |
| 117 | Ga0070672_100248257 | 3300005543 | Bacteria | 1498 |
| 118 | Ga0070665_100235654 | 3300005548 | Bacteria | 1831 |
| 119 | Ga0070665_100340176 | 3300005548 | Bacteria | 1505 |
| 120 | Ga0070665_100593165 | 3300005548 | Bacteria | 1121 |
| 121 | Ga0070704_100738292 | 3300005549 | Bacteria | 876 |
| 122 | Ga0068855_100036949 | 3300005563 | Bacteria | 5811 |
| 123 | Ga0068855_100232839 | 3300005563 | Bacteria | 2061 |
| 124 | Ga0068855_100234373 | 3300005563 | Bacteria | 2053 |
| 125 | Ga0068855_100804494 | 3300005563 | Bacteria | 999 |
| 126 | Ga0070664_100000267 | 3300005564 | Bacteria | 37668 |
| 127 | Ga0068857_100029449 | 3300005577 | Bacteria | 4845 |
| 128 | Ga0068857_100095589 | 3300005577 | Bacteria | 2662 |
| 129 | Ga0068857_100445996 | 3300005577 | Bacteria | 1209 |
| 130 | Ga0068854_100022875 | 3300005578 | Bacteria | 4264 |
| 131 | Ga0068854_100024167 | 3300005578 | Bacteria | 4158 |
| 132 | Ga0068856_100002053 | 3300005614 | Bacteria | 20877 |
| 133 | Ga0068856_100024851 | 3300005614 | Bacteria | 5835 |
| 134 | Ga0068856_100341809 | 3300005614 | Bacteria | 1515 |
| 135 | Ga0068852_100043701 | 3300005616 | Bacteria | 3801 |
| 136 | Ga0068852_100056636 | 3300005616 | Bacteria | 3389 |
| 137 | Ga0068852_100093722 | 3300005616 | Bacteria | 2692 |
| 138 | Ga0068852_100142284 | 3300005616 | Bacteria | 2221 |
| 139 | Ga0068852_100216417 | 3300005616 | Bacteria | 1820 |
| 140 | Ga0068852_100356599 | 3300005616 | Bacteria | 1429 |
| 141 | Ga0068852_100679484 | 3300005616 | Bacteria | 1039 |
| 142 | Ga0068859_100106772 | 3300005617 | Bacteria | 2859 |
| 143 | Ga0068859_100108883 | 3300005617 | Bacteria | 2832 |
| 144 | Ga0068864_100060031 | 3300005618 | Bacteria | 3292 |
| 145 | Ga0068864_100219491 | 3300005618 | Bacteria | 1754 |
| 146 | Ga0068864_100421101 | 3300005618 | Bacteria | 1272 |
| 147 | Ga0068864_100710494 | 3300005618 | Bacteria | 982 |
| 148 | Ga0068866_10110123 | 3300005718 | Bacteria | 1535 |
| 149 | Ga0068861_100015673 | 3300005719 | Bacteria | 5348 |
| 150 | Ga0068861_100022104 | 3300005719 | Bacteria | 4578 |
| 151 | Ga0068861_100022301 | 3300005719 | Bacteria | 4560 |
| 152 | Ga0068851_10037386 | 3300005834 | Bacteria | 2433 |
| 153 | Ga0068851_10100469 | 3300005834 | Bacteria | 1534 |
| 154 | Ga0068870_10267380 | 3300005840 | Bacteria | 1067 |
| 155 | Ga0068863_100049597 | 3300005841 | Bacteria | 3980 |
| 156 | Ga0068858_100006620 | 3300005842 | Bacteria | 11273 |
| 157 | Ga0068858_100120280 | 3300005842 | Bacteria | 2455 |
| 158 | Ga0068860_100097662 | 3300005843 | Bacteria | 2800 |
| 159 | Ga0068860_100172086 | 3300005843 | Bacteria | 2092 |
| 160 | Ga0068862_100063807 | 3300005844 | Bacteria | 3170 |
| 161 | Ga0068862_100228663 | 3300005844 | Bacteria | 1686 |
| 162 | Ga0075363_100038359 | 3300006048 | Bacteria | 2519 |
| 163 | Ga0075364_10053170 | 3300006051 | Bacteria | 2647 |
| 164 | Ga0075362_10012284 | 3300006177 | Bacteria | 3399 |
| 165 | Ga0075362_10028110 | 3300006177 | Bacteria | 2413 |
| 166 | Ga0075367_10002209 | 3300006178 | Bacteria | 8782 |
| 167 | Ga0075367_10088704 | 3300006178 | Bacteria | 1880 |
| 168 | Ga0075369_10023004 | 3300006186 | Bacteria | 2573 |
| 169 | Ga0075366_10007775 | 3300006195 | Bacteria | 5935 |
| 170 | Ga0075366_10013362 | 3300006195 | Bacteria | 4672 |
| 171 | Ga0075366_10029844 | 3300006195 | Bacteria | 3204 |
| 172 | Ga0075366_10078048 | 3300006195 | Bacteria | 1976 |
| 173 | Ga0075366_10086045 | 3300006195 | Bacteria | 1881 |
| 174 | Ga0075366_10134156 | 3300006195 | Bacteria | 1495 |
| 175 | Ga0075366_10356339 | 3300006195 | Bacteria | 898 |
| 176 | Ga0097621_100168995 | 3300006237 | Bacteria | 1884 |
| 177 | Ga0075370_10000201 | 3300006353 | Bacteria | 21046 |
| 178 | Ga0075370_10001234 | 3300006353 | Bacteria | 10856 |
| 179 | Ga0075370_10003435 | 3300006353 | Bacteria | 7541 |
| 180 | Ga0075370_10009591 | 3300006353 | Bacteria | 5033 |
| 181 | Ga0075370_10010256 | 3300006353 | Bacteria | 4892 |
| 182 | Ga0075370_10029300 | 3300006353 | Bacteria | 3066 |
| 183 | Ga0075370_10034024 | 3300006353 | Bacteria | 2856 |
| 184 | Ga0075370_10044650 | 3300006353 | Bacteria | 2505 |
| 185 | Ga0075370_10044825 | 3300006353 | Bacteria | 2500 |
| 186 | Ga0068871_100020051 | 3300006358 | Bacteria | 5117 |
| 187 | Ga0068871_100081992 | 3300006358 | Bacteria | 2674 |
| 188 | Ga0068865_100014886 | 3300006881 | Bacteria | 4951 |
| 189 | Ga0068865_100221348 | 3300006881 | Bacteria | 1480 |
| 190 | Ga0097620_100106761 | 3300006931 | Bacteria | 2859 |
| 191 | Ga0097620_100108885 | 3300006931 | Bacteria | 2832 |
| 192 | Ga0099823_1000083 | 3300006944 | Bacteria | 44975 |
| 193 | Ga0079104_1000013 | 3300006946 | Bacteria | 349477 |
| 194 | Ga0105240_10015301 | 3300009093 | Bacteria | 10439 |
| 195 | Ga0105240_10118894 | 3300009093 | Bacteria | 3184 |
| 196 | Ga0105240_10524014 | 3300009093 | Bacteria | 1315 |
| 197 | Ga0105245_10013187 | 3300009098 | Bacteria | 7201 |
| 198 | Ga0105245_10228508 | 3300009098 | Bacteria | 1799 |
| 199 | Ga0105245_10470397 | 3300009098 | Bacteria | 1269 |
| 200 | Ga0114129_10241375 | 3300009147 | Bacteria | 2429 |
| 201 | Ga0105243_10002845 | 3300009148 | Bacteria | 14364 |
| 202 | Ga0105243_10004374 | 3300009148 | Bacteria | 11179 |
| 203 | Ga0105243_10010965 | 3300009148 | Bacteria | 6853 |
| 204 | Ga0105243_10078629 | 3300009148 | Bacteria | 2686 |
| 205 | Ga0105243_10091822 | 3300009148 | Bacteria | 2501 |
| 206 | Ga0105243_10120701 | 3300009148 | Bacteria | 2209 |
| 207 | Ga0105243_10124756 | 3300009148 | Bacteria | 2176 |
| 208 | Ga0105242_10313640 | 3300009176 | Bacteria | 1436 |
| 209 | Ga0105242_10351715 | 3300009176 | Bacteria | 1361 |
| 210 | Ga0105242_10726124 | 3300009176 | Bacteria | 975 |
| 211 | Ga0105248_10022270 | 3300009177 | Bacteria | 7025 |
| 212 | Ga0105248_10095190 | 3300009177 | Bacteria | 3353 |
| 213 | Ga0105248_10124017 | 3300009177 | Bacteria | 2914 |
| 214 | Ga0105237_10000441 | 3300009545 | Bacteria | 59156 |
| 215 | Ga0105237_10005851 | 3300009545 | Bacteria | 13795 |
| 216 | Ga0105238_10009732 | 3300009551 | Bacteria | 9625 |
| 217 | Ga0105238_10070600 | 3300009551 | Bacteria | 3491 |
| 218 | Ga0105238_10171909 | 3300009551 | Bacteria | 2143 |
| 219 | Ga0105249_10029198 | 3300009553 | Bacteria | 4980 |
| 220 | Ga0105239_10000417 | 3300010375 | Bacteria | 62040 |
| 221 | Ga0105239_10037957 | 3300010375 | Bacteria | 5279 |
| 222 | Ga0105239_10081431 | 3300010375 | Bacteria | 3563 |
| 223 | Ga0105239_10083030 | 3300010375 | Bacteria | 3528 |
| 224 | Ga0105239_10239407 | 3300010375 | Bacteria | 2037 |
| 225 | Ga0105246_10115928 | 3300011119 | Bacteria | 1976 |
| 226 | Ga0157319_1000037 | 3300012497 | Bacteria | 39883 |
| 227 | Ga0157371_10167673 | 3300013102 | Bacteria | 1569 |
| 228 | Ga0157369_10028648 | 3300013105 | Bacteria | 6163 |
| 229 | Ga0157369_10842038 | 3300013105 | Bacteria | 942 |
| 230 | Ga0157374_10029986 | 3300013296 | Bacteria | 4935 |
| 231 | Ga0157374_10524788 | 3300013296 | Bacteria | 1190 |
| 232 | Ga0157374_10707214 | 3300013296 | Bacteria | 1021 |
| 233 | Ga0157378_10095407 | 3300013297 | Bacteria | 2709 |
| 234 | Ga0157378_10208963 | 3300013297 | Bacteria | 1850 |
| 235 | Ga0157378_10501530 | 3300013297 | Bacteria | 1212 |
| 236 | Ga0163162_10025537 | 3300013306 | Bacteria | 5838 |
| 237 | Ga0163162_10065803 | 3300013306 | Bacteria | 3673 |
| 238 | Ga0163162_10939741 | 3300013306 | Bacteria | 976 |
| 239 | Ga0157372_10033672 | 3300013307 | Bacteria | 5630 |
| 240 | Ga0157375_10196704 | 3300013308 | Bacteria | 2171 |
| 241 | Ga0157375_10226234 | 3300013308 | Bacteria | 2029 |
| 242 | Ga0157375_11210744 | 3300013308 | Bacteria | 886 |
| 243 | Ga0163163_11011645 | 3300014325 | Bacteria | 894 |
| 244 | Ga0157380_10269980 | 3300014326 | Bacteria | 1550 |
| 245 | Ga0157377_10000091 | 3300014745 | Bacteria | 66087 |
| 246 | Ga0157377_10016804 | 3300014745 | Bacteria | 3771 |
| 247 | Ga0157377_10198369 | 3300014745 | Bacteria | 1273 |
| 248 | Ga0157379_10019670 | 3300014968 | Bacteria | 5964 |
| 249 | Ga0157379_10048077 | 3300014968 | Bacteria | 3808 |
| 250 | Ga0157379_10257130 | 3300014968 | Bacteria | 1586 |
| 251 | Ga0157379_10446633 | 3300014968 | Bacteria | 1193 |
| 252 | Ga0157376_10014494 | 3300014969 | Bacteria | 5920 |
| 253 | Ga0157376_10325280 | 3300014969 | Bacteria | 1463 |
| 254 | Ga0157376_10494306 | 3300014969 | Bacteria | 1201 |
| 255 | Ga0163161_10019047 | 3300017792 | Bacteria | 4812 |
| 256 | Ga0163161_10031397 | 3300017792 | Bacteria | 3784 |
| 257 | Ga0213872_10000018 | 3300021361 | Bacteria | 175951 |
| 258 | Ga0213872_10000070 | 3300021361 | Bacteria | 91519 |
| 259 | Ga0213872_10000417 | 3300021361 | Bacteria | 34831 |
| 260 | Ga0209674_100039 | 3300025226 | Bacteria | 402292 |
| 261 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 262 | Ga0209563_100110 | 3300025230 | Bacteria | 142518 |
| 263 | Ga0207427_101215 | 3300025231 | Bacteria | 9962 |
| 264 | Ga0209258_100124 | 3300025242 | Bacteria | 178883 |
| 265 | Ga0209258_105648 | 3300025242 | Bacteria | 2081 |
| 266 | Ga0207425_1000333 | 3300025245 | Bacteria | 33033 |
| 267 | Ga0209646_1000196 | 3300025246 | Bacteria | 72959 |
| 268 | Ga0209646_1016918 | 3300025246 | Bacteria | 1079 |
| 269 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 270 | Ga0209677_100151 | 3300025253 | Bacteria | 63642 |
| 271 | Ga0209677_100488 | 3300025253 | Bacteria | 22414 |
| 272 | Ga0209677_100877 | 3300025253 | Bacteria | 14760 |
| 273 | Ga0209759_1000107 | 3300025256 | Bacteria | 147025 |
| 274 | Ga0209759_1000652 | 3300025256 | Bacteria | 32306 |
| 275 | Ga0209759_1000898 | 3300025256 | Bacteria | 22252 |
| 276 | Ga0209759_1019767 | 3300025256 | Bacteria | 1586 |
| 277 | Ga0209759_1037097 | 3300025256 | Bacteria | 880 |
| 278 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 279 | Ga0209455_1000114 | 3300025272 | Bacteria | 178883 |
| 280 | Ga0209673_1009846 | 3300025273 | Bacteria | 4092 |
| 281 | Ga0209675_1019509 | 3300025291 | Bacteria | 1864 |
| 282 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 283 | Ga0209564_1000014 | 3300025295 | Bacteria | 621501 |
| 284 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 285 | Ga0209758_1000208 | 3300025297 | Bacteria | 128596 |
| 286 | Ga0209050_1008652 | 3300025298 | Bacteria | 5382 |
| 287 | Ga0209256_1000130 | 3300025299 | Bacteria | 163227 |
| 288 | Ga0209256_1000471 | 3300025299 | Bacteria | 60530 |
| 289 | Ga0209051_1001932 | 3300025303 | Bacteria | 16014 |
| 290 | Ga0209051_1002398 | 3300025303 | Bacteria | 13498 |
| 291 | Ga0209051_1006338 | 3300025303 | Bacteria | 6695 |
| 292 | Ga0209051_1009233 | 3300025303 | Bacteria | 5103 |
| 293 | Ga0209257_1000049 | 3300025304 | Bacteria | 441224 |
| 294 | Ga0209257_1001013 | 3300025304 | Bacteria | 37837 |
| 295 | Ga0209257_1001664 | 3300025304 | Bacteria | 25177 |
| 296 | Ga0209257_1060265 | 3300025304 | Bacteria | 1033 |
| 297 | Ga0207697_10024132 | 3300025315 | Bacteria | 2491 |
| 298 | Ga0207697_10029145 | 3300025315 | Bacteria | 2258 |
| 299 | Ga0207697_10101257 | 3300025315 | Bacteria | 1228 |
| 300 | Ga0207656_10088785 | 3300025321 | Bacteria | 1400 |
| 301 | Ga0207656_10115967 | 3300025321 | Bacteria | 1242 |
| 302 | Ga0207682_10022146 | 3300025893 | Bacteria | 2502 |
| 303 | Ga0207682_10026607 | 3300025893 | Bacteria | 2300 |
| 304 | Ga0207682_10081982 | 3300025893 | Bacteria | 1384 |
| 305 | Ga0207688_10030413 | 3300025901 | Bacteria | 2977 |
| 306 | Ga0207688_10036249 | 3300025901 | Bacteria | 2734 |
| 307 | Ga0207688_10095062 | 3300025901 | Bacteria | 1715 |
| 308 | Ga0207680_10456126 | 3300025903 | Bacteria | 908 |
