F478644

General Info

Members Datasets Scaffolds Average Seq Length
742 371 730 239

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10001328|Ga0307508_1000132819
Length 274
Sequence MGRADEARAGASRGILDSRLRGNDGYTEHTMDRMIYLSMSGAKAMMQRQDTLANNLANVSTPGFRAELQAFRAVPVQGSGASTRVYSLETTPGYSAAPGVVSETGRNLDVAVKGNAWLSVQALDGTEAYTRGGALDINSEGALTTLSGLPVMGDGGPIQVPPQTEVSIGGDGTITGKAITGKISVIGKLKLVTPTADTPLERGEDGLFRGADGAELPADPTARVQDGALEGSNVSPVETMVSMITAARQFEAQMKMLQTAEGDEKAAAQLLSMS

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
5 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
8 2643221656 Pelomonas sp. Root405 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
11 2738541337 Pelomonas sp. BT06 Isolate Unclassified
12 2831864461 Roseateles noduli HZ7 Isolate Nodule
13 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
29 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
98 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
195 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
201 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
205 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
243 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
244 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
245 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
246 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
247 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
248 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
249 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
273 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
287 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
288 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
289 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
338 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
339 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
340 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
341 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
342 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
343 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
344 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
345 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
346 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
347 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
348 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
353 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
357 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
358 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
367 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
370 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 1.35
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.23
Nodule 0.54
Rhizoplane 3.1
Rhizosphere 73.32
Stem 0
Stem Tuber 0
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000819 3300002705 Bacteria 15840
2 JGI25156J39149_1008311 3300002705 Bacteria 2628
3 JGI25154J39366_1000824 3300002738 Bacteria 13459
4 JGI25157J39369_1000027 3300002741 Bacteria 147448
5 JGI25164J39214_1003672 3300002772 Bacteria 1891
6 JGI25152J39213_1001390 3300002773 Bacteria 10482
7 JGI25150J39212_1012465 3300002774 Bacteria 1505
8 JGI25153J46596_10003685 3300003215 Bacteria 8471
9 rootH1_10004916 3300003316 Bacteria 1512
10 rootH1_10004916 3300003323 Bacteria 4708
11 rootH1_10006365 3300003316 Bacteria 19108
12 rootH2_10047071 3300003320 Bacteria 3455
13 rootL2_10003861 3300003322 Bacteria 52646
14 rootL2_10009273 3300003322 Bacteria 31971
15 rootH1_10006621 3300003323 Bacteria 4004
16 rootH1_10019349 3300003323 Bacteria 13289
17 rootH1_10027533 3300003323 Bacteria 3244
18 rootH1_10031598 3300003323 Bacteria 3903
19 Ga0055539_1004569 3300003752 Bacteria 1838
20 Ga0055539_1004861 3300003752 Bacteria 1771
21 Ga0055533_1000073 3300003756 Bacteria 142476
22 Ga0055525_1000038 3300003759 Bacteria 297540
23 Ga0055525_1000687 3300003759 Bacteria 12627
24 Ga0055535_1000229 3300003761 Bacteria 58945
25 Ga0055529_1000064 3300003763 Bacteria 178831
26 Ga0055526_1002388 3300003771 Bacteria 12716
27 Ga0055530_10029662 3300003791 Bacteria 1460
28 Ga0055540_1009954 3300003792 Bacteria 3213
29 Ga0055540_1024456 3300003792 Bacteria 1498
30 Ga0055531_10003179 3300003794 Bacteria 10559
31 Ga0055531_10028054 3300003794 Bacteria 1953
32 Ga0055543_1002234 3300004625 Bacteria 6575
33 Ga0055543_1013363 3300004625 Bacteria 1625
34 Ga0065165_1000283 3300005262 Bacteria 86141
35 Ga0070658_10112110 3300005327 Bacteria 2261
36 Ga0070658_10162910 3300005327 Bacteria 1871
37 Ga0070658_10186426 3300005327 Bacteria 1747
38 Ga0070658_10336633 3300005327 Bacteria 1290
39 Ga0070658_10386740 3300005327 Bacteria 1201
40 Ga0070676_10001564 3300005328 Bacteria 11610
41 Ga0070676_10008248 3300005328 Bacteria 5609
42 Ga0070676_10021053 3300005328 Bacteria 3648
43 Ga0070676_10203141 3300005328 Bacteria 1300
44 Ga0070683_100049545 3300005329 Bacteria 3885
45 Ga0070670_100058457 3300005331 Bacteria 3310
46 Ga0070670_100078920 3300005331 Bacteria 2828
47 Ga0070670_100164150 3300005331 Bacteria 1925
48 Ga0068869_100006946 3300005334 Bacteria 7204
49 Ga0068869_100032102 3300005334 Bacteria 3698
50 Ga0070666_10010360 3300005335 Bacteria 5829
51 Ga0070682_100011477 3300005337 Bacteria 5064