| 309 | Ga0207645_10001787 | 3300025907 | Bacteria | 17388 |
| 310 | Ga0207645_10008457 | 3300025907 | Bacteria | 7178 |
| 311 | Ga0207645_10014732 | 3300025907 | Bacteria | 5221 |
| 312 | Ga0207645_10110772 | 3300025907 | Bacteria | 1777 |
| 313 | Ga0207643_10082044 | 3300025908 | Bacteria | 1869 |
| 314 | Ga0207643_10335907 | 3300025908 | Bacteria | 946 |
| 315 | Ga0207643_10492395 | 3300025908 | Bacteria | 783 |
| 316 | Ga0207705_10126816 | 3300025909 | Bacteria | 1897 |
| 317 | Ga0207705_10134771 | 3300025909 | Bacteria | 1840 |
| 318 | Ga0207705_10174068 | 3300025909 | Bacteria | 1622 |
| 319 | Ga0207705_10439247 | 3300025909 | Bacteria | 1011 |
| 320 | Ga0207684_10041453 | 3300025910 | Bacteria | 3903 |
| 321 | Ga0207654_10019687 | 3300025911 | Bacteria | 3567 |
| 322 | Ga0207695_10023628 | 3300025913 | Bacteria | 6937 |
| 323 | Ga0207695_10024383 | 3300025913 | Bacteria | 6809 |
| 324 | Ga0207695_10731186 | 3300025913 | Bacteria | 870 |
| 325 | Ga0207671_10001929 | 3300025914 | Bacteria | 22998 |
| 326 | Ga0207671_10045543 | 3300025914 | Bacteria | 3244 |
| 327 | Ga0207657_10044064 | 3300025919 | Bacteria | 3925 |
| 328 | Ga0207657_10127028 | 3300025919 | Bacteria | 2093 |
| 329 | Ga0207657_10342328 | 3300025919 | Bacteria | 1180 |
| 330 | Ga0207649_10001581 | 3300025920 | Bacteria | 13262 |
| 331 | Ga0207649_10079481 | 3300025920 | Bacteria | 2119 |
| 332 | Ga0207649_10112887 | 3300025920 | Bacteria | 1819 |
| 333 | Ga0207681_10000974 | 3300025923 | Bacteria | 18695 |
| 334 | Ga0207681_10035283 | 3300025923 | Bacteria | 3294 |
| 335 | Ga0207681_10062794 | 3300025923 | Bacteria | 2559 |
| 336 | Ga0207694_10062742 | 3300025924 | Bacteria | 2894 |
| 337 | Ga0207694_10106435 | 3300025924 | Bacteria | 2228 |
| 338 | Ga0207650_10060020 | 3300025925 | Bacteria | 2837 |
| 339 | Ga0207650_10072212 | 3300025925 | Bacteria | 2597 |
| 340 | Ga0207650_10093142 | 3300025925 | Bacteria | 2306 |
| 341 | Ga0207650_10191466 | 3300025925 | Bacteria | 1634 |
| 342 | Ga0207659_10020790 | 3300025926 | Bacteria | 4345 |
| 343 | Ga0207659_10042645 | 3300025926 | Bacteria | 3182 |
| 344 | Ga0207659_10086103 | 3300025926 | Bacteria | 2336 |
| 345 | Ga0207659_10090565 | 3300025926 | Bacteria | 2283 |
| 346 | Ga0207659_10197159 | 3300025926 | Bacteria | 1606 |
| 347 | Ga0207687_10082878 | 3300025927 | Bacteria | 2321 |
| 348 | Ga0207687_10289598 | 3300025927 | Bacteria | 1316 |
| 349 | Ga0207644_10016843 | 3300025931 | Bacteria | 4924 |
| 350 | Ga0207644_10024152 | 3300025931 | Bacteria | 4171 |
| 351 | Ga0207644_10368925 | 3300025931 | Bacteria | 1169 |
| 352 | Ga0207690_10147841 | 3300025932 | Bacteria | 1739 |
| 353 | Ga0207690_10154917 | 3300025932 | Bacteria | 1702 |
| 354 | Ga0207690_10434774 | 3300025932 | Bacteria | 1052 |
| 355 | Ga0207706_10000993 | 3300025933 | Bacteria | 28866 |
| 356 | Ga0207706_10001576 | 3300025933 | Bacteria | 22614 |
| 357 | Ga0207706_10091398 | 3300025933 | Bacteria | 2676 |
| 358 | Ga0207706_10129692 | 3300025933 | Bacteria | 2218 |
| 359 | Ga0207706_10182261 | 3300025933 | Bacteria | 1844 |
| 360 | Ga0207706_10184163 | 3300025933 | Bacteria | 1834 |
| 361 | Ga0207686_10192095 | 3300025934 | Bacteria | 1456 |
| 362 | Ga0207709_10004566 | 3300025935 | Bacteria | 7972 |
| 363 | Ga0207709_10026089 | 3300025935 | Bacteria | 3353 |
| 364 | Ga0207709_10035015 | 3300025935 | Bacteria | 2965 |
| 365 | Ga0207709_10084466 | 3300025935 | Bacteria | 2055 |
| 366 | Ga0207669_10019498 | 3300025937 | Bacteria | 3533 |
| 367 | Ga0207669_10027345 | 3300025937 | Bacteria | 3121 |
| 368 | Ga0207704_10056029 | 3300025938 | Bacteria | 2412 |
| 369 | Ga0207704_10205333 | 3300025938 | Bacteria | 1445 |
| 370 | Ga0207704_10450450 | 3300025938 | Bacteria | 1027 |
| 371 | Ga0207704_10715257 | 3300025938 | Bacteria | 830 |
| 372 | Ga0207665_10239116 | 3300025939 | Bacteria | 1337 |
| 373 | Ga0207691_10006575 | 3300025940 | Bacteria | 11227 |
| 374 | Ga0207691_10042436 | 3300025940 | Bacteria | 4193 |
| 375 | Ga0207691_10115314 | 3300025940 | Bacteria | 2386 |
| 376 | Ga0207691_10469389 | 3300025940 | Bacteria | 1070 |
| 377 | Ga0207711_10005046 | 3300025941 | Bacteria | 11194 |
| 378 | Ga0207711_10015814 | 3300025941 | Bacteria | 6260 |
| 379 | Ga0207689_10000855 | 3300025942 | Bacteria | 29354 |
| 380 | Ga0207689_10003648 | 3300025942 | Bacteria | 14048 |
| 381 | Ga0207689_10009091 | 3300025942 | Bacteria | 8601 |
| 382 | Ga0207689_10113469 | 3300025942 | Bacteria | 2227 |
| 383 | Ga0207679_10000486 | 3300025945 | Bacteria | 27449 |
| 384 | Ga0207679_10256730 | 3300025945 | Bacteria | 1489 |
| 385 | Ga0207679_10365409 | 3300025945 | Bacteria | 1261 |
| 386 | Ga0207679_10453235 | 3300025945 | Bacteria | 1138 |
| 387 | Ga0207679_10782839 | 3300025945 | Bacteria | 869 |
| 388 | Ga0207667_10099975 | 3300025949 | Bacteria | 2992 |
| 389 | Ga0207667_10159584 | 3300025949 | Bacteria | 2320 |
| 390 | Ga0207667_10360759 | 3300025949 | Bacteria | 1482 |
| 391 | Ga0207651_10002160 | 3300025960 | Bacteria | 9302 |
| 392 | Ga0207651_10243179 | 3300025960 | Bacteria | 1468 |
| 393 | Ga0207712_10106021 | 3300025961 | Bacteria | 2099 |
| 394 | Ga0207668_10129350 | 3300025972 | Bacteria | 1925 |
| 395 | Ga0207640_10011945 | 3300025981 | Bacteria | 4932 |
| 396 | Ga0207640_10058408 | 3300025981 | Bacteria | 2541 |
| 397 | Ga0207640_10496267 | 3300025981 | Bacteria | 1016 |
| 398 | Ga0207658_10005961 | 3300025986 | Bacteria | 8325 |
| 399 | Ga0207658_10168912 | 3300025986 | Bacteria | 1800 |
| 400 | Ga0207658_10599759 | 3300025986 | Bacteria | 989 |
| 401 | Ga0207677_10017341 | 3300026023 | Bacteria | 4290 |
| 402 | Ga0207677_10158644 | 3300026023 | Bacteria | 1755 |
| 403 | Ga0207677_10168103 | 3300026023 | Bacteria | 1711 |
| 404 | Ga0207703_10065050 | 3300026035 | Bacteria | 2995 |
| 405 | Ga0207703_10246180 | 3300026035 | Bacteria | 1609 |
| 406 | Ga0207703_10436691 | 3300026035 | Bacteria | 1221 |
| 407 | Ga0207639_10015071 | 3300026041 | Bacteria | 5444 |
| 408 | Ga0207639_10680217 | 3300026041 | Bacteria | 953 |
| 409 | Ga0207678_10005512 | 3300026067 | Bacteria | 11313 |
| 410 | Ga0207678_10023385 | 3300026067 | Bacteria | 5404 |
| 411 | Ga0207678_10166497 | 3300026067 | Bacteria | 1882 |
| 412 | Ga0207678_10236701 | 3300026067 | Bacteria | 1564 |
| 413 | Ga0207678_10319869 | 3300026067 | Bacteria | 1335 |
| 414 | Ga0207708_10041755 | 3300026075 | Bacteria | 3496 |
| 415 | Ga0207702_10000356 | 3300026078 | Bacteria | 52498 |
| 416 | Ga0207702_10047997 | 3300026078 | Bacteria | 3600 |
| 417 | Ga0207702_10183623 | 3300026078 | Bacteria | 1928 |
| 418 | Ga0207702_10190137 | 3300026078 | Bacteria | 1896 |
| 419 | Ga0207641_10001680 | 3300026088 | Bacteria | 21541 |
| 420 | Ga0207641_10559869 | 3300026088 | Bacteria | 1116 |
| 421 | Ga0207648_10002162 | 3300026089 | Bacteria | 21355 |
| 422 | Ga0207648_10010360 | 3300026089 | Bacteria | 8842 |
| 423 | Ga0207648_10040097 | 3300026089 | Bacteria | 4115 |
| 424 | Ga0207648_10058384 | 3300026089 | Bacteria | 3364 |
| 425 | Ga0207648_10410318 | 3300026089 | Bacteria | 1228 |
| 426 | Ga0207676_10200144 | 3300026095 | Bacteria | 1764 |
| 427 | Ga0207676_10476828 | 3300026095 | Bacteria | 1181 |
| 428 | Ga0207674_10026355 | 3300026116 | Bacteria | 6176 |
| 429 | Ga0207674_10054067 | 3300026116 | Bacteria | 4090 |
| 430 | Ga0207674_10112313 | 3300026116 | Bacteria | 2698 |
| 431 | Ga0207674_10122177 | 3300026116 | Bacteria | 2570 |
| 432 | Ga0207675_100000911 | 3300026118 | Bacteria | 29492 |
| 433 | Ga0207675_100025343 | 3300026118 | Bacteria | 5518 |
| 434 | Ga0207675_100112287 | 3300026118 | Bacteria | 2572 |
| 435 | Ga0207683_10025099 | 3300026121 | Bacteria | 5139 |
| 436 | Ga0207683_10067518 | 3300026121 | Bacteria | 3154 |
| 437 | Ga0207683_10247414 | 3300026121 | Bacteria | 1627 |
| 438 | Ga0207683_10280562 | 3300026121 | Bacteria | 1522 |
| 439 | Ga0207683_10734175 | 3300026121 | Bacteria | 916 |
| 440 | Ga0207683_10861978 | 3300026121 | Bacteria | 841 |
| 441 | Ga0207698_10006990 | 3300026142 | Bacteria | 7064 |
| 442 | Ga0207698_10043539 | 3300026142 | Bacteria | 3364 |
| 443 | Ga0207698_10128705 | 3300026142 | Bacteria | 2159 |
| 444 | Ga0207698_10171264 | 3300026142 | Bacteria | 1912 |
| 445 | Ga0209281_1000076 | 3300027111 | Bacteria | 263350 |
| 446 | Ga0209996_1004814 | 3300027395 | Bacteria | 1724 |
| 447 | Ga0268266_10259244 | 3300028379 | Bacteria | 1611 |
| 448 | Ga0268266_10555972 | 3300028379 | Bacteria | 1100 |
| 449 | Ga0268265_10016231 | 3300028380 | Bacteria | 5112 |
| 450 | Ga0268265_10158640 | 3300028380 | Bacteria | 1918 |
| 451 | Ga0268265_10843370 | 3300028380 | Bacteria | 896 |
| 452 | Ga0268264_10052692 | 3300028381 | Bacteria | 3393 |
| 453 | Ga0268264_10223286 | 3300028381 | Bacteria | 1735 |
| 454 | Ga0265334_10067856 | 3300028573 | Bacteria | 1332 |
| 455 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 456 | Ga0307517_10335046 | 3300028786 | Bacteria | 829 |
| 457 | Ga0307515_10000131 | 3300028794 | Bacteria | 178919 |
| 458 | Ga0307515_10000165 | 3300028794 | Bacteria | 162589 |
| 459 | Ga0307515_10000232 | 3300028794 | Bacteria | 137778 |
| 460 | Ga0307515_10001456 | 3300028794 | Bacteria | 53165 |
| 461 | Ga0307515_10003007 | 3300028794 | Bacteria | 35804 |
| 462 | Ga0307515_10027050 | 3300028794 | Bacteria | 9832 |
| 463 | Ga0307515_10101925 | 3300028794 | Bacteria | 3459 |
| 464 | Ga0265324_10002326 | 3300029957 | Bacteria | 9841 |
| 465 | Ga0268256_1021399 | 3300030500 | Bacteria | 1721 |
| 466 | Ga0265328_10027240 | 3300031239 | Bacteria | 2143 |
| 467 | Ga0265331_10091700 | 3300031250 | Bacteria | 1404 |
| 468 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 469 | Ga0307513_10001541 | 3300031456 | Bacteria | 33038 |
| 470 | Ga0307509_10246280 | 3300031507 | Bacteria | 1575 |
| 471 | Ga0307408_100000160 | 3300031548 | Bacteria | 74342 |
| 472 | Ga0307408_100039869 | 3300031548 | Bacteria | 3323 |
| 473 | Ga0307408_100064966 | 3300031548 | Bacteria | 2675 |
| 474 | Ga0307408_100096425 | 3300031548 | Bacteria | 2244 |
| 475 | Ga0307408_100216238 | 3300031548 | Bacteria | 1561 |
| 476 | Ga0307508_10001328 | 3300031616 | Bacteria | 27985 |
| 477 | Ga0307514_10001289 | 3300031649 | Bacteria | 32516 |
| 478 | Ga0307516_10002032 | 3300031730 | Bacteria | 27587 |
| 479 | Ga0307516_10002726 | 3300031730 | Bacteria | 23277 |
| 480 | Ga0307516_10015871 | 3300031730 | Bacteria | 7903 |
| 481 | Ga0307516_10051235 | 3300031730 | Bacteria | 4047 |
| 482 | Ga0307516_10276676 | 3300031730 | Bacteria | 1362 |
| 483 | Ga0307409_100464726 | 3300031995 | Bacteria | 1224 |
| 484 | Ga0307416_100078114 | 3300032002 | Bacteria | 2783 |
| 485 | Ga0307416_100942918 | 3300032002 | Bacteria | 965 |
| 486 | Ga0307414_10005757 | 3300032004 | Bacteria | 6848 |
| 487 | Ga0307414_10777095 | 3300032004 | Bacteria | 872 |
| 488 | Ga0307411_10009492 | 3300032005 | Bacteria | 5119 |
| 489 | Ga0307411_10212005 | 3300032005 | Bacteria | 1496 |
| 490 | Ga0307411_10392620 | 3300032005 | Bacteria | 1145 |
| 491 | Ga0307510_10007541 | 3300033180 | Bacteria | 12959 |
| 492 | Ga0373959_0040877 | 3300034820 | Bacteria | 972 |
| 493 | Ga0373940_0096976 | 3300035088 | Bacteria | 890 |
| 494 | Ga0373949_0022695 | 3300035090 | Bacteria | 1449 |
| 495 | Ga0373932_0116696 | 3300035112 | Bacteria | 886 |
| 496 | Ga0373939_0001481 | 3300035114 | Bacteria | 5688 |
| 497 | Ga0373956_0228389 | 3300035119 | Bacteria | 884 |
| 498 | Ga0373960_0012261 | 3300035121 | Bacteria | 2127 |
| 499 | Ga0373960_0072452 | 3300035121 | Bacteria | 1068 |
| 500 | Ga0373943_0256544 | 3300035170 | Bacteria | 983 |
| 501 | Ga0373962_0010650 | 3300035242 | Bacteria | 2297 |
| 502 | Ga0373962_0034740 | 3300035242 | Bacteria | 1397 |
| 503 | Ga0373931_0000429 | 3300035691 | Bacteria | 17104 |
| 504 | Ga0373931_0001168 | 3300035691 | Bacteria | 11183 |
| 505 | Ga0373931_0001365 | 3300035691 | Bacteria | 10433 |
| 506 | Ga0373927_0164516 | 3300035695 | Bacteria | 1454 |
| 507 | Ga0373937_0201608 | 3300036401 | Bacteria | 1870 |
| 508 | Ga0373925_0046695 | 3300037068 | Bacteria | 3221 |
| 509 | Ga0395905_0008848 | 3300037471 | Bacteria | 9894 |
| 510 | Ga0395905_0015785 | 3300037471 | Bacteria | 7174 |
| 511 | Ga0395905_0242112 | 3300037471 | Bacteria | 1685 |
| 512 | Ga0395901_0004869 | 3300038443 | Bacteria | 13555 |
| 513 | Ga0436365_0394409 | 3300039437 | Bacteria | 916 |
| 514 | Ga0436361_0275830 | 3300039447 | Bacteria | 6564 |
| 515 | Ga0436361_0677882 | 3300039447 | Bacteria | 228834 |
| 516 | Ga0436361_0763381 | 3300039447 | Bacteria | 4734 |
| 517 | Ga0436361_0812713 | 3300039447 | Bacteria | 39089 |
| 518 | Ga0439461_0046392 | 3300041410 | Bacteria | 952 |
| 519 | Ga0451793_1137656 | 3300041452 | Bacteria | 1029 |
| 520 | Ga0451795_0619171 | 3300041456 | Bacteria | 1810 |
| 521 | Ga0451807_2445078 | 3300041486 | Bacteria | 1540 |
| 522 | Ga0451833_0114255 | 3300041491 | Bacteria | 1260 |
| 523 | Ga0451853_3442311 | 3300041512 | Bacteria | 2408 |
| 524 | Ga0439454_003233 | 3300042011 | Bacteria | 1796 |
| 525 | Ga0450917_000073 | 3300042120 | Bacteria | 5647 |
| 526 | Ga0450919_007815 | 3300042121 | Bacteria | 1245 |
| 527 | Ga0450923_013417 | 3300042125 | Bacteria | 1506 |
| 528 | Ga0450890_001264 | 3300042127 | Bacteria | 3662 |
| 529 | Ga0450890_003134 | 3300042127 | Bacteria | 2214 |
| 530 | Ga0450891_000191 | 3300042129 | Bacteria | 5995 |
| 531 | Ga0450889_000610 | 3300042144 | Bacteria | 3971 |
| 532 | Ga0439458_0020111 | 3300042157 | Bacteria | 1541 |
| 533 | Ga0439458_0027396 | 3300042157 | Bacteria | 1344 |
| 534 | Ga0439459_0001224 | 3300042438 | Bacteria | 3755 |
| 535 | Ga0439459_0011217 | 3300042438 | Bacteria | 1577 |
| 536 | Ga0450918_000573 | 3300042531 | Bacteria | 7828 |
| 537 | Ga0451577_0000152 | 3300042876 | Bacteria | 153284 |
| 538 | Ga0451577_0007214 | 3300042876 | Bacteria | 10951 |
| 539 | Ga0451577_0021763 | 3300042876 | Bacteria | 5863 |
| 540 | Ga0466969_0002697 | 3300044656 | Bacteria | 9478 |
| 541 | Ga0466969_0019974 | 3300044656 | Bacteria | 3472 |
| 542 | Ga0466969_0048861 | 3300044656 | Bacteria | 2089 |
| 543 | Ga0466972_0000265 | 3300044658 | Bacteria | 33659 |
| 544 | Ga0466977_0000007 | 3300044666 | Bacteria | 32886 |
| 545 | Ga0466965_0000290 | 3300044683 | Bacteria | 16664 |
| 546 | Ga0466966_0001287 | 3300044684 | Bacteria | 16051 |
| 547 | Ga0466966_0084879 | 3300044684 | Bacteria | 1968 |
| 548 | Ga0466963_0018757 | 3300044694 | Bacteria | 4330 |
| 549 | Ga0466963_0171347 | 3300044694 | Bacteria | 1513 |
| 550 | Ga0466964_0000836 | 3300044706 | Bacteria | 10083 |
| 551 | Ga0466964_0293918 | 3300044706 | Bacteria | 816 |
| 552 | Ga0453684_0000122 | 3300044712 | Bacteria | 340529 |
| 553 | Ga0453684_0064995 | 3300044712 | Bacteria | 4655 |
| 554 | Ga0453684_0074293 | 3300044712 | Bacteria | 4281 |
| 555 | Ga0453684_0198585 | 3300044712 | Bacteria | 2340 |
| 556 | Ga0466971_0000304 | 3300044719 | Bacteria | 18934 |
| 557 | Ga0466968_0006186 | 3300044735 | Bacteria | 4501 |
| 558 | Ga0466968_0009938 | 3300044735 | Bacteria | 3673 |
| 559 | Ga0466970_0000659 | 3300044765 | Bacteria | 16979 |
| 560 | Ga0466970_0008455 | 3300044765 | Bacteria | 5181 |
| 561 | Ga0466957_0001020 | 3300044842 | Bacteria | 14442 |
| 562 | Ga0466959_0001171 | 3300045049 | Bacteria | 15784 |
| 563 | Ga0466959_0002228 | 3300045049 | Bacteria | 12350 |
| 564 | Ga0451576_0000559 | 3300045051 | Bacteria | 79734 |
| 565 | Ga0451576_0074522 | 3300045051 | Bacteria | 3532 |
| 566 | Ga0451576_0103352 | 3300045051 | Bacteria | 2964 |
| 567 | Ga0451576_0126788 | 3300045051 | Bacteria | 2659 |
| 568 | Ga0451576_0333617 | 3300045051 | Bacteria | 1587 |
| 569 | Ga0451576_0483882 | 3300045051 | Bacteria | 1300 |
| 570 | Ga0466958_0015806 | 3300045836 | Bacteria | 4334 |
| 571 | Ga0466958_0157085 | 3300045836 | Bacteria | 1435 |
| 572 | Ga0466967_0033285 | 3300045976 | Bacteria | 4361 |
| 573 | Ga0495629_0007894 | 3300046459 | Bacteria | 7829 |
| 574 | Ga0495638_0087017 | 3300046460 | Bacteria | 1888 |
| 575 | Ga0495650_0000002 | 3300046471 | Bacteria | 1057165 |
| 576 | Ga0495650_0000478 | 3300046471 | Bacteria | 61296 |
| 577 | Ga0495650_0042201 | 3300046471 | Bacteria | 1944 |
| 578 | Ga0495605_0004250 | 3300046474 | Bacteria | 8440 |
| 579 | Ga0495639_0018631 | 3300046475 | Bacteria | 3025 |
| 580 | Ga0495585_0230808 | 3300046492 | Bacteria | 930 |
| 581 | Ga0495594_0007426 | 3300046499 | Bacteria | 5639 |
| 582 | Ga0495596_0000001 | 3300046500 | Bacteria | 501331 |
| 583 | Ga0495607_0000175 | 3300046501 | Bacteria | 68131 |
| 584 | Ga0495583_0000123 | 3300046506 | Bacteria | 131122 |
| 585 | Ga0495606_0001921 | 3300046507 | Bacteria | 25804 |
| 586 | Ga0495606_0216870 | 3300046507 | Bacteria | 1081 |
| 587 | Ga0495610_0000002 | 3300046512 | Bacteria | 1282131 |
| 588 | Ga0495610_0090865 | 3300046512 | Bacteria | 1384 |
| 589 | Ga0495620_0103979 | 3300046515 | Bacteria | 1130 |
| 590 | Ga0495632_0011879 | 3300046519 | Bacteria | 5059 |
| 591 | Ga0495632_0014006 | 3300046519 | Bacteria | 4551 |
| 592 | Ga0495632_0016647 | 3300046519 | Bacteria | 4082 |
| 593 | Ga0495637_0000005 | 3300046520 | Bacteria | 447799 |
| 594 | Ga0495643_0000002 | 3300046522 | Bacteria | 1131278 |
| 595 | Ga0495643_0012023 | 3300046522 | Bacteria | 5238 |
| 596 | Ga0495666_0010876 | 3300046526 | Bacteria | 4537 |
| 597 | Ga0495654_0091466 | 3300046530 | Bacteria | 1411 |
| 598 | Ga0495598_0015441 | 3300046537 | Bacteria | 1929 |
| 599 | Ga0495598_0045602 | 3300046537 | Bacteria | 1300 |
| 600 | Ga0495621_0002970 | 3300046539 | Bacteria | 4625 |
| 601 | Ga0495621_0085259 | 3300046539 | Bacteria | 1183 |
| 602 | Ga0495597_0000015 | 3300046542 | Bacteria | 172952 |
| 603 | Ga0495597_0001359 | 3300046542 | Bacteria | 17738 |
| 604 | Ga0495597_0042619 | 3300046542 | Bacteria | 2023 |
| 605 | Ga0495645_0170854 | 3300046543 | Bacteria | 1497 |
| 606 | Ga0495622_0150409 | 3300046557 | Bacteria | 1053 |
| 607 | Ga0495668_0084528 | 3300046616 | Bacteria | 1740 |
| 608 | Ga0495625_0001732 | 3300046660 | Bacteria | 25240 |
| 609 | Ga0495625_0003731 | 3300046660 | Bacteria | 14831 |
| 610 | Ga0495625_0004458 | 3300046660 | Bacteria | 13233 |
| 611 | Ga0495625_0441550 | 3300046660 | Bacteria | 805 |
| 612 | Ga0495625_0456567 | 3300046660 | Bacteria | 788 |
| 613 | Ga0495658_0080334 | 3300046683 | Bacteria | 1912 |
| 614 | Ga0495670_0214521 | 3300046691 | Bacteria | 1021 |
| 615 | Ga0495671_0001269 | 3300046692 | Bacteria | 17216 |
| 616 | Ga0495671_0280824 | 3300046692 | Bacteria | 802 |
| 617 | Ga0495649_0005186 | 3300046694 | Bacteria | 8347 |
| 618 | Ga0495649_0006920 | 3300046694 | Bacteria | 7013 |
| 619 | Ga0495589_0002708 | 3300046794 | Bacteria | 9794 |
| 620 | Ga0495672_0182064 | 3300047320 | Bacteria | 1063 |
| 621 | Ga0495676_0236226 | 3300047321 | Bacteria | 1253 |
| 622 | Ga0495680_0416232 | 3300047322 | Bacteria | 925 |
| 623 | Ga0495687_002069 | 3300047443 | Bacteria | 16865 |
| 624 | Ga0495673_0094227 | 3300047469 | Bacteria | 1219 |
| 625 | Ga0495681_0000088 | 3300047470 | Bacteria | 79878 |
| 626 | Ga0495681_0000426 | 3300047470 | Bacteria | 32387 |
| 627 | Ga0495686_0000641 | 3300047472 | Bacteria | 48207 |
| 628 | Ga0495686_0065561 | 3300047472 | Bacteria | 2245 |
| 629 | Ga0495686_0138772 | 3300047472 | Bacteria | 1436 |
| 630 | Ga0495593_0079323 | 3300047673 | Bacteria | 1699 |
| 631 | Ga0495626_0000001 | 3300048091 | Bacteria | 1077129 |
| 632 | Ga0495626_0156711 | 3300048091 | Bacteria | 957 |
| 633 | Ga0496101_0072926 | 3300048904 | Bacteria | 2521 |
| 634 | Ga0496102_0015830 | 3300048905 | Bacteria | 6575 |
| 635 | Ga0496103_0150067 | 3300048906 | Bacteria | 1493 |
| 636 | Ga0496104_0071764 | 3300048907 | Bacteria | 3292 |
| 637 | Ga0496107_0004920 | 3300048910 | Bacteria | 9086 |
| 638 | Ga0496108_0028353 | 3300048911 | Bacteria | 4632 |
| 639 | Ga0496108_0065613 | 3300048911 | Bacteria | 3060 |
| 640 | Ga0496108_0075008 | 3300048911 | Bacteria | 2857 |
| 641 | Ga0496108_0358728 | 3300048911 | Bacteria | 1272 |
| 642 | Ga0496109_0184833 | 3300048912 | Bacteria | 1958 |
| 643 | Ga0496109_0185790 | 3300048912 | Bacteria | 1953 |
| 644 | Ga0496109_0235792 | 3300048912 | Bacteria | 1722 |
| 645 | Ga0496110_0008007 | 3300048913 | Bacteria | 8469 |
| 646 | Ga0496110_0697743 | 3300048913 | Bacteria | 916 |
| 647 | Ga0496111_0053758 | 3300048914 | Bacteria | 2910 |
| 648 | Ga0496112_0277599 | 3300048915 | Bacteria | 1623 |
| 649 | Ga0496114_0012468 | 3300048917 | Bacteria | 6804 |
| 650 | Ga0496114_0047847 | 3300048917 | Bacteria | 3557 |
| 651 | Ga0496114_0121229 | 3300048917 | Bacteria | 2249 |
| 652 | Ga0496115_0036144 | 3300048918 | Bacteria | 3910 |
| 653 | Ga0496121_0008194 | 3300048924 | Bacteria | 12405 |
| 654 | Ga0496124_0000344 | 3300048927 | Bacteria | 85082 |
| 655 | Ga0496124_0015117 | 3300048927 | Bacteria | 7419 |
| 656 | Ga0496124_0188253 | 3300048927 | Bacteria | 1582 |
| 657 | Ga0496125_0028418 | 3300048928 | Bacteria | 5052 |
| 658 | Ga0496125_0387021 | 3300048928 | Bacteria | 822 |
| 659 | Ga0501306_010277 | 3300049127 | Bacteria | 1175 |
| 660 | Ga0501308_000125 | 3300049128 | Bacteria | 3817 |
| 661 | Ga0501309_000072 | 3300049129 | Bacteria | 5562 |
| 662 | Ga0501309_002714 | 3300049129 | Bacteria | 1939 |
| 663 | Ga0501310_000166 | 3300049130 | Bacteria | 6374 |
| 664 | Ga0501304_000040 | 3300049160 | Bacteria | 4578 |
| 665 | Ga0495678_002620 | 3300049459 | Bacteria | 11999 |
| 666 | Ga0495682_0077610 | 3300049460 | Bacteria | 1195 |
| 667 | Ga0501312_000083 | 3300049528 | Bacteria | 5552 |
| 668 | Ga0501312_000733 | 3300049528 | Bacteria | 2835 |
| 669 | Ga0501314_004425 | 3300049530 | Bacteria | 1165 |
| 670 | Ga0501320_000886 | 3300049536 | Bacteria | 1965 |
| 671 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 672 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 673 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 674 | Ga0501048_0000091 | 3300049582 | Bacteria | 48347 |
| 675 | Ga0501206_016782 | 3300049653 | Bacteria | 1021 |
| 676 | Ga0501211_000060 | 3300049658 | Bacteria | 7394 |
| 677 | Ga0501222_000573 | 3300049662 | Bacteria | 5416 |
| 678 | Ga0501233_001248 | 3300049668 | Bacteria | 4336 |
| 679 | Ga0501235_005384 | 3300049669 | Bacteria | 2786 |
| 680 | Ga0501236_007587 | 3300049670 | Bacteria | 1360 |
| 681 | Ga0501249_019913 | 3300049679 | Bacteria | 1458 |
| 682 | Ga0501258_000044 | 3300049687 | Bacteria | 6690 |
| 683 | Ga0501229_000386 | 3300049706 | Bacteria | 4951 |
| 684 | Ga0501262_000731 | 3300049759 | Bacteria | 3797 |
| 685 | Ga0501271_002647 | 3300049768 | Bacteria | 1611 |
| 686 | Ga0501272_002879 | 3300049769 | Bacteria | 1724 |
| 687 | Ga0501045_0013429 | 3300049824 | Bacteria | 5786 |
| 688 | nmdc:mga03683_11795_c1 | 3300050489 | Bacteria | 3176 |
| 689 | nmdc:mga03683_26488_c1 | 3300050489 | Bacteria | 2288 |
| 690 | nmdc:mga03n38_10564_c1 | 3300050490 | Bacteria | 3404 |
| 691 | nmdc:mga0k408_18851_c1 | 3300050493 | Bacteria | 3852 |
| 692 | nmdc:mga0k408_251935_c1 | 3300050493 | Bacteria | 1054 |
| 693 | nmdc:mga0k408_2669_c1 | 3300050493 | Bacteria | 9460 |
| 694 | nmdc:mga0k408_2914_c1 | 3300050493 | Bacteria | 9064 |
| 695 | nmdc:mga0k408_309_c2 | 3300050493 | Bacteria | 14319 |