52 Ga0068868_100015353 3300005338 Bacteria 5663
53 Ga0068868_100150412 3300005338 Bacteria 1917
54 Ga0070691_10093657 3300005341 Bacteria 1484
55 Ga0070661_100000220 3300005344 Bacteria 47213
56 Ga0070661_100122816 3300005344 Bacteria 1946
57 Ga0070661_100471212 3300005344 Bacteria 1001
58 Ga0070668_100017395 3300005347 Bacteria 5386
59 Ga0070668_100404298 3300005347 Bacteria 1166
60 Ga0070669_100009995 3300005353 Bacteria 6745
61 Ga0070669_100012537 3300005353 Bacteria 6011
62 Ga0070675_100005126 3300005354 Bacteria 9998
63 Ga0070675_100018606 3300005354 Bacteria 5530
64 Ga0070675_100065579 3300005354 Bacteria 3003
65 Ga0070675_100067887 3300005354 Bacteria 2951
66 Ga0070675_100085117 3300005354 Bacteria 2641
67 Ga0070675_100235705 3300005354 Bacteria 1598
68 Ga0070671_100027816 3300005355 Bacteria 4655
69 Ga0070671_100164531 3300005355 Bacteria 1875
70 Ga0070674_100010227 3300005356 Bacteria 5660
71 Ga0070674_100015369 3300005356 Bacteria 4778
72 Ga0070674_100034505 3300005356 Bacteria 3380
73 Ga0070673_100007297 3300005364 Bacteria 7276
74 Ga0070673_100018847 3300005364 Bacteria 4944
75 Ga0070673_100027663 3300005364 Bacteria 4206
76 Ga0070688_100323478 3300005365 Bacteria 1121
77 Ga0070659_100011721 3300005366 Bacteria 6490
78 Ga0070659_100279317 3300005366 Bacteria 1389
79 Ga0070659_100541699 3300005366 Bacteria 996
80 Ga0070667_100015900 3300005367 Bacteria 6225
81 Ga0070667_100413156 3300005367 Bacteria 1229
82 Ga0070667_100644164 3300005367 Bacteria 978
83 Ga0070700_100072194 3300005441 Bacteria 2206
84 Ga0070708_100224098 3300005445 Bacteria 1764
85 Ga0070663_100000511 3300005455 Bacteria 20575
86 Ga0070663_100040338 3300005455 Bacteria 3267
87 Ga0070663_100047246 3300005455 Bacteria 3049
88 Ga0070663_100147313 3300005455 Bacteria 1802
89 Ga0070678_100094551 3300005456 Bacteria 2301
90 Ga0070678_100299788 3300005456 Bacteria 1365
91 Ga0070678_100383983 3300005456 Bacteria 1216
92 Ga0070662_100011606 3300005457 Bacteria 5814
93 Ga0070662_100025773 3300005457 Bacteria 4064
94 Ga0070662_100059050 3300005457 Bacteria 2793
95 Ga0070662_100075848 3300005457 Bacteria 2491
96 Ga0070662_100162304 3300005457 Bacteria 1749
97 Ga0070662_100179951 3300005457 Bacteria 1666
98 Ga0070662_100182899 3300005457 Bacteria 1653
99 Ga0070681_10803284 3300005458 Bacteria 858
100 Ga0068867_100000790 3300005459 Bacteria 21397
101 Ga0068867_100013500 3300005459 Bacteria 5785
102 Ga0068867_100026443 3300005459 Bacteria 4167
103 Ga0068867_100036682 3300005459 Bacteria 3561
104 Ga0068867_100052050 3300005459 Bacteria 3021
105 Ga0068867_100159120 3300005459 Bacteria 1780
106 Ga0070706_100006257 3300005467 Bacteria 11259
107 Ga0070706_100091805 3300005467 Bacteria 2817
108 Ga0070698_100147344 3300005471 Bacteria 2302
109 Ga0070699_100039909 3300005518 Bacteria 4065
110 Ga0070684_100184945 3300005535 Bacteria 1895
111 Ga0070684_100431796 3300005535 Bacteria 1216
112 Ga0068853_100054053 3300005539 Bacteria 3460
113 Ga0070672_100007320 3300005543 Bacteria 7483
114 Ga0070672_100025782 3300005543 Bacteria 4367
115 Ga0070672_100077068 3300005543 Bacteria 2665
116 Ga0070672_100201268 3300005543 Bacteria 1665
117 Ga0070672_100248257 3300005543 Bacteria 1498
118 Ga0070665_100235654 3300005548 Bacteria 1831
119 Ga0070665_100340176 3300005548 Bacteria 1505
120 Ga0070665_100593165 3300005548 Bacteria 1121
121 Ga0070704_100738292 3300005549 Bacteria 876
122 Ga0068855_100036949 3300005563 Bacteria 5811
123 Ga0068855_100232839 3300005563 Bacteria 2061
124 Ga0068855_100234373 3300005563 Bacteria 2053
125 Ga0068855_100804494 3300005563 Bacteria 999
126 Ga0070664_100000267 3300005564 Bacteria 37668
127 Ga0068857_100029449 3300005577 Bacteria 4845
128 Ga0068857_100095589 3300005577 Bacteria 2662
129 Ga0068857_100445996 3300005577 Bacteria 1209
130 Ga0068854_100022875 3300005578 Bacteria 4264
131 Ga0068854_100024167 3300005578 Bacteria 4158
132 Ga0068856_100002053 3300005614 Bacteria 20877
133 Ga0068856_100024851 3300005614 Bacteria 5835
134 Ga0068856_100341809 3300005614 Bacteria 1515
135 Ga0068852_100043701 3300005616 Bacteria 3801
136 Ga0068852_100056636 3300005616 Bacteria 3389
137 Ga0068852_100093722 3300005616 Bacteria 2692
138 Ga0068852_100142284 3300005616 Bacteria 2221
139 Ga0068852_100216417 3300005616 Bacteria 1820
140 Ga0068852_100356599 3300005616 Bacteria 1429
141 Ga0068852_100679484 3300005616 Bacteria 1039
142 Ga0068859_100106772 3300005617 Bacteria 2859
143 Ga0068859_100108883 3300005617 Bacteria 2832
144 Ga0068864_100060031 3300005618 Bacteria 3292
145 Ga0068864_100219491 3300005618 Bacteria 1754
146 Ga0068864_100421101 3300005618 Bacteria 1272
147 Ga0068864_100710494 3300005618 Bacteria 982
148 Ga0068866_10110123 3300005718 Bacteria 1535
149 Ga0068861_100015673 3300005719 Bacteria 5348
150 Ga0068861_100022104 3300005719 Bacteria 4578
151 Ga0068861_100022301 3300005719 Bacteria 4560
152 Ga0068851_10037386 3300005834 Bacteria 2433
153 Ga0068851_10100469 3300005834 Bacteria 1534
154 Ga0068870_10267380 3300005840 Bacteria 1067
155 Ga0068863_100049597 3300005841 Bacteria 3980
156 Ga0068858_100006620 3300005842 Bacteria 11273
157 Ga0068858_100120280 3300005842 Bacteria 2455
158 Ga0068860_100097662 3300005843 Bacteria 2800
159 Ga0068860_100172086 3300005843 Bacteria 2092