| 696 | nmdc:mga0k408_3267_c1 | 3300050493 | Bacteria | 8579 |
| 697 | nmdc:mga0k408_404264_c1 | 3300050493 | Bacteria | 813 |
| 698 | nmdc:mga0k408_540_c1 | 3300050493 | Bacteria | 20847 |
| 699 | nmdc:mga0k408_79520_c1 | 3300050493 | Bacteria | 1918 |
| 700 | nmdc:mga06z11_22603_c1 | 3300050494 | Bacteria | 2940 |
| 701 | nmdc:mga06z11_335668_c1 | 3300050494 | Bacteria | 903 |
| 702 | nmdc:mga06z11_60609_c1 | 3300050494 | Bacteria | 1971 |
| 703 | nmdc:mga07m45_12293_c1 | 3300050496 | Bacteria | 4521 |
| 704 | nmdc:mga07m45_12332_c1 | 3300050496 | Bacteria | 4515 |
| 705 | nmdc:mga07m45_16204_c1 | 3300050496 | Bacteria | 3990 |
| 706 | nmdc:mga07m45_239_c1 | 3300050496 | Bacteria | 22183 |
| 707 | nmdc:mga07m45_32789_c1 | 3300050496 | Bacteria | 2881 |
| 708 | nmdc:mga07m45_3604_c1 | 3300050496 | Bacteria | 7477 |
| 709 | nmdc:mga07m45_370_c1 | 3300050496 | Bacteria | 18428 |
| 710 | nmdc:mga07m45_41801_c1 | 3300050496 | Bacteria | 2568 |
| 711 | nmdc:mga07m45_7408_c1 | 3300050496 | Bacteria | 5607 |
| 712 | nmdc:mga0sz30_153264_c1 | 3300050516 | Bacteria | 1020 |
| 713 | nmdc:mga0sz30_54366_c1 | 3300050516 | Bacteria | 1703 |
| 714 | Ga0500635_0000187 | 3300053080 | Bacteria | 31687 |
| 715 | Ga0495619_0313064 | 3300053085 | Bacteria | 1087 |
| 716 | Ga0500578_0025540 | 3300053086 | Bacteria | 3789 |
| 717 | Ga0500651_0101228 | 3300053093 | Bacteria | 1766 |
| 718 | Ga0500593_053320 | 3300053117 | Bacteria | 1790 |
| 719 | Ga0500607_143161 | 3300053121 | Bacteria | 1121 |
| 720 | Ga0500652_023850 | 3300053131 | Bacteria | 2330 |
| 721 | Ga0500559_0026005 | 3300053136 | Bacteria | 2491 |
| 722 | Ga0500561_0000912 | 3300053137 | Bacteria | 4722 |
| 723 | Ga0500568_0004552 | 3300053139 | Bacteria | 7395 |
| 724 | Ga0500568_0020559 | 3300053139 | Bacteria | 2853 |
| 725 | Ga0500622_0000874 | 3300053156 | Bacteria | 25654 |
| 726 | Ga0500636_0066706 | 3300053177 | Bacteria | 2092 |
| 727 | Ga0500645_006071 | 3300053730 | Bacteria | 4356 |
| 728 | Ga0500587_003671 | 3300053739 | Bacteria | 2133 |
| 729 | Ga0500661_010132 | 3300055283 | Bacteria | 1718 |
| 730 | Ga0466962_0007408 | 3300061719 | Bacteria | 5266 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046539 | Ga0495621_0085259 | Ga0495621_0085259_16_696 | 195 |
| 2 | 3300009147 | Ga0114129_10241375 | Ga0114129_102413752 | 209 |
| 3 | 3300046537 | Ga0495598_0015441 | Ga0495598_0015441_302_1027 | 209 |
| 4 | 3300053117 | Ga0500593_053320 | Ga0500593_053320_285_1022 | 209 |
| 5 | 3300005445 | Ga0070708_100224098 | Ga0070708_1002240981 | 210 |
| 6 | 3300045051 | Ga0451576_0126788 | Ga0451576_0126788_800_1525 | 218 |
| 7 | 3300035121 | Ga0373960_0072452 | Ga0373960_0072452_376_1056 | 219 |
| 8 | 3300032002 | Ga0307416_100942918 | Ga0307416_1009429181 | 220 |
| 9 | 3300021361 | Ga0213872_10000070 | Ga0213872_1000007064 | 221 |
| 10 | 3300039447 | Ga0436361_0812713 | Ga0436361_0812713_29625_30344 | 221 |
| 11 | 3300049127 | Ga0501306_010277 | Ga0501306_010277_392_1114 | 221 |
| 12 | 3300049528 | Ga0501312_000733 | Ga0501312_000733_1402_2124 | 221 |
| 13 | 3300028794 | Ga0307515_10000165 | Ga0307515_1000016531 | 222 |
| 14 | 3300005456 | Ga0070678_100094551 | Ga0070678_1000945513 | 223 |
| 15 | 3300026121 | Ga0207683_10025099 | Ga0207683_100250994 | 223 |
| 16 | 3300031730 | Ga0307516_10051235 | Ga0307516_100512353 | 223 |
| 17 | 3300039447 | Ga0436361_0763381 | Ga0436361_0763381_2514_3233 | 224 |
| 18 | 3300005364 | Ga0070673_100018847 | Ga0070673_1000188474 | 225 |
| 19 | 3300005548 | Ga0070665_100235654 | Ga0070665_1002356542 | 225 |
| 20 | 3300025960 | Ga0207651_10002160 | Ga0207651_100021604 | 225 |
| 21 | 3300028794 | Ga0307515_10000131 | Ga0307515_1000013141 | 225 |
| 22 | 3300003794 | Ga0055531_10028054 | Ga0055531_100280541 | 226 |
| 23 | 3300005548 | Ga0070665_100340176 | Ga0070665_1003401762 | 226 |
| 24 | 3300025297 | Ga0209758_1000193 | Ga0209758_1000193102 | 226 |
| 25 | 3300028379 | Ga0268266_10259244 | Ga0268266_102592442 | 226 |
| 26 | 3300028379 | Ga0268266_10555972 | Ga0268266_105559722 | 226 |
| 27 | 3300035242 | Ga0373962_0034740 | Ga0373962_0034740_698_1384 | 226 |
| 28 | 3300046507 | Ga0495606_0216870 | Ga0495606_0216870_294_1022 | 226 |
| 29 | 3300053093 | Ga0500651_0101228 | Ga0500651_0101228_293_1024 | 226 |
| 30 | 3300009551 | Ga0105238_10009732 | Ga0105238_100097328 | 227 |
| 31 | 3300010375 | Ga0105239_10000417 | Ga0105239_1000041740 | 227 |
| 32 | 3300039437 | Ga0436365_0394409 | Ga0436365_0394409_111_836 | 227 |
| 33 | 3300047472 | Ga0495686_0000641 | Ga0495686_0000641_14315_15040 | 228 |
| 34 | 3300050493 | nmdc:mga0k408_251935_c1 | nmdc:mga0k408_251935_c1_148_876 | 228 |
| 35 | 3300009093 | Ga0105240_10524014 | Ga0105240_105240142 | 229 |
| 36 | 3300025256 | Ga0209759_1000898 | Ga0209759_10008988 | 229 |
| 37 | 3300025256 | Ga0209759_1037097 | Ga0209759_10370971 | 229 |
| 38 | 3300025909 | Ga0207705_10134771 | Ga0207705_101347712 | 229 |
| 39 | 3300025919 | Ga0207657_10342328 | Ga0207657_103423282 | 229 |
| 40 | 3300025920 | Ga0207649_10112887 | Ga0207649_101128871 | 229 |
| 41 | 3300025932 | Ga0207690_10154917 | Ga0207690_101549172 | 229 |
| 42 | 3300025273 | Ga0209673_1009846 | Ga0209673_10098463 | 230 |
| 43 | 3300048912 | Ga0496109_0235792 | Ga0496109_0235792_64_792 | 230 |
| 44 | 3300002705 | JGI25156J39149_1008311 | JGI25156J39149_10083113 | 231 |
| 45 | 3300003761 | Ga0055535_1000229 | Ga0055535_100022945 | 231 |
| 46 | 3300003763 | Ga0055529_1000064 | Ga0055529_1000064165 | 231 |
| 47 | 3300025242 | Ga0209258_100124 | Ga0209258_10012415 | 231 |
| 48 | 3300025246 | Ga0209646_1016918 | Ga0209646_10169181 | 231 |
| 49 | 3300025256 | Ga0209759_1000652 | Ga0209759_100065220 | 231 |
| 50 | 3300025272 | Ga0209455_1000114 | Ga0209455_1000114165 | 231 |
| 51 | 3300031239 | Ga0265328_10027240 | Ga0265328_100272402 | 231 |
| 52 | 3300031250 | Ga0265331_10091700 | Ga0265331_100917002 | 231 |
| 53 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028113 | 231 |
| 54 | 3300031456 | Ga0307513_10001541 | Ga0307513_1000154118 | 231 |
| 55 | 3300005327 | Ga0070658_10186426 | Ga0070658_101864262 | 232 |
| 56 | 3300005329 | Ga0070683_100049545 | Ga0070683_1000495452 | 232 |
| 57 | 3300005344 | Ga0070661_100471212 | Ga0070661_1004712121 | 232 |
| 58 | 3300005577 | Ga0068857_100445996 | Ga0068857_1004459962 | 232 |
| 59 | 3300005578 | Ga0068854_100022875 | Ga0068854_1000228756 | 232 |
| 60 | 3300005834 | Ga0068851_10100469 | Ga0068851_101004692 | 232 |
| 61 | 3300009551 | Ga0105238_10070600 | Ga0105238_100706002 | 232 |
| 62 | 3300025321 | Ga0207656_10115967 | Ga0207656_101159672 | 232 |
| 63 | 3300025909 | Ga0207705_10174068 | Ga0207705_101740682 | 232 |
| 64 | 3300026078 | Ga0207702_10190137 | Ga0207702_101901372 | 232 |
| 65 | 3300026142 | Ga0207698_10128705 | Ga0207698_101287052 | 232 |
| 66 | 3300033180 | Ga0307510_10007541 | Ga0307510_1000754110 | 232 |
| 67 | 3300044712 | Ga0453684_0064995 | Ga0453684_0064995_880_1605 | 232 |
| 68 | 3300053121 | Ga0500607_143161 | Ga0500607_143161_133_858 | 232 |
| 69 | 3300053131 | Ga0500652_023850 | Ga0500652_023850_707_1432 | 232 |
| 70 | 3300005328 | Ga0070676_10203141 | Ga0070676_102031412 | 233 |
| 71 | 3300005331 | Ga0070670_100164150 | Ga0070670_1001641502 | 233 |
| 72 | 3300005353 | Ga0070669_100012537 | Ga0070669_1000125372 | 233 |
| 73 | 3300005354 | Ga0070675_100067887 | Ga0070675_1000678872 | 233 |
| 74 | 3300005356 | Ga0070674_100010227 | Ga0070674_1000102272 | 233 |
| 75 | 3300005364 | Ga0070673_100027663 | Ga0070673_1000276632 | 233 |
| 76 | 3300005459 | Ga0068867_100036682 | Ga0068867_1000366822 | 233 |
| 77 | 3300005543 | Ga0070672_100007320 | Ga0070672_1000073206 | 233 |
| 78 | 3300009093 | Ga0105240_10015301 | Ga0105240_100153016 | 233 |
| 79 | 3300009545 | Ga0105237_10000441 | Ga0105237_1000044119 | 233 |
| 80 | 3300014326 | Ga0157380_10269980 | Ga0157380_102699802 | 233 |
| 81 | 3300025315 | Ga0207697_10029145 | Ga0207697_100291452 | 233 |
| 82 | 3300025913 | Ga0207695_10024383 | Ga0207695_100243835 | 233 |
| 83 | 3300025914 | Ga0207671_10001929 | Ga0207671_1000192923 | 233 |
| 84 | 3300025923 | Ga0207681_10062794 | Ga0207681_100627942 | 233 |
| 85 | 3300025924 | Ga0207694_10062742 | Ga0207694_100627421 | 233 |
| 86 | 3300025925 | Ga0207650_10072212 | Ga0207650_100722122 | 233 |
| 87 | 3300025926 | Ga0207659_10090565 | Ga0207659_100905652 | 233 |
| 88 | 3300025937 | Ga0207669_10027345 | Ga0207669_100273452 | 233 |
| 89 | 3300025940 | Ga0207691_10006575 | Ga0207691_100065756 | 233 |
| 90 | 3300026095 | Ga0207676_10476828 | Ga0207676_104768282 | 233 |
| 91 | 3300026121 | Ga0207683_10861978 | Ga0207683_108619781 | 233 |
| 92 | 3300044656 | Ga0466969_0002697 | Ga0466969_0002697_4590_5318 | 233 |
| 93 | 3300044683 | Ga0466965_0000290 | Ga0466965_0000290_11764_12492 | 233 |
| 94 | 3300044684 | Ga0466966_0001287 | Ga0466966_0001287_2810_3538 | 233 |
| 95 | 3300044706 | Ga0466964_0000836 | Ga0466964_0000836_4544_5272 | 233 |
| 96 | 3300044719 | Ga0466971_0000304 | Ga0466971_0000304_11551_12279 | 233 |
| 97 | 3300044735 | Ga0466968_0006186 | Ga0466968_0006186_373_1101 | 233 |
| 98 | 3300044765 | Ga0466970_0000659 | Ga0466970_0000659_10250_10978 | 233 |
| 99 | 3300044842 | Ga0466957_0001020 | Ga0466957_0001020_9890_10618 | 233 |
| 100 | 3300045049 | Ga0466959_0002228 | Ga0466959_0002228_823_1551 | 233 |
| 101 | 3300045836 | Ga0466958_0015806 | Ga0466958_0015806_2030_2758 | 233 |
| 102 | 3300046537 | Ga0495598_0045602 | Ga0495598_0045602_23_724 | 233 |
| 103 | 3300046539 | Ga0495621_0002970 | Ga0495621_0002970_796_1521 | 233 |
| 104 | 3300048913 | Ga0496110_0697743 | Ga0496110_0697743_14_715 | 233 |
| 105 | 3300050493 | nmdc:mga0k408_404264_c1 | nmdc:mga0k408_404264_c1_92_802 | 233 |
| 106 | 3300005328 | Ga0070676_10001564 | Ga0070676_100015645 | 234 |
| 107 | 3300005334 | Ga0068869_100032102 | Ga0068869_1000321024 | 234 |
| 108 | 3300005338 | Ga0068868_100015353 | Ga0068868_1000153534 | 234 |
| 109 | 3300005338 | Ga0068868_100150412 | Ga0068868_1001504122 | 234 |
| 110 | 3300005341 | Ga0070691_10093657 | Ga0070691_100936572 | 234 |
| 111 | 3300005347 | Ga0070668_100017395 | Ga0070668_1000173952 | 234 |
| 112 | 3300005353 | Ga0070669_100009995 | Ga0070669_1000099956 | 234 |
| 113 | 3300005354 | Ga0070675_100005126 | Ga0070675_10000512611 | 234 |
| 114 | 3300005354 | Ga0070675_100018606 | Ga0070675_1000186066 | 234 |
| 115 | 3300005355 | Ga0070671_100164531 | Ga0070671_1001645312 | 234 |
| 116 | 3300005455 | Ga0070663_100040338 | Ga0070663_1000403383 | 234 |
| 117 | 3300005456 | Ga0070678_100383983 | Ga0070678_1003839832 | 234 |
| 118 | 3300005457 | Ga0070662_100011606 | Ga0070662_1000116065 | 234 |
| 119 | 3300005459 | Ga0068867_100013500 | Ga0068867_1000135004 | 234 |
| 120 | 3300005459 | Ga0068867_100159120 | Ga0068867_1001591201 | 234 |
| 121 | 3300005535 | Ga0070684_100431796 | Ga0070684_1004317962 | 234 |
| 122 | 3300005563 | Ga0068855_100036949 | Ga0068855_1000369495 | 234 |
| 123 | 3300005614 | Ga0068856_100024851 | Ga0068856_1000248514 | 234 |
| 124 | 3300005616 | Ga0068852_100043701 | Ga0068852_1000437014 | 234 |
| 125 | 3300005618 | Ga0068864_100710494 | Ga0068864_1007104941 | 234 |
| 126 | 3300005719 | Ga0068861_100022301 | Ga0068861_1000223014 | 234 |
| 127 | 3300005842 | Ga0068858_100120280 | Ga0068858_1001202802 | 234 |
| 128 | 3300005843 | Ga0068860_100097662 | Ga0068860_1000976624 | 234 |
| 129 | 3300005844 | Ga0068862_100063807 | Ga0068862_1000638072 | 234 |
| 130 | 3300006358 | Ga0068871_100020051 | Ga0068871_1000200512 | 234 |
| 131 | 3300009098 | Ga0105245_10013187 | Ga0105245_100131874 | 234 |