160 Ga0068862_100063807 3300005844 Bacteria 3170
161 Ga0068862_100228663 3300005844 Bacteria 1686
162 Ga0075363_100038359 3300006048 Bacteria 2519
163 Ga0075364_10053170 3300006051 Bacteria 2647
164 Ga0075362_10012284 3300006177 Bacteria 3399
165 Ga0075362_10028110 3300006177 Bacteria 2413
166 Ga0075367_10002209 3300006178 Bacteria 8782
167 Ga0075367_10088704 3300006178 Bacteria 1880
168 Ga0075369_10023004 3300006186 Bacteria 2573
169 Ga0075366_10007775 3300006195 Bacteria 5935
170 Ga0075366_10013362 3300006195 Bacteria 4672
171 Ga0075366_10029844 3300006195 Bacteria 3204
172 Ga0075366_10078048 3300006195 Bacteria 1976
173 Ga0075366_10086045 3300006195 Bacteria 1881
174 Ga0075366_10134156 3300006195 Bacteria 1495
175 Ga0075366_10356339 3300006195 Bacteria 898
176 Ga0097621_100168995 3300006237 Bacteria 1884
177 Ga0075370_10000201 3300006353 Bacteria 21046
178 Ga0075370_10001234 3300006353 Bacteria 10856
179 Ga0075370_10003435 3300006353 Bacteria 7541
180 Ga0075370_10009591 3300006353 Bacteria 5033
181 Ga0075370_10010256 3300006353 Bacteria 4892
182 Ga0075370_10029300 3300006353 Bacteria 3066
183 Ga0075370_10034024 3300006353 Bacteria 2856
184 Ga0075370_10044650 3300006353 Bacteria 2505
185 Ga0075370_10044825 3300006353 Bacteria 2500
186 Ga0068871_100020051 3300006358 Bacteria 5117
187 Ga0068871_100081992 3300006358 Bacteria 2674
188 Ga0068865_100014886 3300006881 Bacteria 4951
189 Ga0068865_100221348 3300006881 Bacteria 1480
190 Ga0097620_100106761 3300006931 Bacteria 2859
191 Ga0097620_100108885 3300006931 Bacteria 2832
192 Ga0099823_1000083 3300006944 Bacteria 44975
193 Ga0079104_1000013 3300006946 Bacteria 349477
194 Ga0105240_10015301 3300009093 Bacteria 10439
195 Ga0105240_10118894 3300009093 Bacteria 3184
196 Ga0105240_10524014 3300009093 Bacteria 1315
197 Ga0105245_10013187 3300009098 Bacteria 7201
198 Ga0105245_10228508 3300009098 Bacteria 1799
199 Ga0105245_10470397 3300009098 Bacteria 1269
200 Ga0114129_10241375 3300009147 Bacteria 2429
201 Ga0105243_10002845 3300009148 Bacteria 14364
202 Ga0105243_10004374 3300009148 Bacteria 11179
203 Ga0105243_10010965 3300009148 Bacteria 6853
204 Ga0105243_10078629 3300009148 Bacteria 2686
205 Ga0105243_10091822 3300009148 Bacteria 2501
206 Ga0105243_10120701 3300009148 Bacteria 2209
207 Ga0105243_10124756 3300009148 Bacteria 2176
208 Ga0105242_10313640 3300009176 Bacteria 1436
209 Ga0105242_10351715 3300009176 Bacteria 1361
210 Ga0105242_10726124 3300009176 Bacteria 975
211 Ga0105248_10022270 3300009177 Bacteria 7025
212 Ga0105248_10095190 3300009177 Bacteria 3353
213 Ga0105248_10124017 3300009177 Bacteria 2914
214 Ga0105237_10000441 3300009545 Bacteria 59156
215 Ga0105237_10005851 3300009545 Bacteria 13795
216 Ga0105238_10009732 3300009551 Bacteria 9625
217 Ga0105238_10070600 3300009551 Bacteria 3491
218 Ga0105238_10171909 3300009551 Bacteria 2143
219 Ga0105249_10029198 3300009553 Bacteria 4980
220 Ga0105239_10000417 3300010375 Bacteria 62040
221 Ga0105239_10037957 3300010375 Bacteria 5279
222 Ga0105239_10081431 3300010375 Bacteria 3563
223 Ga0105239_10083030 3300010375 Bacteria 3528
224 Ga0105239_10239407 3300010375 Bacteria 2037
225 Ga0105246_10115928 3300011119 Bacteria 1976
226 Ga0157319_1000037 3300012497 Bacteria 39883
227 Ga0157371_10167673 3300013102 Bacteria 1569
228 Ga0157369_10028648 3300013105 Bacteria 6163
229 Ga0157369_10842038 3300013105 Bacteria 942
230 Ga0157374_10029986 3300013296 Bacteria 4935
231 Ga0157374_10524788 3300013296 Bacteria 1190
232 Ga0157374_10707214 3300013296 Bacteria 1021
233 Ga0157378_10095407 3300013297 Bacteria 2709
234 Ga0157378_10208963 3300013297 Bacteria 1850
235 Ga0157378_10501530 3300013297 Bacteria 1212
236 Ga0163162_10025537 3300013306 Bacteria 5838
237 Ga0163162_10065803 3300013306 Bacteria 3673
238 Ga0163162_10939741 3300013306 Bacteria 976
239 Ga0157372_10033672 3300013307 Bacteria 5630
240 Ga0157375_10196704 3300013308 Bacteria 2171
241 Ga0157375_10226234 3300013308 Bacteria 2029
242 Ga0157375_11210744 3300013308 Bacteria 886
243 Ga0163163_11011645 3300014325 Bacteria 894
244 Ga0157380_10269980 3300014326 Bacteria 1550
245 Ga0157377_10000091 3300014745 Bacteria 66087
246 Ga0157377_10016804 3300014745 Bacteria 3771
247 Ga0157377_10198369 3300014745 Bacteria 1273
248 Ga0157379_10019670 3300014968 Bacteria 5964
249 Ga0157379_10048077 3300014968 Bacteria 3808
250 Ga0157379_10257130 3300014968 Bacteria 1586
251 Ga0157379_10446633 3300014968 Bacteria 1193
252 Ga0157376_10014494 3300014969 Bacteria 5920
253 Ga0157376_10325280 3300014969 Bacteria 1463
254 Ga0157376_10494306 3300014969 Bacteria 1201
255 Ga0163161_10019047 3300017792 Bacteria 4812
256 Ga0163161_10031397 3300017792 Bacteria 3784
257 Ga0213872_10000018 3300021361 Bacteria 175951
258 Ga0213872_10000070 3300021361 Bacteria 91519
259 Ga0213872_10000417 3300021361 Bacteria 34831
260 Ga0209674_100039 3300025226 Bacteria 402292
261 Ga0209563_100005 3300025230 Bacteria 1774893
262 Ga0209563_100110 3300025230 Bacteria 142518
263 Ga0207427_101215 3300025231 Bacteria 9962
264 Ga0209258_100124 3300025242 Bacteria 178883
265 Ga0209258_105648 3300025242 Bacteria 2081
266 Ga0207425_1000333 3300025245 Bacteria 33033
267 Ga0209646_1000196 3300025246 Bacteria 72959
268 Ga0209646_1016918 3300025246 Bacteria 1079
269 Ga0209026_1000011 3300025250 Bacteria 507291