| 132 | 3300009148 | Ga0105243_10091822 | Ga0105243_100918223 | 234 |
| 133 | 3300010375 | Ga0105239_10081431 | Ga0105239_100814312 | 234 |
| 134 | 3300013102 | Ga0157371_10167673 | Ga0157371_101676732 | 234 |
| 135 | 3300013105 | Ga0157369_10842038 | Ga0157369_108420381 | 234 |
| 136 | 3300013296 | Ga0157374_10029986 | Ga0157374_100299862 | 234 |
| 137 | 3300013306 | Ga0163162_10025537 | Ga0163162_100255373 | 234 |
| 138 | 3300013307 | Ga0157372_10033672 | Ga0157372_100336724 | 234 |
| 139 | 3300013308 | Ga0157375_10226234 | Ga0157375_102262341 | 234 |
| 140 | 3300014325 | Ga0163163_11011645 | Ga0163163_110116451 | 234 |
| 141 | 3300014745 | Ga0157377_10016804 | Ga0157377_100168041 | 234 |
| 142 | 3300014968 | Ga0157379_10019670 | Ga0157379_100196702 | 234 |
| 143 | 3300014969 | Ga0157376_10014494 | Ga0157376_100144942 | 234 |
| 144 | 3300017792 | Ga0163161_10019047 | Ga0163161_100190473 | 234 |
| 145 | 3300021361 | Ga0213872_10000417 | Ga0213872_1000041726 | 234 |
| 146 | 3300025315 | Ga0207697_10101257 | Ga0207697_101012572 | 234 |
| 147 | 3300025893 | Ga0207682_10026607 | Ga0207682_100266073 | 234 |
| 148 | 3300025901 | Ga0207688_10036249 | Ga0207688_100362493 | 234 |
| 149 | 3300025907 | Ga0207645_10001787 | Ga0207645_100017877 | 234 |
| 150 | 3300025919 | Ga0207657_10044064 | Ga0207657_100440642 | 234 |
| 151 | 3300025923 | Ga0207681_10035283 | Ga0207681_100352833 | 234 |
| 152 | 3300025926 | Ga0207659_10020790 | Ga0207659_100207903 | 234 |
| 153 | 3300025927 | Ga0207687_10082878 | Ga0207687_100828783 | 234 |
| 154 | 3300025931 | Ga0207644_10024152 | Ga0207644_100241524 | 234 |
| 155 | 3300025931 | Ga0207644_10368925 | Ga0207644_103689252 | 234 |
| 156 | 3300025933 | Ga0207706_10000993 | Ga0207706_1000099312 | 234 |
| 157 | 3300025935 | Ga0207709_10084466 | Ga0207709_100844662 | 234 |
| 158 | 3300025941 | Ga0207711_10005046 | Ga0207711_1000504612 | 234 |
| 159 | 3300025942 | Ga0207689_10000855 | Ga0207689_1000085524 | 234 |
| 160 | 3300025945 | Ga0207679_10453235 | Ga0207679_104532351 | 234 |
| 161 | 3300025949 | Ga0207667_10159584 | Ga0207667_101595842 | 234 |
| 162 | 3300026023 | Ga0207677_10017341 | Ga0207677_100173412 | 234 |
| 163 | 3300026023 | Ga0207677_10158644 | Ga0207677_101586442 | 234 |
| 164 | 3300026035 | Ga0207703_10246180 | Ga0207703_102461802 | 234 |
| 165 | 3300026041 | Ga0207639_10015071 | Ga0207639_100150714 | 234 |
| 166 | 3300026067 | Ga0207678_10023385 | Ga0207678_100233853 | 234 |
| 167 | 3300026078 | Ga0207702_10047997 | Ga0207702_100479975 | 234 |
| 168 | 3300026089 | Ga0207648_10040097 | Ga0207648_100400972 | 234 |
| 169 | 3300026116 | Ga0207674_10026355 | Ga0207674_100263552 | 234 |
| 170 | 3300026116 | Ga0207674_10112313 | Ga0207674_101123132 | 234 |
| 171 | 3300026118 | Ga0207675_100000911 | Ga0207675_10000091124 | 234 |
| 172 | 3300026121 | Ga0207683_10247414 | Ga0207683_102474142 | 234 |
| 173 | 3300026142 | Ga0207698_10006990 | Ga0207698_100069903 | 234 |
| 174 | 3300028380 | Ga0268265_10158640 | Ga0268265_101586402 | 234 |
| 175 | 3300028381 | Ga0268264_10223286 | Ga0268264_102232863 | 234 |
| 176 | 3300034820 | Ga0373959_0040877 | Ga0373959_0040877_10_735 | 234 |
| 177 | 3300035112 | Ga0373932_0116696 | Ga0373932_0116696_121_846 | 234 |
| 178 | 3300035242 | Ga0373962_0010650 | Ga0373962_0010650_1050_1775 | 234 |
| 179 | 3300035691 | Ga0373931_0001365 | Ga0373931_0001365_4463_5188 | 234 |
| 180 | 3300039447 | Ga0436361_0275830 | Ga0436361_0275830_4882_5616 | 234 |
| 181 | 3300045051 | Ga0451576_0103352 | Ga0451576_0103352_145_870 | 234 |
| 182 | 3300045051 | Ga0451576_0483882 | Ga0451576_0483882_70_798 | 234 |
| 183 | 3300048904 | Ga0496101_0072926 | Ga0496101_0072926_887_1612 | 234 |
| 184 | 3300048910 | Ga0496107_0004920 | Ga0496107_0004920_4159_4884 | 234 |
| 185 | 3300048911 | Ga0496108_0028353 | Ga0496108_0028353_3783_4508 | 234 |
| 186 | 3300048912 | Ga0496109_0184833 | Ga0496109_0184833_571_1296 | 234 |
| 187 | 3300048913 | Ga0496110_0008007 | Ga0496110_0008007_1887_2612 | 234 |
| 188 | 3300048914 | Ga0496111_0053758 | Ga0496111_0053758_30_755 | 234 |
| 189 | 3300048915 | Ga0496112_0277599 | Ga0496112_0277599_415_1140 | 234 |
| 190 | 3300048917 | Ga0496114_0047847 | Ga0496114_0047847_2344_3069 | 234 |
| 191 | 3300048918 | Ga0496115_0036144 | Ga0496115_0036144_887_1612 | 234 |
| 192 | 3300003323 | rootH1_10031598 | rootH1_100315982 | 235 |
| 193 | 3300013296 | Ga0157374_10707214 | Ga0157374_107072141 | 235 |
| 194 | 3300035691 | Ga0373931_0001168 | Ga0373931_0001168_3553_4281 | 235 |
| 195 | 3300046512 | Ga0495610_0090865 | Ga0495610_0090865_422_1147 | 235 |
| 196 | 3300046519 | Ga0495632_0011879 | Ga0495632_0011879_1854_2579 | 235 |
| 197 | 3300046660 | Ga0495625_0456567 | Ga0495625_0456567_42_767 | 235 |
| 198 | 3300046694 | Ga0495649_0005186 | Ga0495649_0005186_6124_6849 | 235 |
| 199 | 3300048091 | Ga0495626_0156711 | Ga0495626_0156711_180_905 | 235 |
| 200 | 3300049460 | Ga0495682_0077610 | Ga0495682_0077610_372_1097 | 235 |
| 201 | 3300053080 | Ga0500635_0000187 | Ga0500635_0000187_19719_20444 | 236 |
| 202 | iso_pu_bacteria | 2721755763 | 2723879822 | 236 |
| 203 | iso_pu_bacteria | 2585428062 | 2587756219 | 237 |
| 204 | iso_pu_bacteria | 2643221544 | 2643746401 | 237 |
| 205 | iso_pu_bacteria | 2643221585 | 2643933122 | 237 |
| 206 | iso_pu_bacteria | 2643221639 | 2644217265 | 237 |
| 207 | iso_pu_bacteria | 2643221644 | 2644243740 | 237 |
| 208 | iso_pu_bacteria | 2643221646 | 2644258966 | 237 |
| 209 | iso_pu_bacteria | 2643221654 | 2644301795 | 237 |
| 210 | iso_pu_bacteria | 2643221656 | 2644314371 | 237 |
| 211 | iso_pu_bacteria | 2643221660 | 2644338730 | 237 |
| 212 | iso_pu_bacteria | 2738541337 | 2739055700 | 237 |
| 213 | iso_pu_bacteria | 2831864461 | 2831866170 | 237 |
| 214 | iso_pu_bacteria | 2886848708 | 2886852453 | 237 |
| 215 | 3300009177 | Ga0105248_10022270 | Ga0105248_1002227010 | 238 |
| 216 | 3300013297 | Ga0157378_10501530 | Ga0157378_105015302 | 238 |
| 217 | 3300025304 | Ga0209257_1060265 | Ga0209257_10602652 | 238 |
| 218 | 3300041456 | Ga0451795_0619171 | Ga0451795_0619171_134_859 | 238 |
| 219 | 3300047472 | Ga0495686_0138772 | Ga0495686_0138772_628_1344 | 238 |
| 220 | 3300048906 | Ga0496103_0150067 | Ga0496103_0150067_521_1237 | 238 |
| 221 | 3300048907 | Ga0496104_0071764 | Ga0496104_0071764_1250_1966 | 238 |
| 222 | 3300048911 | Ga0496108_0065613 | Ga0496108_0065613_1937_2653 | 238 |
| 223 | 3300048912 | Ga0496109_0185790 | Ga0496109_0185790_168_884 | 238 |
| 224 | 3300053086 | Ga0500578_0025540 | Ga0500578_0025540_1844_2560 | 238 |
| 225 | 3300053730 | Ga0500645_006071 | Ga0500645_006071_1267_1983 | 238 |
| 226 | 3300044656 | Ga0466969_0019974 | Ga0466969_0019974_705_1448 | 239 |
| 227 | 3300044666 | Ga0466977_0000007 | Ga0466977_0000007_1369_2112 | 239 |
| 228 | 3300046471 | Ga0495650_0000002 | Ga0495650_0000002_563347_564093 | 239 |
| 229 | 3300046512 | Ga0495610_0000002 | Ga0495610_0000002_207177_207923 | 239 |
| 230 | 3300046520 | Ga0495637_0000005 | Ga0495637_0000005_202961_203707 | 239 |
| 231 | 3300046522 | Ga0495643_0000002 | Ga0495643_0000002_220484_221230 | 239 |
| 232 | 3300046542 | Ga0495597_0000015 | Ga0495597_0000015_68042_68788 | 239 |
| 233 | 3300046660 | Ga0495625_0004458 | Ga0495625_0004458_3325_4071 | 239 |
| 234 | 3300046692 | Ga0495671_0001269 | Ga0495671_0001269_12556_13302 | 239 |
| 235 | 3300047469 | Ga0495673_0094227 | Ga0495673_0094227_202_948 | 239 |
| 236 | 3300047470 | Ga0495681_0000088 | Ga0495681_0000088_28990_29736 | 239 |
| 237 | 3300047472 | Ga0495686_0065561 | Ga0495686_0065561_423_1169 | 239 |
| 238 | 3300049459 | Ga0495678_002620 | Ga0495678_002620_560_1306 | 239 |
| 239 | 3300006195 | Ga0075366_10029844 | Ga0075366_100298444 | 240 |
| 240 | 3300032002 | Ga0307416_100078114 | Ga0307416_1000781141 | 240 |
| 241 | 3300032005 | Ga0307411_10392620 | Ga0307411_103926201 | 240 |
| 242 | 3300046471 | Ga0495650_0000478 | Ga0495650_0000478_42096_42848 | 240 |
| 243 | 3300046474 | Ga0495605_0004250 | Ga0495605_0004250_4647_5399 | 240 |
| 244 | 3300046499 | Ga0495594_0007426 | Ga0495594_0007426_3614_4366 | 240 |
| 245 | 3300046500 | Ga0495596_0000001 | Ga0495596_0000001_4331_5083 | 240 |
| 246 | 3300046501 | Ga0495607_0000175 | Ga0495607_0000175_54046_54798 | 240 |
| 247 | 3300046519 | Ga0495632_0014006 | Ga0495632_0014006_1588_2340 | 240 |
| 248 | 3300046526 | Ga0495666_0010876 | Ga0495666_0010876_999_1751 | 240 |
| 249 | 3300046530 | Ga0495654_0091466 | Ga0495654_0091466_633_1385 | 240 |
| 250 | 3300046542 | Ga0495597_0001359 | Ga0495597_0001359_10389_11141 | 240 |
| 251 | 3300047320 | Ga0495672_0182064 | Ga0495672_0182064_117_869 | 240 |
| 252 | 3300047470 | Ga0495681_0000426 | Ga0495681_0000426_19942_20694 | 240 |
| 253 | 3300048091 | Ga0495626_0000001 | Ga0495626_0000001_374443_375195 | 240 |
| 254 | 3300049653 | Ga0501206_016782 | Ga0501206_016782_266_988 | 240 |
| 255 | 3300050493 | nmdc:mga0k408_18851_c1 | nmdc:mga0k408_18851_c1_1791_2513 | 240 |
| 256 | 3300002705 | JGI25156J39149_1000819 | JGI25156J39149_10008191 | 241 |
| 257 | 3300002738 | JGI25154J39366_1000824 | JGI25154J39366_10008246 | 241 |
| 258 | 3300002741 | JGI25157J39369_1000027 | JGI25157J39369_1000027108 | 241 |
| 259 | 3300002772 | JGI25164J39214_1003672 | JGI25164J39214_10036722 | 241 |
| 260 | 3300002773 | JGI25152J39213_1001390 | JGI25152J39213_10013905 | 241 |
| 261 | 3300002774 | JGI25150J39212_1012465 | JGI25150J39212_10124651 | 241 |
| 262 | 3300003215 | JGI25153J46596_10003685 | JGI25153J46596_100036858 | 241 |
| 263 | 3300003316 | rootH1_10004916 | rootH1_100049162 | 241 |
| 264 | 3300003316 | rootH1_10006365 | rootH1_1000636511 | 241 |
| 265 | 3300003320 | rootH2_10047071 | rootH2_100470714 | 241 |
| 266 | 3300003322 | rootL2_10003861 | rootL2_1000386118 | 241 |
| 267 | 3300003322 | rootL2_10009273 | rootL2_1000927320 | 241 |
| 268 | 3300003323 | rootH1_10006621 | rootH1_100066215 | 241 |
| 269 | 3300003323 | rootH1_10019349 | rootH1_1001934910 | 241 |
| 270 | 3300003323 | rootH1_10027533 | rootH1_100275334 | 241 |
| 271 | 3300003752 | Ga0055539_1004569 | Ga0055539_10045691 | 241 |
| 272 | 3300003752 | Ga0055539_1004861 | Ga0055539_10048611 | 241 |
| 273 | 3300003756 | Ga0055533_1000073 | Ga0055533_1000073120 | 241 |
| 274 | 3300003759 | Ga0055525_1000038 | Ga0055525_1000038106 | 241 |
| 275 | 3300003759 | Ga0055525_1000687 | Ga0055525_10006874 | 241 |
| 276 | 3300003771 | Ga0055526_1002388 | Ga0055526_10023887 | 241 |
| 277 | 3300003791 | Ga0055530_10029662 | Ga0055530_100296622 | 241 |
| 278 | 3300003792 | Ga0055540_1009954 | Ga0055540_10099543 | 241 |
| 279 | 3300003792 | Ga0055540_1024456 | Ga0055540_10244562 | 241 |
| 280 | 3300003794 | Ga0055531_10003179 | Ga0055531_100031796 | 241 |
| 281 | 3300004625 | Ga0055543_1002234 | Ga0055543_10022342 | 241 |
| 282 | 3300004625 | Ga0055543_1013363 | Ga0055543_10133631 | 241 |
| 283 | 3300005262 | Ga0065165_1000283 | Ga0065165_100028332 | 241 |
| 284 | 3300005327 | Ga0070658_10112110 | Ga0070658_101121102 | 241 |
| 285 | 3300005327 | Ga0070658_10162910 | Ga0070658_101629101 | 241 |
| 286 | 3300005327 | Ga0070658_10336633 | Ga0070658_103366332 | 241 |
| 287 | 3300005327 | Ga0070658_10386740 | Ga0070658_103867402 | 241 |
| 288 | 3300005328 | Ga0070676_10008248 | Ga0070676_100082484 | 241 |
| 289 | 3300005328 | Ga0070676_10021053 | Ga0070676_100210532 | 241 |
| 290 | 3300005331 | Ga0070670_100058457 | Ga0070670_1000584572 | 241 |
| 291 | 3300005331 | Ga0070670_100078920 | Ga0070670_1000789202 | 241 |
| 292 | 3300005334 | Ga0068869_100006946 | Ga0068869_1000069465 | 241 |