270 Ga0209677_100151 3300025253 Bacteria 63642
271 Ga0209677_100488 3300025253 Bacteria 22414
272 Ga0209677_100877 3300025253 Bacteria 14760
273 Ga0209759_1000107 3300025256 Bacteria 147025
274 Ga0209759_1000652 3300025256 Bacteria 32306
275 Ga0209759_1000898 3300025256 Bacteria 22252
276 Ga0209759_1019767 3300025256 Bacteria 1586
277 Ga0209759_1037097 3300025256 Bacteria 880
278 Ga0209129_1000027 3300025258 Bacteria 409587
279 Ga0209455_1000114 3300025272 Bacteria 178883
280 Ga0209673_1009846 3300025273 Bacteria 4092
281 Ga0209675_1019509 3300025291 Bacteria 1864
282 Ga0209564_1000003 3300025295 Bacteria 1585848
283 Ga0209564_1000014 3300025295 Bacteria 621501
284 Ga0209758_1000193 3300025297 Bacteria 134744
285 Ga0209758_1000208 3300025297 Bacteria 128596
286 Ga0209050_1008652 3300025298 Bacteria 5382
287 Ga0209256_1000130 3300025299 Bacteria 163227
288 Ga0209256_1000471 3300025299 Bacteria 60530
289 Ga0209051_1001932 3300025303 Bacteria 16014
290 Ga0209051_1002398 3300025303 Bacteria 13498
291 Ga0209051_1006338 3300025303 Bacteria 6695
292 Ga0209051_1009233 3300025303 Bacteria 5103
293 Ga0209257_1000049 3300025304 Bacteria 441224
294 Ga0209257_1001013 3300025304 Bacteria 37837
295 Ga0209257_1001664 3300025304 Bacteria 25177
296 Ga0209257_1060265 3300025304 Bacteria 1033
297 Ga0207697_10024132 3300025315 Bacteria 2491
298 Ga0207697_10029145 3300025315 Bacteria 2258
299 Ga0207697_10101257 3300025315 Bacteria 1228
300 Ga0207656_10088785 3300025321 Bacteria 1400
301 Ga0207656_10115967 3300025321 Bacteria 1242
302 Ga0207682_10022146 3300025893 Bacteria 2502
303 Ga0207682_10026607 3300025893 Bacteria 2300
304 Ga0207682_10081982 3300025893 Bacteria 1384
305 Ga0207688_10030413 3300025901 Bacteria 2977
306 Ga0207688_10036249 3300025901 Bacteria 2734
307 Ga0207688_10095062 3300025901 Bacteria 1715
308 Ga0207680_10456126 3300025903 Bacteria 908
309 Ga0207645_10001787 3300025907 Bacteria 17388
310 Ga0207645_10008457 3300025907 Bacteria 7178
311 Ga0207645_10014732 3300025907 Bacteria 5221
312 Ga0207645_10110772 3300025907 Bacteria 1777
313 Ga0207643_10082044 3300025908 Bacteria 1869
314 Ga0207643_10335907 3300025908 Bacteria 946
315 Ga0207643_10492395 3300025908 Bacteria 783
316 Ga0207705_10126816 3300025909 Bacteria 1897
317 Ga0207705_10134771 3300025909 Bacteria 1840
318 Ga0207705_10174068 3300025909 Bacteria 1622
319 Ga0207705_10439247 3300025909 Bacteria 1011
320 Ga0207684_10041453 3300025910 Bacteria 3903
321 Ga0207654_10019687 3300025911 Bacteria 3567
322 Ga0207695_10023628 3300025913 Bacteria 6937
323 Ga0207695_10024383 3300025913 Bacteria 6809
324 Ga0207695_10731186 3300025913 Bacteria 870
325 Ga0207671_10001929 3300025914 Bacteria 22998
326 Ga0207671_10045543 3300025914 Bacteria 3244
327 Ga0207657_10044064 3300025919 Bacteria 3925
328 Ga0207657_10127028 3300025919 Bacteria 2093
329 Ga0207657_10342328 3300025919 Bacteria 1180
330 Ga0207649_10001581 3300025920 Bacteria 13262
331 Ga0207649_10079481 3300025920 Bacteria 2119
332 Ga0207649_10112887 3300025920 Bacteria 1819
333 Ga0207681_10000974 3300025923 Bacteria 18695
334 Ga0207681_10035283 3300025923 Bacteria 3294
335 Ga0207681_10062794 3300025923 Bacteria 2559
336 Ga0207694_10062742 3300025924 Bacteria 2894
337 Ga0207694_10106435 3300025924 Bacteria 2228
338 Ga0207650_10060020 3300025925 Bacteria 2837
339 Ga0207650_10072212 3300025925 Bacteria 2597
340 Ga0207650_10093142 3300025925 Bacteria 2306
341 Ga0207650_10191466 3300025925 Bacteria 1634
342 Ga0207659_10020790 3300025926 Bacteria 4345
343 Ga0207659_10042645 3300025926 Bacteria 3182
344 Ga0207659_10086103 3300025926 Bacteria 2336
345 Ga0207659_10090565 3300025926 Bacteria 2283
346 Ga0207659_10197159 3300025926 Bacteria 1606
347 Ga0207687_10082878 3300025927 Bacteria 2321
348 Ga0207687_10289598 3300025927 Bacteria 1316
349 Ga0207644_10016843 3300025931 Bacteria 4924
350 Ga0207644_10024152 3300025931 Bacteria 4171
351 Ga0207644_10368925 3300025931 Bacteria 1169
352 Ga0207690_10147841 3300025932 Bacteria 1739
353 Ga0207690_10154917 3300025932 Bacteria 1702
354 Ga0207690_10434774 3300025932 Bacteria 1052
355 Ga0207706_10000993 3300025933 Bacteria 28866
356 Ga0207706_10001576 3300025933 Bacteria 22614
357 Ga0207706_10091398 3300025933 Bacteria 2676
358 Ga0207706_10129692 3300025933 Bacteria 2218
359 Ga0207706_10182261 3300025933 Bacteria 1844
360 Ga0207706_10184163 3300025933 Bacteria 1834
361 Ga0207686_10192095 3300025934 Bacteria 1456
362 Ga0207709_10004566 3300025935 Bacteria 7972
363 Ga0207709_10026089 3300025935 Bacteria 3353
364 Ga0207709_10035015 3300025935 Bacteria 2965
365 Ga0207709_10084466 3300025935 Bacteria 2055
366 Ga0207669_10019498 3300025937 Bacteria 3533
367 Ga0207669_10027345 3300025937 Bacteria 3121
368 Ga0207704_10056029 3300025938 Bacteria 2412
369 Ga0207704_10205333 3300025938 Bacteria 1445
370 Ga0207704_10450450 3300025938 Bacteria 1027
371 Ga0207704_10715257 3300025938 Bacteria 830
372 Ga0207665_10239116 3300025939 Bacteria 1337
373 Ga0207691_10006575 3300025940 Bacteria 11227
374 Ga0207691_10042436 3300025940 Bacteria 4193
375 Ga0207691_10115314 3300025940 Bacteria 2386
376 Ga0207691_10469389 3300025940 Bacteria 1070
377 Ga0207711_10005046 3300025941 Bacteria 11194
378 Ga0207711_10015814 3300025941 Bacteria 6260