| 293 | 3300005335 | Ga0070666_10010360 | Ga0070666_100103603 | 241 |
| 294 | 3300005337 | Ga0070682_100011477 | Ga0070682_1000114772 | 241 |
| 295 | 3300005344 | Ga0070661_100000220 | Ga0070661_10000022041 | 241 |
| 296 | 3300005344 | Ga0070661_100122816 | Ga0070661_1001228161 | 241 |
| 297 | 3300005347 | Ga0070668_100404298 | Ga0070668_1004042982 | 241 |
| 298 | 3300005354 | Ga0070675_100065579 | Ga0070675_1000655792 | 241 |
| 299 | 3300005354 | Ga0070675_100085117 | Ga0070675_1000851172 | 241 |
| 300 | 3300005354 | Ga0070675_100235705 | Ga0070675_1002357051 | 241 |
| 301 | 3300005355 | Ga0070671_100027816 | Ga0070671_1000278164 | 241 |
| 302 | 3300005356 | Ga0070674_100015369 | Ga0070674_1000153692 | 241 |
| 303 | 3300005356 | Ga0070674_100034505 | Ga0070674_1000345053 | 241 |
| 304 | 3300005364 | Ga0070673_100007297 | Ga0070673_1000072972 | 241 |
| 305 | 3300005365 | Ga0070688_100323478 | Ga0070688_1003234782 | 241 |
| 306 | 3300005366 | Ga0070659_100011721 | Ga0070659_1000117215 | 241 |
| 307 | 3300005366 | Ga0070659_100279317 | Ga0070659_1002793172 | 241 |
| 308 | 3300005366 | Ga0070659_100541699 | Ga0070659_1005416991 | 241 |
| 309 | 3300005367 | Ga0070667_100015900 | Ga0070667_1000159007 | 241 |
| 310 | 3300005367 | Ga0070667_100413156 | Ga0070667_1004131561 | 241 |
| 311 | 3300005367 | Ga0070667_100644164 | Ga0070667_1006441641 | 241 |
| 312 | 3300005441 | Ga0070700_100072194 | Ga0070700_1000721941 | 241 |
| 313 | 3300005455 | Ga0070663_100000511 | Ga0070663_10000051112 | 241 |
| 314 | 3300005455 | Ga0070663_100047246 | Ga0070663_1000472463 | 241 |
| 315 | 3300005455 | Ga0070663_100147313 | Ga0070663_1001473132 | 241 |
| 316 | 3300005456 | Ga0070678_100299788 | Ga0070678_1002997882 | 241 |
| 317 | 3300005457 | Ga0070662_100025773 | Ga0070662_1000257733 | 241 |
| 318 | 3300005457 | Ga0070662_100059050 | Ga0070662_1000590502 | 241 |
| 319 | 3300005457 | Ga0070662_100075848 | Ga0070662_1000758482 | 241 |
| 320 | 3300005457 | Ga0070662_100162304 | Ga0070662_1001623041 | 241 |
| 321 | 3300005457 | Ga0070662_100179951 | Ga0070662_1001799511 | 241 |
| 322 | 3300005457 | Ga0070662_100182899 | Ga0070662_1001828992 | 241 |
| 323 | 3300005458 | Ga0070681_10803284 | Ga0070681_108032841 | 241 |
| 324 | 3300005459 | Ga0068867_100000790 | Ga0068867_10000079010 | 241 |
| 325 | 3300005459 | Ga0068867_100026443 | Ga0068867_1000264432 | 241 |
| 326 | 3300005459 | Ga0068867_100052050 | Ga0068867_1000520501 | 241 |
| 327 | 3300005467 | Ga0070706_100006257 | Ga0070706_10000625714 | 241 |
| 328 | 3300005467 | Ga0070706_100091805 | Ga0070706_1000918052 | 241 |
| 329 | 3300005471 | Ga0070698_100147344 | Ga0070698_1001473442 | 241 |
| 330 | 3300005518 | Ga0070699_100039909 | Ga0070699_1000399093 | 241 |
| 331 | 3300005535 | Ga0070684_100184945 | Ga0070684_1001849451 | 241 |
| 332 | 3300005539 | Ga0068853_100054053 | Ga0068853_1000540531 | 241 |
| 333 | 3300005543 | Ga0070672_100025782 | Ga0070672_1000257823 | 241 |
| 334 | 3300005543 | Ga0070672_100077068 | Ga0070672_1000770682 | 241 |
| 335 | 3300005543 | Ga0070672_100201268 | Ga0070672_1002012682 | 241 |
| 336 | 3300005543 | Ga0070672_100248257 | Ga0070672_1002482572 | 241 |
| 337 | 3300005548 | Ga0070665_100593165 | Ga0070665_1005931651 | 241 |
| 338 | 3300005549 | Ga0070704_100738292 | Ga0070704_1007382921 | 241 |
| 339 | 3300005563 | Ga0068855_100232839 | Ga0068855_1002328392 | 241 |
| 340 | 3300005563 | Ga0068855_100234373 | Ga0068855_1002343732 | 241 |
| 341 | 3300005563 | Ga0068855_100804494 | Ga0068855_1008044941 | 241 |
| 342 | 3300005564 | Ga0070664_100000267 | Ga0070664_10000026731 | 241 |
| 343 | 3300005577 | Ga0068857_100029449 | Ga0068857_1000294492 | 241 |
| 344 | 3300005577 | Ga0068857_100095589 | Ga0068857_1000955893 | 241 |
| 345 | 3300005578 | Ga0068854_100024167 | Ga0068854_1000241672 | 241 |
| 346 | 3300005614 | Ga0068856_100002053 | Ga0068856_10000205310 | 241 |
| 347 | 3300005614 | Ga0068856_100341809 | Ga0068856_1003418092 | 241 |
| 348 | 3300005616 | Ga0068852_100056636 | Ga0068852_1000566362 | 241 |
| 349 | 3300005616 | Ga0068852_100093722 | Ga0068852_1000937223 | 241 |
| 350 | 3300005616 | Ga0068852_100142284 | Ga0068852_1001422842 | 241 |
| 351 | 3300005616 | Ga0068852_100216417 | Ga0068852_1002164172 | 241 |
| 352 | 3300005616 | Ga0068852_100356599 | Ga0068852_1003565992 | 241 |
| 353 | 3300005616 | Ga0068852_100679484 | Ga0068852_1006794841 | 241 |
| 354 | 3300005617 | Ga0068859_100106772 | Ga0068859_1001067723 | 241 |
| 355 | 3300005617 | Ga0068859_100108883 | Ga0068859_1001088832 | 241 |
| 356 | 3300005618 | Ga0068864_100060031 | Ga0068864_1000600313 | 241 |
| 357 | 3300005618 | Ga0068864_100219491 | Ga0068864_1002194912 | 241 |
| 358 | 3300005618 | Ga0068864_100421101 | Ga0068864_1004211011 | 241 |
| 359 | 3300005718 | Ga0068866_10110123 | Ga0068866_101101232 | 241 |
| 360 | 3300005719 | Ga0068861_100015673 | Ga0068861_1000156734 | 241 |
| 361 | 3300005719 | Ga0068861_100022104 | Ga0068861_1000221043 | 241 |
| 362 | 3300005834 | Ga0068851_10037386 | Ga0068851_100373862 | 241 |
| 363 | 3300005840 | Ga0068870_10267380 | Ga0068870_102673801 | 241 |
| 364 | 3300005841 | Ga0068863_100049597 | Ga0068863_1000495973 | 241 |
| 365 | 3300005842 | Ga0068858_100006620 | Ga0068858_10000662014 | 241 |
| 366 | 3300005843 | Ga0068860_100172086 | Ga0068860_1001720862 | 241 |
| 367 | 3300005844 | Ga0068862_100228663 | Ga0068862_1002286632 | 241 |
| 368 | 3300006048 | Ga0075363_100038359 | Ga0075363_1000383592 | 241 |
| 369 | 3300006051 | Ga0075364_10053170 | Ga0075364_100531702 | 241 |
| 370 | 3300006177 | Ga0075362_10012284 | Ga0075362_100122842 | 241 |
| 371 | 3300006177 | Ga0075362_10028110 | Ga0075362_100281102 | 241 |
| 372 | 3300006178 | Ga0075367_10002209 | Ga0075367_100022093 | 241 |
| 373 | 3300006178 | Ga0075367_10088704 | Ga0075367_100887042 | 241 |
| 374 | 3300006186 | Ga0075369_10023004 | Ga0075369_100230042 | 241 |
| 375 | 3300006195 | Ga0075366_10007775 | Ga0075366_100077751 | 241 |
| 376 | 3300006195 | Ga0075366_10013362 | Ga0075366_100133626 | 241 |
| 377 | 3300006195 | Ga0075366_10078048 | Ga0075366_100780482 | 241 |
| 378 | 3300006195 | Ga0075366_10086045 | Ga0075366_100860452 | 241 |
| 379 | 3300006195 | Ga0075366_10134156 | Ga0075366_101341562 | 241 |
| 380 | 3300006195 | Ga0075366_10356339 | Ga0075366_103563392 | 241 |
| 381 | 3300006237 | Ga0097621_100168995 | Ga0097621_1001689952 | 241 |
| 382 | 3300006353 | Ga0075370_10000201 | Ga0075370_1000020127 | 241 |
| 383 | 3300006353 | Ga0075370_10001234 | Ga0075370_100012344 | 241 |
| 384 | 3300006353 | Ga0075370_10003435 | Ga0075370_100034352 | 241 |
| 385 | 3300006353 | Ga0075370_10009591 | Ga0075370_100095912 | 241 |
| 386 | 3300006353 | Ga0075370_10010256 | Ga0075370_100102564 | 241 |
| 387 | 3300006353 | Ga0075370_10029300 | Ga0075370_100293003 | 241 |
| 388 | 3300006353 | Ga0075370_10034024 | Ga0075370_100340243 | 241 |
| 389 | 3300006353 | Ga0075370_10044650 | Ga0075370_100446502 | 241 |
| 390 | 3300006353 | Ga0075370_10044825 | Ga0075370_100448252 | 241 |
| 391 | 3300006358 | Ga0068871_100081992 | Ga0068871_1000819922 | 241 |
| 392 | 3300006881 | Ga0068865_100014886 | Ga0068865_1000148862 | 241 |
| 393 | 3300006881 | Ga0068865_100221348 | Ga0068865_1002213481 | 241 |
| 394 | 3300006931 | Ga0097620_100106761 | Ga0097620_1001067613 | 241 |
| 395 | 3300006931 | Ga0097620_100108885 | Ga0097620_1001088852 | 241 |
| 396 | 3300006944 | Ga0099823_1000083 | Ga0099823_100008317 | 241 |
| 397 | 3300006946 | Ga0079104_1000013 | Ga0079104_100001318 | 241 |
| 398 | 3300009093 | Ga0105240_10118894 | Ga0105240_101188942 | 241 |
| 399 | 3300009098 | Ga0105245_10228508 | Ga0105245_102285082 | 241 |
| 400 | 3300009098 | Ga0105245_10470397 | Ga0105245_104703972 | 241 |
| 401 | 3300009148 | Ga0105243_10002845 | Ga0105243_1000284510 | 241 |
| 402 | 3300009148 | Ga0105243_10004374 | Ga0105243_100043742 | 241 |
| 403 | 3300009148 | Ga0105243_10010965 | Ga0105243_100109652 | 241 |
| 404 | 3300009148 | Ga0105243_10078629 | Ga0105243_100786293 | 241 |
| 405 | 3300009148 | Ga0105243_10120701 | Ga0105243_101207012 | 241 |
| 406 | 3300009148 | Ga0105243_10124756 | Ga0105243_101247562 | 241 |
| 407 | 3300009176 | Ga0105242_10313640 | Ga0105242_103136402 | 241 |
| 408 | 3300009176 | Ga0105242_10351715 | Ga0105242_103517152 | 241 |
| 409 | 3300009176 | Ga0105242_10726124 | Ga0105242_107261241 | 241 |
| 410 | 3300009177 | Ga0105248_10095190 | Ga0105248_100951901 | 241 |
| 411 | 3300009177 | Ga0105248_10124017 | Ga0105248_101240173 | 241 |
| 412 | 3300009545 | Ga0105237_10005851 | Ga0105237_1000585113 | 241 |
| 413 | 3300009551 | Ga0105238_10171909 | Ga0105238_101719092 | 241 |
| 414 | 3300009553 | Ga0105249_10029198 | Ga0105249_100291984 | 241 |
| 415 | 3300010375 | Ga0105239_10037957 | Ga0105239_100379572 | 241 |
| 416 | 3300010375 | Ga0105239_10083030 | Ga0105239_100830303 | 241 |
| 417 | 3300010375 | Ga0105239_10239407 | Ga0105239_102394072 | 241 |
| 418 | 3300011119 | Ga0105246_10115928 | Ga0105246_101159282 | 241 |
| 419 | 3300012497 | Ga0157319_1000037 | Ga0157319_10000372 | 241 |
| 420 | 3300013105 | Ga0157369_10028648 | Ga0157369_100286486 | 241 |
| 421 | 3300013296 | Ga0157374_10524788 | Ga0157374_105247881 | 241 |
| 422 | 3300013297 | Ga0157378_10095407 | Ga0157378_100954073 | 241 |
| 423 | 3300013297 | Ga0157378_10208963 | Ga0157378_102089633 | 241 |
| 424 | 3300013306 | Ga0163162_10065803 | Ga0163162_100658033 | 241 |
| 425 | 3300013306 | Ga0163162_10939741 | Ga0163162_109397411 | 241 |
| 426 | 3300013308 | Ga0157375_10196704 | Ga0157375_101967042 | 241 |
| 427 | 3300013308 | Ga0157375_11210744 | Ga0157375_112107441 | 241 |
| 428 | 3300014745 | Ga0157377_10000091 | Ga0157377_1000009154 | 241 |
| 429 | 3300014745 | Ga0157377_10198369 | Ga0157377_101983691 | 241 |
| 430 | 3300014968 | Ga0157379_10048077 | Ga0157379_100480774 | 241 |
| 431 | 3300014968 | Ga0157379_10257130 | Ga0157379_102571302 | 241 |
| 432 | 3300014968 | Ga0157379_10446633 | Ga0157379_104466332 | 241 |
| 433 | 3300014969 | Ga0157376_10325280 | Ga0157376_103252802 | 241 |
| 434 | 3300014969 | Ga0157376_10494306 | Ga0157376_104943061 | 241 |
| 435 | 3300017792 | Ga0163161_10031397 | Ga0163161_100313975 | 241 |
| 436 | 3300021361 | Ga0213872_10000018 | Ga0213872_1000001877 | 241 |
| 437 | 3300025226 | Ga0209674_100039 | Ga0209674_100039312 | 241 |
| 438 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051166 | 241 |
| 439 | 3300025230 | Ga0209563_100110 | Ga0209563_10011018 | 241 |
| 440 | 3300025231 | Ga0207427_101215 | Ga0207427_1012152 | 241 |
| 441 | 3300025242 | Ga0209258_105648 | Ga0209258_1056483 | 241 |
| 442 | 3300025245 | Ga0207425_1000333 | Ga0207425_100033317 | 241 |
| 443 | 3300025246 | Ga0209646_1000196 | Ga0209646_100019634 | 241 |
| 444 | 3300025250 | Ga0209026_1000011 | Ga0209026_100001139 | 241 |
| 445 | 3300025253 | Ga0209677_100151 | Ga0209677_10015123 | 241 |
| 446 | 3300025253 | Ga0209677_100488 | Ga0209677_1004882 | 241 |
| 447 | 3300025253 | Ga0209677_100877 | Ga0209677_10087710 | 241 |
| 448 | 3300025256 | Ga0209759_1000107 | Ga0209759_100010739 | 241 |
| 449 | 3300025256 | Ga0209759_1019767 | Ga0209759_10197672 | 241 |
| 450 | 3300025258 | Ga0209129_1000027 | Ga0209129_1000027314 | 241 |
| 451 | 3300025291 | Ga0209675_1019509 | Ga0209675_10195091 | 241 |
| 452 | 3300025295 | Ga0209564_1000003 | Ga0209564_1000003344 | 241 |
| 453 | 3300025295 | Ga0209564_1000014 | Ga0209564_1000014468 | 241 |
| 454 | 3300025297 | Ga0209758_1000208 | Ga0209758_100020823 | 241 |
| 455 | 3300025298 | Ga0209050_1008652 | Ga0209050_10086523 | 241 |