379 Ga0207689_10000855 3300025942 Bacteria 29354
380 Ga0207689_10003648 3300025942 Bacteria 14048
381 Ga0207689_10009091 3300025942 Bacteria 8601
382 Ga0207689_10113469 3300025942 Bacteria 2227
383 Ga0207679_10000486 3300025945 Bacteria 27449
384 Ga0207679_10256730 3300025945 Bacteria 1489
385 Ga0207679_10365409 3300025945 Bacteria 1261
386 Ga0207679_10453235 3300025945 Bacteria 1138
387 Ga0207679_10782839 3300025945 Bacteria 869
388 Ga0207667_10099975 3300025949 Bacteria 2992
389 Ga0207667_10159584 3300025949 Bacteria 2320
390 Ga0207667_10360759 3300025949 Bacteria 1482
391 Ga0207651_10002160 3300025960 Bacteria 9302
392 Ga0207651_10243179 3300025960 Bacteria 1468
393 Ga0207712_10106021 3300025961 Bacteria 2099
394 Ga0207668_10129350 3300025972 Bacteria 1925
395 Ga0207640_10011945 3300025981 Bacteria 4932
396 Ga0207640_10058408 3300025981 Bacteria 2541
397 Ga0207640_10496267 3300025981 Bacteria 1016
398 Ga0207658_10005961 3300025986 Bacteria 8325
399 Ga0207658_10168912 3300025986 Bacteria 1800
400 Ga0207658_10599759 3300025986 Bacteria 989
401 Ga0207677_10017341 3300026023 Bacteria 4290
402 Ga0207677_10158644 3300026023 Bacteria 1755
403 Ga0207677_10168103 3300026023 Bacteria 1711
404 Ga0207703_10065050 3300026035 Bacteria 2995
405 Ga0207703_10246180 3300026035 Bacteria 1609
406 Ga0207703_10436691 3300026035 Bacteria 1221
407 Ga0207639_10015071 3300026041 Bacteria 5444
408 Ga0207639_10680217 3300026041 Bacteria 953
409 Ga0207678_10005512 3300026067 Bacteria 11313
410 Ga0207678_10023385 3300026067 Bacteria 5404
411 Ga0207678_10166497 3300026067 Bacteria 1882
412 Ga0207678_10236701 3300026067 Bacteria 1564
413 Ga0207678_10319869 3300026067 Bacteria 1335
414 Ga0207708_10041755 3300026075 Bacteria 3496
415 Ga0207702_10000356 3300026078 Bacteria 52498
416 Ga0207702_10047997 3300026078 Bacteria 3600
417 Ga0207702_10183623 3300026078 Bacteria 1928
418 Ga0207702_10190137 3300026078 Bacteria 1896
419 Ga0207641_10001680 3300026088 Bacteria 21541
420 Ga0207641_10559869 3300026088 Bacteria 1116
421 Ga0207648_10002162 3300026089 Bacteria 21355
422 Ga0207648_10010360 3300026089 Bacteria 8842
423 Ga0207648_10040097 3300026089 Bacteria 4115
424 Ga0207648_10058384 3300026089 Bacteria 3364
425 Ga0207648_10410318 3300026089 Bacteria 1228
426 Ga0207676_10200144 3300026095 Bacteria 1764
427 Ga0207676_10476828 3300026095 Bacteria 1181
428 Ga0207674_10026355 3300026116 Bacteria 6176
429 Ga0207674_10054067 3300026116 Bacteria 4090
430 Ga0207674_10112313 3300026116 Bacteria 2698
431 Ga0207674_10122177 3300026116 Bacteria 2570
432 Ga0207675_100000911 3300026118 Bacteria 29492
433 Ga0207675_100025343 3300026118 Bacteria 5518
434 Ga0207675_100112287 3300026118 Bacteria 2572
435 Ga0207683_10025099 3300026121 Bacteria 5139
436 Ga0207683_10067518 3300026121 Bacteria 3154
437 Ga0207683_10247414 3300026121 Bacteria 1627
438 Ga0207683_10280562 3300026121 Bacteria 1522
439 Ga0207683_10734175 3300026121 Bacteria 916
440 Ga0207683_10861978 3300026121 Bacteria 841
441 Ga0207698_10006990 3300026142 Bacteria 7064
442 Ga0207698_10043539 3300026142 Bacteria 3364
443 Ga0207698_10128705 3300026142 Bacteria 2159
444 Ga0207698_10171264 3300026142 Bacteria 1912
445 Ga0209281_1000076 3300027111 Bacteria 263350
446 Ga0209996_1004814 3300027395 Bacteria 1724
447 Ga0268266_10259244 3300028379 Bacteria 1611
448 Ga0268266_10555972 3300028379 Bacteria 1100
449 Ga0268265_10016231 3300028380 Bacteria 5112
450 Ga0268265_10158640 3300028380 Bacteria 1918
451 Ga0268265_10843370 3300028380 Bacteria 896
452 Ga0268264_10052692 3300028381 Bacteria 3393
453 Ga0268264_10223286 3300028381 Bacteria 1735
454 Ga0265334_10067856 3300028573 Bacteria 1332
455 Ga0265336_10000022 3300028666 Bacteria 192716
456 Ga0307517_10335046 3300028786 Bacteria 829
457 Ga0307515_10000131 3300028794 Bacteria 178919
458 Ga0307515_10000165 3300028794 Bacteria 162589
459 Ga0307515_10000232 3300028794 Bacteria 137778
460 Ga0307515_10001456 3300028794 Bacteria 53165
461 Ga0307515_10003007 3300028794 Bacteria 35804
462 Ga0307515_10027050 3300028794 Bacteria 9832
463 Ga0307515_10101925 3300028794 Bacteria 3459
464 Ga0265324_10002326 3300029957 Bacteria 9841
465 Ga0268256_1021399 3300030500 Bacteria 1721
466 Ga0265328_10027240 3300031239 Bacteria 2143
467 Ga0265331_10091700 3300031250 Bacteria 1404
468 Ga0265327_10000028 3300031251 Bacteria 361066
469 Ga0307513_10001541 3300031456 Bacteria 33038
470 Ga0307509_10246280 3300031507 Bacteria 1575
471 Ga0307408_100000160 3300031548 Bacteria 74342
472 Ga0307408_100039869 3300031548 Bacteria 3323
473 Ga0307408_100064966 3300031548 Bacteria 2675
474 Ga0307408_100096425 3300031548 Bacteria 2244
475 Ga0307408_100216238 3300031548 Bacteria 1561
476 Ga0307508_10001328 3300031616 Bacteria 27985
477 Ga0307514_10001289 3300031649 Bacteria 32516
478 Ga0307516_10002032 3300031730 Bacteria 27587
479 Ga0307516_10002726 3300031730 Bacteria 23277
480 Ga0307516_10015871 3300031730 Bacteria 7903
481 Ga0307516_10051235 3300031730 Bacteria 4047
482 Ga0307516_10276676 3300031730 Bacteria 1362
483 Ga0307409_100464726 3300031995 Bacteria 1224
484 Ga0307416_100078114 3300032002 Bacteria 2783
485 Ga0307416_100942918 3300032002 Bacteria 965
486 Ga0307414_10005757 3300032004 Bacteria 6848
487 Ga0307414_10777095 3300032004 Bacteria 872
488 Ga0307411_10009492 3300032005 Bacteria 5119
489 Ga0307411_10212005 3300032005 Bacteria 1496
490 Ga0307411_10392620 3300032005 Bacteria 1145
491 Ga0307510_10007541 3300033180 Bacteria 12959
492 Ga0373959_0040877 3300034820 Bacteria 972
493 Ga0373940_0096976 3300035088 Bacteria 890
494 Ga0373949_0022695 3300035090 Bacteria 1449
495 Ga0373932_0116696 3300035112 Bacteria 886
496 Ga0373939_0001481 3300035114 Bacteria 5688
497 Ga0373956_0228389 3300035119 Bacteria 884
498 Ga0373960_0012261 3300035121 Bacteria 2127
499 Ga0373960_0072452 3300035121 Bacteria 1068
500 Ga0373943_0256544 3300035170 Bacteria 983
501 Ga0373962_0010650 3300035242 Bacteria 2297
502 Ga0373962_0034740 3300035242 Bacteria 1397
503 Ga0373931_0000429 3300035691 Bacteria 17104
504 Ga0373931_0001168 3300035691 Bacteria 11183
505 Ga0373931_0001365 3300035691 Bacteria 10433
506 Ga0373927_0164516 3300035695 Bacteria 1454
507 Ga0373937_0201608 3300036401 Bacteria 1870
508 Ga0373925_0046695 3300037068 Bacteria 3221
509 Ga0395905_0008848 3300037471 Bacteria 9894
510 Ga0395905_0015785 3300037471 Bacteria 7174
511 Ga0395905_0242112 3300037471 Bacteria 1685
512 Ga0395901_0004869 3300038443 Bacteria 13555
513 Ga0436365_0394409 3300039437 Bacteria 916
514 Ga0436361_0275830 3300039447 Bacteria 6564
515 Ga0436361_0677882 3300039447 Bacteria 228834
516 Ga0436361_0763381 3300039447 Bacteria 4734
517 Ga0436361_0812713 3300039447 Bacteria 39089
518 Ga0439461_0046392 3300041410 Bacteria 952
519 Ga0451793_1137656 3300041452 Bacteria 1029
520 Ga0451795_0619171 3300041456 Bacteria 1810
521 Ga0451807_2445078 3300041486 Bacteria 1540
522 Ga0451833_0114255 3300041491 Bacteria 1260
523 Ga0451853_3442311 3300041512 Bacteria 2408
524 Ga0439454_003233 3300042011 Bacteria 1796
525 Ga0450917_000073 3300042120 Bacteria 5647
526 Ga0450919_007815 3300042121 Bacteria 1245
527 Ga0450923_013417 3300042125 Bacteria 1506
528 Ga0450890_001264 3300042127 Bacteria 3662
529 Ga0450890_003134 3300042127 Bacteria 2214
530 Ga0450891_000191 3300042129 Bacteria 5995
531 Ga0450889_000610 3300042144 Bacteria 3971
532 Ga0439458_0020111 3300042157 Bacteria 1541
533 Ga0439458_0027396 3300042157 Bacteria 1344
534 Ga0439459_0001224 3300042438 Bacteria 3755
535 Ga0439459_0011217 3300042438 Bacteria 1577
536 Ga0450918_000573 3300042531 Bacteria 7828
537 Ga0451577_0000152 3300042876 Bacteria 153284
538 Ga0451577_0007214 3300042876 Bacteria 10951
539 Ga0451577_0021763 3300042876 Bacteria 5863
540 Ga0466969_0002697 3300044656 Bacteria 9478
541 Ga0466969_0019974 3300044656 Bacteria 3472
542 Ga0466969_0048861 3300044656 Bacteria 2089
543 Ga0466972_0000265 3300044658 Bacteria 33659
544 Ga0466977_0000007 3300044666 Bacteria 32886
545 Ga0466965_0000290 3300044683 Bacteria 16664
546 Ga0466966_0001287 3300044684 Bacteria 16051
547 Ga0466966_0084879 3300044684 Bacteria 1968
548 Ga0466963_0018757 3300044694 Bacteria 4330
549 Ga0466963_0171347 3300044694 Bacteria 1513
550 Ga0466964_0000836 3300044706 Bacteria 10083
551 Ga0466964_0293918 3300044706 Bacteria 816
552 Ga0453684_0000122 3300044712 Bacteria 340529
553 Ga0453684_0064995 3300044712 Bacteria 4655
554 Ga0453684_0074293 3300044712 Bacteria 4281
555 Ga0453684_0198585 3300044712 Bacteria 2340
556 Ga0466971_0000304 3300044719 Bacteria 18934
557 Ga0466968_0006186 3300044735 Bacteria 4501
558 Ga0466968_0009938 3300044735 Bacteria 3673
559 Ga0466970_0000659 3300044765 Bacteria 16979
560 Ga0466970_0008455 3300044765 Bacteria 5181
561 Ga0466957_0001020 3300044842 Bacteria 14442
562 Ga0466959_0001171 3300045049 Bacteria 15784
563 Ga0466959_0002228 3300045049 Bacteria 12350
564 Ga0451576_0000559 3300045051 Bacteria 79734
565 Ga0451576_0074522 3300045051 Bacteria 3532
566 Ga0451576_0103352 3300045051 Bacteria 2964
567 Ga0451576_0126788 3300045051 Bacteria 2659
568 Ga0451576_0333617 3300045051 Bacteria 1587
569 Ga0451576_0483882 3300045051 Bacteria 1300
570 Ga0466958_0015806 3300045836 Bacteria 4334
571 Ga0466958_0157085 3300045836 Bacteria 1435
572 Ga0466967_0033285 3300045976 Bacteria 4361
573 Ga0495629_0007894 3300046459 Bacteria 7829
574 Ga0495638_0087017 3300046460 Bacteria 1888
575 Ga0495650_0000002 3300046471 Bacteria 1057165
576 Ga0495650_0000478 3300046471 Bacteria 61296
577 Ga0495650_0042201 3300046471 Bacteria 1944
578 Ga0495605_0004250 3300046474 Bacteria 8440
579 Ga0495639_0018631 3300046475 Bacteria 3025
580 Ga0495585_0230808 3300046492 Bacteria 930
581 Ga0495594_0007426 3300046499 Bacteria 5639
582 Ga0495596_0000001 3300046500 Bacteria 501331
583 Ga0495607_0000175 3300046501 Bacteria 68131
584 Ga0495583_0000123 3300046506 Bacteria 131122
585 Ga0495606_0001921 3300046507 Bacteria 25804
586 Ga0495606_0216870 3300046507 Bacteria 1081
587 Ga0495610_0000002 3300046512 Bacteria 1282131
588 Ga0495610_0090865 3300046512 Bacteria 1384
589 Ga0495620_0103979 3300046515 Bacteria 1130
590 Ga0495632_0011879 3300046519 Bacteria 5059
591 Ga0495632_0014006 3300046519 Bacteria 4551
592 Ga0495632_0016647 3300046519 Bacteria 4082
593 Ga0495637_0000005 3300046520 Bacteria 447799
594 Ga0495643_0000002 3300046522 Bacteria 1131278
595 Ga0495643_0012023 3300046522 Bacteria 5238
596 Ga0495666_0010876 3300046526 Bacteria 4537
597 Ga0495654_0091466 3300046530 Bacteria 1411
598 Ga0495598_0015441 3300046537 Bacteria 1929
599 Ga0495598_0045602 3300046537 Bacteria 1300
600 Ga0495621_0002970 3300046539 Bacteria 4625
601 Ga0495621_0085259 3300046539 Bacteria 1183
602 Ga0495597_0000015 3300046542 Bacteria 172952
603 Ga0495597_0001359 3300046542 Bacteria 17738
604 Ga0495597_0042619 3300046542 Bacteria 2023
605 Ga0495645_0170854 3300046543 Bacteria 1497
606 Ga0495622_0150409 3300046557 Bacteria 1053
607 Ga0495668_0084528 3300046616 Bacteria 1740
608 Ga0495625_0001732 3300046660 Bacteria 25240
609 Ga0495625_0003731 3300046660 Bacteria 14831
610 Ga0495625_0004458 3300046660 Bacteria 13233
611 Ga0495625_0441550 3300046660 Bacteria 805
612 Ga0495625_0456567 3300046660 Bacteria 788
613 Ga0495658_0080334 3300046683 Bacteria 1912
614 Ga0495670_0214521 3300046691 Bacteria 1021
615 Ga0495671_0001269 3300046692 Bacteria 17216
616 Ga0495671_0280824 3300046692 Bacteria 802
617 Ga0495649_0005186 3300046694 Bacteria 8347
618 Ga0495649_0006920 3300046694 Bacteria 7013
619 Ga0495589_0002708 3300046794 Bacteria 9794
620 Ga0495672_0182064 3300047320 Bacteria 1063
621 Ga0495676_0236226 3300047321 Bacteria 1253
622 Ga0495680_0416232 3300047322 Bacteria 925
623 Ga0495687_002069 3300047443 Bacteria 16865
624 Ga0495673_0094227 3300047469 Bacteria 1219
625 Ga0495681_0000088 3300047470 Bacteria 79878
626 Ga0495681_0000426 3300047470 Bacteria 32387
627 Ga0495686_0000641 3300047472 Bacteria 48207
628 Ga0495686_0065561 3300047472 Bacteria 2245
629 Ga0495686_0138772 3300047472 Bacteria 1436
630 Ga0495593_0079323 3300047673 Bacteria 1699
631 Ga0495626_0000001 3300048091 Bacteria 1077129
632 Ga0495626_0156711 3300048091 Bacteria 957
633 Ga0496101_0072926 3300048904 Bacteria 2521
634 Ga0496102_0015830 3300048905 Bacteria 6575
635 Ga0496103_0150067 3300048906 Bacteria 1493
636 Ga0496104_0071764 3300048907 Bacteria 3292
637 Ga0496107_0004920 3300048910 Bacteria 9086
638 Ga0496108_0028353 3300048911 Bacteria 4632
639 Ga0496108_0065613 3300048911 Bacteria 3060
640 Ga0496108_0075008 3300048911 Bacteria 2857
641 Ga0496108_0358728 3300048911 Bacteria 1272
642 Ga0496109_0184833 3300048912 Bacteria 1958
643 Ga0496109_0185790 3300048912 Bacteria 1953
644 Ga0496109_0235792 3300048912 Bacteria 1722
645 Ga0496110_0008007 3300048913 Bacteria 8469
646 Ga0496110_0697743 3300048913 Bacteria 916
647 Ga0496111_0053758 3300048914 Bacteria 2910
648 Ga0496112_0277599 3300048915 Bacteria 1623
649 Ga0496114_0012468 3300048917 Bacteria 6804
650 Ga0496114_0047847 3300048917 Bacteria 3557
651 Ga0496114_0121229 3300048917 Bacteria 2249
652 Ga0496115_0036144 3300048918 Bacteria 3910
653 Ga0496121_0008194 3300048924 Bacteria 12405
654 Ga0496124_0000344 3300048927 Bacteria 85082
655 Ga0496124_0015117 3300048927 Bacteria 7419
656 Ga0496124_0188253 3300048927 Bacteria 1582
657 Ga0496125_0028418 3300048928 Bacteria 5052
658 Ga0496125_0387021 3300048928 Bacteria 822
659 Ga0501306_010277 3300049127 Bacteria 1175
660 Ga0501308_000125 3300049128 Bacteria 3817
661 Ga0501309_000072 3300049129 Bacteria 5562
662 Ga0501309_002714 3300049129 Bacteria 1939
663 Ga0501310_000166 3300049130 Bacteria 6374
664 Ga0501304_000040 3300049160 Bacteria 4578
665 Ga0495678_002620 3300049459 Bacteria 11999
666 Ga0495682_0077610 3300049460 Bacteria 1195
667 Ga0501312_000083 3300049528 Bacteria 5552
668 Ga0501312_000733 3300049528 Bacteria 2835
669 Ga0501314_004425 3300049530 Bacteria 1165
670 Ga0501320_000886 3300049536 Bacteria 1965
671 Ga0501043_0000004 3300049579 Bacteria 291085
672 Ga0501046_0000016 3300049580 Bacteria 234374
673 Ga0501047_0000012 3300049581 Bacteria 368824
674 Ga0501048_0000091 3300049582 Bacteria 48347
675 Ga0501206_016782 3300049653 Bacteria 1021
676 Ga0501211_000060 3300049658 Bacteria 7394
677 Ga0501222_000573 3300049662 Bacteria 5416
678 Ga0501233_001248 3300049668 Bacteria 4336
679 Ga0501235_005384 3300049669 Bacteria 2786
680 Ga0501236_007587 3300049670 Bacteria 1360
681 Ga0501249_019913 3300049679 Bacteria 1458
682 Ga0501258_000044 3300049687 Bacteria 6690
683 Ga0501229_000386 3300049706 Bacteria 4951
684 Ga0501262_000731 3300049759 Bacteria 3797
685 Ga0501271_002647 3300049768 Bacteria 1611
686 Ga0501272_002879 3300049769 Bacteria 1724
687 Ga0501045_0013429 3300049824 Bacteria 5786
688 nmdc:mga03683_11795_c1 3300050489 Bacteria 3176
689 nmdc:mga03683_26488_c1 3300050489 Bacteria 2288
690 nmdc:mga03n38_10564_c1 3300050490 Bacteria 3404
691 nmdc:mga0k408_18851_c1 3300050493 Bacteria 3852
692 nmdc:mga0k408_251935_c1 3300050493 Bacteria 1054
693 nmdc:mga0k408_2669_c1 3300050493 Bacteria 9460
694 nmdc:mga0k408_2914_c1 3300050493 Bacteria 9064
695 nmdc:mga0k408_309_c2 3300050493 Bacteria 14319
696 nmdc:mga0k408_3267_c1 3300050493 Bacteria 8579
697 nmdc:mga0k408_404264_c1 3300050493 Bacteria 813
698 nmdc:mga0k408_540_c1 3300050493 Bacteria 20847
699 nmdc:mga0k408_79520_c1 3300050493 Bacteria 1918
700 nmdc:mga06z11_22603_c1 3300050494 Bacteria 2940
701 nmdc:mga06z11_335668_c1 3300050494 Bacteria 903
702 nmdc:mga06z11_60609_c1 3300050494 Bacteria 1971
703 nmdc:mga07m45_12293_c1 3300050496 Bacteria 4521
704 nmdc:mga07m45_12332_c1 3300050496 Bacteria 4515
705 nmdc:mga07m45_16204_c1 3300050496 Bacteria 3990
706 nmdc:mga07m45_239_c1 3300050496 Bacteria 22183
707 nmdc:mga07m45_32789_c1 3300050496 Bacteria 2881
708 nmdc:mga07m45_3604_c1 3300050496 Bacteria 7477