| 456 | 3300025299 | Ga0209256_1000130 | Ga0209256_1000130135 | 241 |
| 457 | 3300025299 | Ga0209256_1000471 | Ga0209256_100047117 | 241 |
| 458 | 3300025303 | Ga0209051_1001932 | Ga0209051_10019327 | 241 |
| 459 | 3300025303 | Ga0209051_1002398 | Ga0209051_100239815 | 241 |
| 460 | 3300025303 | Ga0209051_1006338 | Ga0209051_10063385 | 241 |
| 461 | 3300025303 | Ga0209051_1009233 | Ga0209051_10092335 | 241 |
| 462 | 3300025304 | Ga0209257_1000049 | Ga0209257_100004916 | 241 |
| 463 | 3300025304 | Ga0209257_1001013 | Ga0209257_100101327 | 241 |
| 464 | 3300025304 | Ga0209257_1001664 | Ga0209257_100166415 | 241 |
| 465 | 3300025315 | Ga0207697_10024132 | Ga0207697_100241323 | 241 |
| 466 | 3300025321 | Ga0207656_10088785 | Ga0207656_100887852 | 241 |
| 467 | 3300025893 | Ga0207682_10022146 | Ga0207682_100221463 | 241 |
| 468 | 3300025893 | Ga0207682_10081982 | Ga0207682_100819822 | 241 |
| 469 | 3300025901 | Ga0207688_10030413 | Ga0207688_100304132 | 241 |
| 470 | 3300025901 | Ga0207688_10095062 | Ga0207688_100950621 | 241 |
| 471 | 3300025903 | Ga0207680_10456126 | Ga0207680_104561261 | 241 |
| 472 | 3300025907 | Ga0207645_10008457 | Ga0207645_100084574 | 241 |
| 473 | 3300025907 | Ga0207645_10014732 | Ga0207645_100147322 | 241 |
| 474 | 3300025907 | Ga0207645_10110772 | Ga0207645_101107722 | 241 |
| 475 | 3300025908 | Ga0207643_10082044 | Ga0207643_100820443 | 241 |
| 476 | 3300025908 | Ga0207643_10335907 | Ga0207643_103359071 | 241 |
| 477 | 3300025908 | Ga0207643_10492395 | Ga0207643_104923951 | 241 |
| 478 | 3300025909 | Ga0207705_10126816 | Ga0207705_101268162 | 241 |
| 479 | 3300025909 | Ga0207705_10439247 | Ga0207705_104392471 | 241 |
| 480 | 3300025910 | Ga0207684_10041453 | Ga0207684_100414535 | 241 |
| 481 | 3300025911 | Ga0207654_10019687 | Ga0207654_100196872 | 241 |
| 482 | 3300025913 | Ga0207695_10023628 | Ga0207695_100236286 | 241 |
| 483 | 3300025913 | Ga0207695_10731186 | Ga0207695_107311861 | 241 |
| 484 | 3300025914 | Ga0207671_10045543 | Ga0207671_100455432 | 241 |
| 485 | 3300025919 | Ga0207657_10127028 | Ga0207657_101270281 | 241 |
| 486 | 3300025920 | Ga0207649_10001581 | Ga0207649_1000158116 | 241 |
| 487 | 3300025920 | Ga0207649_10079481 | Ga0207649_100794812 | 241 |
| 488 | 3300025923 | Ga0207681_10000974 | Ga0207681_100009746 | 241 |
| 489 | 3300025924 | Ga0207694_10106435 | Ga0207694_101064353 | 241 |
| 490 | 3300025925 | Ga0207650_10060020 | Ga0207650_100600202 | 241 |
| 491 | 3300025925 | Ga0207650_10093142 | Ga0207650_100931422 | 241 |
| 492 | 3300025925 | Ga0207650_10191466 | Ga0207650_101914662 | 241 |
| 493 | 3300025926 | Ga0207659_10042645 | Ga0207659_100426452 | 241 |
| 494 | 3300025926 | Ga0207659_10086103 | Ga0207659_100861032 | 241 |
| 495 | 3300025926 | Ga0207659_10197159 | Ga0207659_101971592 | 241 |
| 496 | 3300025927 | Ga0207687_10289598 | Ga0207687_102895982 | 241 |
| 497 | 3300025931 | Ga0207644_10016843 | Ga0207644_100168433 | 241 |
| 498 | 3300025932 | Ga0207690_10147841 | Ga0207690_101478412 | 241 |
| 499 | 3300025932 | Ga0207690_10434774 | Ga0207690_104347742 | 241 |
| 500 | 3300025933 | Ga0207706_10001576 | Ga0207706_100015766 | 241 |
| 501 | 3300025933 | Ga0207706_10091398 | Ga0207706_100913983 | 241 |
| 502 | 3300025933 | Ga0207706_10129692 | Ga0207706_101296924 | 241 |
| 503 | 3300025933 | Ga0207706_10182261 | Ga0207706_101822612 | 241 |
| 504 | 3300025933 | Ga0207706_10184163 | Ga0207706_101841632 | 241 |
| 505 | 3300025934 | Ga0207686_10192095 | Ga0207686_101920951 | 241 |
| 506 | 3300025935 | Ga0207709_10004566 | Ga0207709_100045667 | 241 |
| 507 | 3300025935 | Ga0207709_10026089 | Ga0207709_100260892 | 241 |
| 508 | 3300025935 | Ga0207709_10035015 | Ga0207709_100350152 | 241 |
| 509 | 3300025937 | Ga0207669_10019498 | Ga0207669_100194983 | 241 |
| 510 | 3300025938 | Ga0207704_10056029 | Ga0207704_100560293 | 241 |
| 511 | 3300025938 | Ga0207704_10205333 | Ga0207704_102053332 | 241 |
| 512 | 3300025938 | Ga0207704_10450450 | Ga0207704_104504502 | 241 |
| 513 | 3300025938 | Ga0207704_10715257 | Ga0207704_107152571 | 241 |
| 514 | 3300025939 | Ga0207665_10239116 | Ga0207665_102391162 | 241 |
| 515 | 3300025940 | Ga0207691_10042436 | Ga0207691_100424362 | 241 |
| 516 | 3300025940 | Ga0207691_10115314 | Ga0207691_101153142 | 241 |
| 517 | 3300025940 | Ga0207691_10469389 | Ga0207691_104693891 | 241 |
| 518 | 3300025941 | Ga0207711_10015814 | Ga0207711_100158148 | 241 |
| 519 | 3300025942 | Ga0207689_10003648 | Ga0207689_1000364811 | 241 |
| 520 | 3300025942 | Ga0207689_10009091 | Ga0207689_100090912 | 241 |
| 521 | 3300025942 | Ga0207689_10113469 | Ga0207689_101134691 | 241 |
| 522 | 3300025945 | Ga0207679_10000486 | Ga0207679_1000048616 | 241 |
| 523 | 3300025945 | Ga0207679_10256730 | Ga0207679_102567302 | 241 |
| 524 | 3300025945 | Ga0207679_10365409 | Ga0207679_103654092 | 241 |
| 525 | 3300025945 | Ga0207679_10782839 | Ga0207679_107828391 | 241 |
| 526 | 3300025949 | Ga0207667_10099975 | Ga0207667_100999753 | 241 |
| 527 | 3300025949 | Ga0207667_10360759 | Ga0207667_103607592 | 241 |
| 528 | 3300025960 | Ga0207651_10243179 | Ga0207651_102431792 | 241 |
| 529 | 3300025961 | Ga0207712_10106021 | Ga0207712_101060211 | 241 |
| 530 | 3300025972 | Ga0207668_10129350 | Ga0207668_101293502 | 241 |
| 531 | 3300025981 | Ga0207640_10011945 | Ga0207640_100119452 | 241 |
| 532 | 3300025981 | Ga0207640_10058408 | Ga0207640_100584082 | 241 |
| 533 | 3300025981 | Ga0207640_10496267 | Ga0207640_104962672 | 241 |
| 534 | 3300025986 | Ga0207658_10005961 | Ga0207658_100059618 | 241 |
| 535 | 3300025986 | Ga0207658_10168912 | Ga0207658_101689122 | 241 |
| 536 | 3300025986 | Ga0207658_10599759 | Ga0207658_105997591 | 241 |
| 537 | 3300026023 | Ga0207677_10168103 | Ga0207677_101681032 | 241 |
| 538 | 3300026035 | Ga0207703_10065050 | Ga0207703_100650501 | 241 |
| 539 | 3300026035 | Ga0207703_10436691 | Ga0207703_104366912 | 241 |
| 540 | 3300026041 | Ga0207639_10680217 | Ga0207639_106802171 | 241 |
| 541 | 3300026067 | Ga0207678_10005512 | Ga0207678_100055128 | 241 |
| 542 | 3300026067 | Ga0207678_10166497 | Ga0207678_101664972 | 241 |
| 543 | 3300026067 | Ga0207678_10236701 | Ga0207678_102367013 | 241 |
| 544 | 3300026067 | Ga0207678_10319869 | Ga0207678_103198693 | 241 |
| 545 | 3300026075 | Ga0207708_10041755 | Ga0207708_100417553 | 241 |
| 546 | 3300026078 | Ga0207702_10000356 | Ga0207702_1000035637 | 241 |
| 547 | 3300026078 | Ga0207702_10183623 | Ga0207702_101836232 | 241 |
| 548 | 3300026088 | Ga0207641_10001680 | Ga0207641_100016803 | 241 |
| 549 | 3300026088 | Ga0207641_10559869 | Ga0207641_105598691 | 241 |
| 550 | 3300026089 | Ga0207648_10002162 | Ga0207648_1000216210 | 241 |
| 551 | 3300026089 | Ga0207648_10010360 | Ga0207648_1001036011 | 241 |
| 552 | 3300026089 | Ga0207648_10058384 | Ga0207648_100583842 | 241 |
| 553 | 3300026089 | Ga0207648_10410318 | Ga0207648_104103182 | 241 |
| 554 | 3300026095 | Ga0207676_10200144 | Ga0207676_102001442 | 241 |
| 555 | 3300026116 | Ga0207674_10054067 | Ga0207674_100540674 | 241 |
| 556 | 3300026116 | Ga0207674_10122177 | Ga0207674_101221772 | 241 |
| 557 | 3300026118 | Ga0207675_100025343 | Ga0207675_1000253434 | 241 |
| 558 | 3300026118 | Ga0207675_100112287 | Ga0207675_1001122873 | 241 |
| 559 | 3300026121 | Ga0207683_10067518 | Ga0207683_100675182 | 241 |
| 560 | 3300026121 | Ga0207683_10280562 | Ga0207683_102805622 | 241 |
| 561 | 3300026121 | Ga0207683_10734175 | Ga0207683_107341751 | 241 |
| 562 | 3300026142 | Ga0207698_10043539 | Ga0207698_100435394 | 241 |
| 563 | 3300026142 | Ga0207698_10171264 | Ga0207698_101712641 | 241 |
| 564 | 3300027111 | Ga0209281_1000076 | Ga0209281_100007661 | 241 |
| 565 | 3300027395 | Ga0209996_1004814 | Ga0209996_10048142 | 241 |
| 566 | 3300028380 | Ga0268265_10016231 | Ga0268265_100162315 | 241 |
| 567 | 3300028380 | Ga0268265_10843370 | Ga0268265_108433701 | 241 |
| 568 | 3300028381 | Ga0268264_10052692 | Ga0268264_100526925 | 241 |
| 569 | 3300028573 | Ga0265334_10067856 | Ga0265334_100678562 | 241 |
| 570 | 3300028666 | Ga0265336_10000022 | Ga0265336_1000002272 | 241 |
| 571 | 3300028786 | Ga0307517_10335046 | Ga0307517_103350461 | 241 |
| 572 | 3300028794 | Ga0307515_10000232 | Ga0307515_1000023222 | 241 |
| 573 | 3300028794 | Ga0307515_10001456 | Ga0307515_1000145634 | 241 |
| 574 | 3300028794 | Ga0307515_10003007 | Ga0307515_100030077 | 241 |
| 575 | 3300028794 | Ga0307515_10027050 | Ga0307515_100270508 | 241 |
| 576 | 3300028794 | Ga0307515_10101925 | Ga0307515_101019254 | 241 |
| 577 | 3300029957 | Ga0265324_10002326 | Ga0265324_100023263 | 241 |
| 578 | 3300030500 | Ga0268256_1021399 | Ga0268256_10213992 | 241 |
| 579 | 3300031507 | Ga0307509_10246280 | Ga0307509_102462802 | 241 |
| 580 | 3300031548 | Ga0307408_100000160 | Ga0307408_10000016022 | 241 |
| 581 | 3300031548 | Ga0307408_100039869 | Ga0307408_1000398691 | 241 |
| 582 | 3300031548 | Ga0307408_100064966 | Ga0307408_1000649661 | 241 |
| 583 | 3300031548 | Ga0307408_100096425 | Ga0307408_1000964252 | 241 |
| 584 | 3300031548 | Ga0307408_100216238 | Ga0307408_1002162382 | 241 |
| 585 | 3300031616 | Ga0307508_10001328 | Ga0307508_1000132819 | 241 |
| 586 | 3300031649 | Ga0307514_10001289 | Ga0307514_1000128912 | 241 |
| 587 | 3300031730 | Ga0307516_10002032 | Ga0307516_1000203222 | 241 |
| 588 | 3300031730 | Ga0307516_10002726 | Ga0307516_1000272619 | 241 |
| 589 | 3300031730 | Ga0307516_10015871 | Ga0307516_100158715 | 241 |
| 590 | 3300031730 | Ga0307516_10276676 | Ga0307516_102766762 | 241 |
| 591 | 3300031995 | Ga0307409_100464726 | Ga0307409_1004647262 | 241 |
| 592 | 3300032004 | Ga0307414_10005757 | Ga0307414_100057573 | 241 |
| 593 | 3300032004 | Ga0307414_10777095 | Ga0307414_107770951 | 241 |
| 594 | 3300032005 | Ga0307411_10009492 | Ga0307411_100094926 | 241 |
| 595 | 3300032005 | Ga0307411_10212005 | Ga0307411_102120052 | 241 |
| 596 | 3300035088 | Ga0373940_0096976 | Ga0373940_0096976_93_824 | 241 |
| 597 | 3300035090 | Ga0373949_0022695 | Ga0373949_0022695_154_885 | 241 |
| 598 | 3300035114 | Ga0373939_0001481 | Ga0373939_0001481_115_846 | 241 |
| 599 | 3300035119 | Ga0373956_0228389 | Ga0373956_0228389_11_736 | 241 |
| 600 | 3300035121 | Ga0373960_0012261 | Ga0373960_0012261_246_977 | 241 |
| 601 | 3300035170 | Ga0373943_0256544 | Ga0373943_0256544_79_804 | 241 |
| 602 | 3300035691 | Ga0373931_0000429 | Ga0373931_0000429_2316_3047 | 241 |
| 603 | 3300035695 | Ga0373927_0164516 | Ga0373927_0164516_663_1391 | 241 |
| 604 | 3300036401 | Ga0373937_0201608 | Ga0373937_0201608_1020_1745 | 241 |
| 605 | 3300037068 | Ga0373925_0046695 | Ga0373925_0046695_754_1482 | 241 |
| 606 | 3300037471 | Ga0395905_0008848 | Ga0395905_0008848_128_862 | 241 |
| 607 | 3300037471 | Ga0395905_0015785 | Ga0395905_0015785_6029_6760 | 241 |
| 608 | 3300037471 | Ga0395905_0242112 | Ga0395905_0242112_839_1564 | 241 |
| 609 | 3300038443 | Ga0395901_0004869 | Ga0395901_0004869_2929_3654 | 241 |
| 610 | 3300039447 | Ga0436361_0677882 | Ga0436361_0677882_143046_143777 | 241 |
| 611 | 3300041410 | Ga0439461_0046392 | Ga0439461_0046392_62_793 | 241 |
| 612 | 3300041452 | Ga0451793_1137656 | Ga0451793_1137656_47_781 | 241 |
| 613 | 3300041486 | Ga0451807_2445078 | Ga0451807_2445078_674_1408 | 241 |
| 614 | 3300041491 | Ga0451833_0114255 | Ga0451833_0114255_486_1211 | 241 |
| 615 | 3300041512 | Ga0451853_3442311 | Ga0451853_3442311_807_1541 | 241 |
| 616 | 3300042011 | Ga0439454_003233 | Ga0439454_003233_382_1110 | 241 |
| 617 | 3300042120 | Ga0450917_000073 | Ga0450917_000073_2788_3519 | 241 |
| 618 | 3300042121 | Ga0450919_007815 | Ga0450919_007815_139_873 | 241 |