709 nmdc:mga07m45_370_c1 3300050496 Bacteria 18428
710 nmdc:mga07m45_41801_c1 3300050496 Bacteria 2568
711 nmdc:mga07m45_7408_c1 3300050496 Bacteria 5607
712 nmdc:mga0sz30_153264_c1 3300050516 Bacteria 1020
713 nmdc:mga0sz30_54366_c1 3300050516 Bacteria 1703
714 Ga0500635_0000187 3300053080 Bacteria 31687
715 Ga0495619_0313064 3300053085 Bacteria 1087
716 Ga0500578_0025540 3300053086 Bacteria 3789
717 Ga0500651_0101228 3300053093 Bacteria 1766
718 Ga0500593_053320 3300053117 Bacteria 1790
719 Ga0500607_143161 3300053121 Bacteria 1121
720 Ga0500652_023850 3300053131 Bacteria 2330
721 Ga0500559_0026005 3300053136 Bacteria 2491
722 Ga0500561_0000912 3300053137 Bacteria 4722
723 Ga0500568_0004552 3300053139 Bacteria 7395
724 Ga0500568_0020559 3300053139 Bacteria 2853
725 Ga0500622_0000874 3300053156 Bacteria 25654
726 Ga0500636_0066706 3300053177 Bacteria 2092
727 Ga0500645_006071 3300053730 Bacteria 4356
728 Ga0500587_003671 3300053739 Bacteria 2133
729 Ga0500661_010132 3300055283 Bacteria 1718
730 Ga0466962_0007408 3300061719 Bacteria 5266

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046539 Ga0495621_0085259 Ga0495621_0085259_16_696 195
2 3300009147 Ga0114129_10241375 Ga0114129_102413752 209
3 3300046537 Ga0495598_0015441 Ga0495598_0015441_302_1027 209
4 3300053117 Ga0500593_053320 Ga0500593_053320_285_1022 209
5 3300005445 Ga0070708_100224098 Ga0070708_1002240981 210
6 3300045051 Ga0451576_0126788 Ga0451576_0126788_800_1525 218
7 3300035121 Ga0373960_0072452 Ga0373960_0072452_376_1056 219
8 3300032002 Ga0307416_100942918 Ga0307416_1009429181 220
9 3300021361 Ga0213872_10000070 Ga0213872_1000007064 221
10 3300039447 Ga0436361_0812713 Ga0436361_0812713_29625_30344 221
11 3300049127 Ga0501306_010277 Ga0501306_010277_392_1114 221
12 3300049528 Ga0501312_000733 Ga0501312_000733_1402_2124 221
13 3300028794 Ga0307515_10000165 Ga0307515_1000016531 222
14 3300005456 Ga0070678_100094551 Ga0070678_1000945513 223
15 3300026121 Ga0207683_10025099 Ga0207683_100250994 223
16 3300031730 Ga0307516_10051235 Ga0307516_100512353 223
17 3300039447 Ga0436361_0763381 Ga0436361_0763381_2514_3233 224
18 3300005364 Ga0070673_100018847 Ga0070673_1000188474 225
19 3300005548 Ga0070665_100235654 Ga0070665_1002356542 225
20 3300025960 Ga0207651_10002160 Ga0207651_100021604 225
21 3300028794 Ga0307515_10000131 Ga0307515_1000013141 225
22 3300003794 Ga0055531_10028054 Ga0055531_100280541 226
23 3300005548 Ga0070665_100340176 Ga0070665_1003401762 226
24 3300025297 Ga0209758_1000193 Ga0209758_1000193102 226
25 3300028379 Ga0268266_10259244 Ga0268266_102592442 226
26 3300028379 Ga0268266_10555972 Ga0268266_105559722 226
27 3300035242 Ga0373962_0034740 Ga0373962_0034740_698_1384 226
28 3300046507 Ga0495606_0216870 Ga0495606_0216870_294_1022 226
29 3300053093 Ga0500651_0101228 Ga0500651_0101228_293_1024 226
30 3300009551 Ga0105238_10009732 Ga0105238_100097328 227
31 3300010375 Ga0105239_10000417 Ga0105239_1000041740 227
32 3300039437 Ga0436365_0394409 Ga0436365_0394409_111_836 227
33 3300047472 Ga0495686_0000641 Ga0495686_0000641_14315_15040 228
34 3300050493 nmdc:mga0k408_251935_c1 nmdc:mga0k408_251935_c1_148_876 228
35 3300009093 Ga0105240_10524014 Ga0105240_105240142 229
36 3300025256 Ga0209759_1000898 Ga0209759_10008988 229
37 3300025256 Ga0209759_1037097 Ga0209759_10370971 229
38 3300025909 Ga0207705_10134771 Ga0207705_101347712 229
39 3300025919 Ga0207657_10342328 Ga0207657_103423282 229
40 3300025920 Ga0207649_10112887 Ga0207649_101128871 229
41 3300025932 Ga0207690_10154917 Ga0207690_101549172 229
42 3300025273 Ga0209673_1009846 Ga0209673_10098463 230
43 3300048912 Ga0496109_0235792 Ga0496109_0235792_64_792 230
44 3300002705 JGI25156J39149_1008311 JGI25156J39149_10083113 231
45 3300003761 Ga0055535_1000229 Ga0055535_100022945 231
46 3300003763 Ga0055529_1000064 Ga0055529_1000064165 231
47 3300025242 Ga0209258_100124 Ga0209258_10012415 231
48 3300025246 Ga0209646_1016918 Ga0209646_10169181 231
49 3300025256 Ga0209759_1000652 Ga0209759_100065220 231
50 3300025272 Ga0209455_1000114 Ga0209455_1000114165 231
51 3300031239 Ga0265328_10027240 Ga0265328_100272402 231
52 3300031250 Ga0265331_10091700 Ga0265331_100917002 231
53 3300031251 Ga0265327_10000028 Ga0265327_10000028113 231
54 3300031456 Ga0307513_10001541 Ga0307513_1000154118 231
55 3300005327 Ga0070658_10186426 Ga0070658_101864262 232
56 3300005329 Ga0070683_100049545 Ga0070683_1000495452 232
57 3300005344 Ga0070661_100471212 Ga0070661_1004712121 232
58 3300005577 Ga0068857_100445996 Ga0068857_1004459962 232
59 3300005578 Ga0068854_100022875 Ga0068854_1000228756 232
60 3300005834 Ga0068851_10100469 Ga0068851_101004692 232
61 3300009551 Ga0105238_10070600 Ga0105238_100706002 232
62 3300025321 Ga0207656_10115967 Ga0207656_101159672 232
63 3300025909 Ga0207705_10174068 Ga0207705_101740682 232
64 3300026078 Ga0207702_10190137 Ga0207702_101901372 232
65 3300026142 Ga0207698_10128705 Ga0207698_101287052 232
66 3300033180 Ga0307510_10007541 Ga0307510_1000754110 232
67 3300044712 Ga0453684_0064995 Ga0453684_0064995_880_1605 232
68 3300053121 Ga0500607_143161 Ga0500607_143161_133_858 232
69 3300053131 Ga0500652_023850 Ga0500652_023850_707_1432 232
70 3300005328 Ga0070676_10203141 Ga0070676_102031412 233
71 3300005331 Ga0070670_100164150 Ga0070