| 619 | 3300042125 | Ga0450923_013417 | Ga0450923_013417_196_930 | 241 |
| 620 | 3300042127 | Ga0450890_001264 | Ga0450890_001264_1763_2491 | 241 |
| 621 | 3300042127 | Ga0450890_003134 | Ga0450890_003134_964_1695 | 241 |
| 622 | 3300042129 | Ga0450891_000191 | Ga0450891_000191_1616_2347 | 241 |
| 623 | 3300042144 | Ga0450889_000610 | Ga0450889_000610_1285_2016 | 241 |
| 624 | 3300042157 | Ga0439458_0020111 | Ga0439458_0020111_549_1277 | 241 |
| 625 | 3300042157 | Ga0439458_0027396 | Ga0439458_0027396_207_941 | 241 |
| 626 | 3300042438 | Ga0439459_0001224 | Ga0439459_0001224_2410_3138 | 241 |
| 627 | 3300042438 | Ga0439459_0011217 | Ga0439459_0011217_778_1509 | 241 |
| 628 | 3300042531 | Ga0450918_000573 | Ga0450918_000573_1686_2420 | 241 |
| 629 | 3300042876 | Ga0451577_0000152 | Ga0451577_0000152_14578_15312 | 241 |
| 630 | 3300042876 | Ga0451577_0007214 | Ga0451577_0007214_6567_7301 | 241 |
| 631 | 3300042876 | Ga0451577_0021763 | Ga0451577_0021763_1250_1978 | 241 |
| 632 | 3300044656 | Ga0466969_0048861 | Ga0466969_0048861_380_1108 | 241 |
| 633 | 3300044658 | Ga0466972_0000265 | Ga0466972_0000265_13776_14507 | 241 |
| 634 | 3300044684 | Ga0466966_0084879 | Ga0466966_0084879_489_1217 | 241 |
| 635 | 3300044694 | Ga0466963_0018757 | Ga0466963_0018757_2554_3282 | 241 |
| 636 | 3300044694 | Ga0466963_0171347 | Ga0466963_0171347_347_1075 | 241 |
| 637 | 3300044706 | Ga0466964_0293918 | Ga0466964_0293918_26_754 | 241 |
| 638 | 3300044712 | Ga0453684_0000122 | Ga0453684_0000122_287131_287865 | 241 |
| 639 | 3300044712 | Ga0453684_0074293 | Ga0453684_0074293_2010_2735 | 241 |
| 640 | 3300044712 | Ga0453684_0198585 | Ga0453684_0198585_1586_2320 | 241 |
| 641 | 3300044735 | Ga0466968_0009938 | Ga0466968_0009938_2153_2878 | 241 |
| 642 | 3300044765 | Ga0466970_0008455 | Ga0466970_0008455_1416_2144 | 241 |
| 643 | 3300045049 | Ga0466959_0001171 | Ga0466959_0001171_14988_15716 | 241 |
| 644 | 3300045051 | Ga0451576_0000559 | Ga0451576_0000559_14552_15286 | 241 |
| 645 | 3300045051 | Ga0451576_0074522 | Ga0451576_0074522_2501_3232 | 241 |
| 646 | 3300045051 | Ga0451576_0333617 | Ga0451576_0333617_590_1315 | 241 |
| 647 | 3300045836 | Ga0466958_0157085 | Ga0466958_0157085_499_1227 | 241 |
| 648 | 3300045976 | Ga0466967_0033285 | Ga0466967_0033285_3039_3767 | 241 |
| 649 | 3300046459 | Ga0495629_0007894 | Ga0495629_0007894_902_1627 | 241 |
| 650 | 3300046460 | Ga0495638_0087017 | Ga0495638_0087017_38_766 | 241 |
| 651 | 3300046471 | Ga0495650_0042201 | Ga0495650_0042201_417_1142 | 241 |
| 652 | 3300046475 | Ga0495639_0018631 | Ga0495639_0018631_843_1568 | 241 |
| 653 | 3300046492 | Ga0495585_0230808 | Ga0495585_0230808_63_788 | 241 |
| 654 | 3300046506 | Ga0495583_0000123 | Ga0495583_0000123_123163_123888 | 241 |
| 655 | 3300046507 | Ga0495606_0001921 | Ga0495606_0001921_17922_18647 | 241 |
| 656 | 3300046515 | Ga0495620_0103979 | Ga0495620_0103979_248_982 | 241 |
| 657 | 3300046519 | Ga0495632_0016647 | Ga0495632_0016647_53_787 | 241 |
| 658 | 3300046522 | Ga0495643_0012023 | Ga0495643_0012023_4073_4807 | 241 |
| 659 | 3300046542 | Ga0495597_0042619 | Ga0495597_0042619_1000_1725 | 241 |
| 660 | 3300046543 | Ga0495645_0170854 | Ga0495645_0170854_659_1384 | 241 |
| 661 | 3300046557 | Ga0495622_0150409 | Ga0495622_0150409_284_1009 | 241 |
| 662 | 3300046616 | Ga0495668_0084528 | Ga0495668_0084528_811_1536 | 241 |
| 663 | 3300046660 | Ga0495625_0001732 | Ga0495625_0001732_18342_19076 | 241 |
| 664 | 3300046660 | Ga0495625_0003731 | Ga0495625_0003731_10286_11011 | 241 |
| 665 | 3300046660 | Ga0495625_0441550 | Ga0495625_0441550_42_767 | 241 |
| 666 | 3300046683 | Ga0495658_0080334 | Ga0495658_0080334_556_1281 | 241 |
| 667 | 3300046691 | Ga0495670_0214521 | Ga0495670_0214521_115_843 | 241 |
| 668 | 3300046692 | Ga0495671_0280824 | Ga0495671_0280824_62_787 | 241 |
| 669 | 3300046694 | Ga0495649_0006920 | Ga0495649_0006920_155_880 | 241 |
| 670 | 3300046794 | Ga0495589_0002708 | Ga0495589_0002708_1923_2648 | 241 |
| 671 | 3300047321 | Ga0495676_0236226 | Ga0495676_0236226_409_1134 | 241 |
| 672 | 3300047322 | Ga0495680_0416232 | Ga0495680_0416232_78_803 | 241 |
| 673 | 3300047443 | Ga0495687_002069 | Ga0495687_002069_15011_15736 | 241 |
| 674 | 3300047673 | Ga0495593_0079323 | Ga0495593_0079323_68_793 | 241 |
| 675 | 3300048905 | Ga0496102_0015830 | Ga0496102_0015830_65_796 | 241 |
| 676 | 3300048911 | Ga0496108_0075008 | Ga0496108_0075008_1683_2411 | 241 |
| 677 | 3300048911 | Ga0496108_0358728 | Ga0496108_0358728_415_1140 | 241 |
| 678 | 3300048917 | Ga0496114_0012468 | Ga0496114_0012468_2811_3545 | 241 |
| 679 | 3300048917 | Ga0496114_0121229 | Ga0496114_0121229_819_1544 | 241 |
| 680 | 3300048924 | Ga0496121_0008194 | Ga0496121_0008194_3866_4591 | 241 |
| 681 | 3300048927 | Ga0496124_0000344 | Ga0496124_0000344_29957_30682 | 241 |
| 682 | 3300048927 | Ga0496124_0015117 | Ga0496124_0015117_3774_4502 | 241 |
| 683 | 3300048927 | Ga0496124_0188253 | Ga0496124_0188253_474_1202 | 241 |
| 684 | 3300048928 | Ga0496125_0028418 | Ga0496125_0028418_2272_2997 | 241 |
| 685 | 3300048928 | Ga0496125_0387021 | Ga0496125_0387021_59_784 | 241 |
| 686 | 3300049128 | Ga0501308_000125 | Ga0501308_000125_2899_3630 | 241 |
| 687 | 3300049129 | Ga0501309_000072 | Ga0501309_000072_1933_2664 | 241 |
| 688 | 3300049129 | Ga0501309_002714 | Ga0501309_002714_121_855 | 241 |
| 689 | 3300049130 | Ga0501310_000166 | Ga0501310_000166_2676_3407 | 241 |
| 690 | 3300049160 | Ga0501304_000040 | Ga0501304_000040_2591_3322 | 241 |
| 691 | 3300049528 | Ga0501312_000083 | Ga0501312_000083_2898_3629 | 241 |
| 692 | 3300049530 | Ga0501314_004425 | Ga0501314_004425_136_867 | 241 |
| 693 | 3300049536 | Ga0501320_000886 | Ga0501320_000886_1136_1867 | 241 |
| 694 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_244892_245617 | 241 |
| 695 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_46219_46944 | 241 |
| 696 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_45899_46624 | 241 |
| 697 | 3300049582 | Ga0501048_0000091 | Ga0501048_0000091_4905_5630 | 241 |
| 698 | 3300049658 | Ga0501211_000060 | Ga0501211_000060_2368_3099 | 241 |
| 699 | 3300049662 | Ga0501222_000573 | Ga0501222_000573_1635_2366 | 241 |
| 700 | 3300049668 | Ga0501233_001248 | Ga0501233_001248_3573_4304 | 241 |
| 701 | 3300049669 | Ga0501235_005384 | Ga0501235_005384_1123_1854 | 241 |
| 702 | 3300049670 | Ga0501236_007587 | Ga0501236_007587_358_1089 | 241 |
| 703 | 3300049679 | Ga0501249_019913 | Ga0501249_019913_17_748 | 241 |
| 704 | 3300049687 | Ga0501258_000044 | Ga0501258_000044_4499_5230 | 241 |
| 705 | 3300049706 | Ga0501229_000386 | Ga0501229_000386_359_1090 | 241 |
| 706 | 3300049759 | Ga0501262_000731 | Ga0501262_000731_1714_2445 | 241 |
| 707 | 3300049768 | Ga0501271_002647 | Ga0501271_002647_679_1410 | 241 |
| 708 | 3300049769 | Ga0501272_002879 | Ga0501272_002879_498_1229 | 241 |
| 709 | 3300049824 | Ga0501045_0013429 | Ga0501045_0013429_1359_2084 | 241 |
| 710 | 3300050489 | nmdc:mga03683_11795_c1 | nmdc:mga03683_11795_c1_2151_2876 | 241 |
| 711 | 3300050489 | nmdc:mga03683_26488_c1 | nmdc:mga03683_26488_c1_782_1507 | 241 |
| 712 | 3300050490 | nmdc:mga03n38_10564_c1 | nmdc:mga03n38_10564_c1_799_1524 | 241 |
| 713 | 3300050493 | nmdc:mga0k408_2669_c1 | nmdc:mga0k408_2669_c1_1338_2063 | 241 |
| 714 | 3300050493 | nmdc:mga0k408_2914_c1 | nmdc:mga0k408_2914_c1_3968_4693 | 241 |
| 715 | 3300050493 | nmdc:mga0k408_309_c2 | nmdc:mga0k408_309_c2_7791_8516 | 241 |
| 716 | 3300050493 | nmdc:mga0k408_3267_c1 | nmdc:mga0k408_3267_c1_592_1317 | 241 |
| 717 | 3300050493 | nmdc:mga0k408_540_c1 | nmdc:mga0k408_540_c1_19412_20137 | 241 |
| 718 | 3300050493 | nmdc:mga0k408_79520_c1 | nmdc:mga0k408_79520_c1_15_746 | 241 |
| 719 | 3300050494 | nmdc:mga06z11_22603_c1 | nmdc:mga06z11_22603_c1_1154_1879 | 241 |
| 720 | 3300050494 | nmdc:mga06z11_335668_c1 | nmdc:mga06z11_335668_c1_26_760 | 241 |
| 721 | 3300050494 | nmdc:mga06z11_60609_c1 | nmdc:mga06z11_60609_c1_740_1465 | 241 |
| 722 | 3300050496 | nmdc:mga07m45_12293_c1 | nmdc:mga07m45_12293_c1_1125_1859 | 241 |
| 723 | 3300050496 | nmdc:mga07m45_12332_c1 | nmdc:mga07m45_12332_c1_976_1701 | 241 |
| 724 | 3300050496 | nmdc:mga07m45_16204_c1 | nmdc:mga07m45_16204_c1_2616_3341 | 241 |
| 725 | 3300050496 | nmdc:mga07m45_239_c1 | nmdc:mga07m45_239_c1_5027_5752 | 241 |
| 726 | 3300050496 | nmdc:mga07m45_32789_c1 | nmdc:mga07m45_32789_c1_1434_2162 | 241 |
| 727 | 3300050496 | nmdc:mga07m45_3604_c1 | nmdc:mga07m45_3604_c1_5765_6496 | 241 |
| 728 | 3300050496 | nmdc:mga07m45_370_c1 | nmdc:mga07m45_370_c1_14134_14859 | 241 |
| 729 | 3300050496 | nmdc:mga07m45_41801_c1 | nmdc:mga07m45_41801_c1_172_900 | 241 |
| 730 | 3300050496 | nmdc:mga07m45_7408_c1 | nmdc:mga07m45_7408_c1_3295_4020 | 241 |
| 731 | 3300050516 | nmdc:mga0sz30_153264_c1 | nmdc:mga0sz30_153264_c1_19_744 | 241 |
| 732 | 3300050516 | nmdc:mga0sz30_54366_c1 | nmdc:mga0sz30_54366_c1_370_1095 | 241 |
| 733 | 3300053085 | Ga0495619_0313064 | Ga0495619_0313064_195_920 | 241 |
| 734 | 3300053136 | Ga0500559_0026005 | Ga0500559_0026005_614_1339 | 241 |
| 735 | 3300053137 | Ga0500561_0000912 | Ga0500561_0000912_2797_3525 | 241 |
| 736 | 3300053139 | Ga0500568_0004552 | Ga0500568_0004552_6221_6946 | 241 |
| 737 | 3300053139 | Ga0500568_0020559 | Ga0500568_0020559_1221_1949 | 241 |
| 738 | 3300053156 | Ga0500622_0000874 | Ga0500622_0000874_6347_7075 | 241 |
| 739 | 3300053177 | Ga0500636_0066706 | Ga0500636_0066706_919_1644 | 241 |
| 740 | 3300053739 | Ga0500587_003671 | Ga0500587_003671_1043_1777 | 241 |
| 741 | 3300055283 | Ga0500661_010132 | Ga0500661_010132_25_750 | 241 |
| 742 | 3300061719 | Ga0466962_0007408 | Ga0466962_0007408_535_1263 | 241 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jf2-assembly1.cif.gz_A | crystal structure of a 20kda fragment of flgg | 0.8465 | 67 | 200 |
| 6jf2-assembly2.cif.gz_B | crystal structure of a 20kda fragment of flgg | 0.7972 | 61 | 202 |
| 6jf2-assembly1.cif.gz_A | crystal structure of a 20kda fragment of flgg | 0.7817 | 67 | 200 |
| 1fx7-assembly1.cif.gz_A | crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis | 0.7446 | 134 | 156 |
| 5eq4-assembly2.cif.gz_C | crystal structure of the srpa adhesin r347e mutant from streptococcus sanguinis | 0.7337 | 130 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5eq3A02 | Alpha Beta;Roll;Ubiquitin-like (UB roll); | 0.7089 | 130 | 156 | 3.10.20.890 |
| af_K7LJY2_116_288_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6654 | 126 | 155 | 2.130.10.10 |
| 6iltB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6652 | 133 | 155 | 3.40.1190.20 |
| 3lhxB00 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6148 | 133 | 157 | 3.40.1190.20 |
| af_Q9XWF9_804_861_3.10.450.750 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.613 | 131 | 158 | 3.10.450.750 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S1GZY5-F1-model_v4 | Flagellar hook protein FlgE/F/G-like D1 domain-containing protein | 0.9841 | 74 | 197 |
|
| AF-A0A7S1GZY5-F1-model_v4 | Flagellar hook protein FlgE/F/G-like D1 domain-containing protein | 0.9611 | 74 | 197 |
|
| AF-A0A6G0XZ50-F1-model_v4 | Flagellar basal-body rod protein FlgF (Distal rod protein) (Flagellar basal-body rod protein FlgG) (Flagellar hook protein FlgE) | 0.8956 | 74 | 200 |
GO:0003774
GO:0016020 GO:0031514 |
| AF-A0A5Q2QAE4-F1-model_v4 | Flagellar basal-body rod protein FlgF | 0.8763 | 68 | 241 |
GO:0030694
GO:0071978 |
| AF-A0A357D7W2-F1-model_v4 | Flagellar basal-body rod protein FlgG | 0.8537 | 65 | 202 |
GO:0009426
GO:0071978 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar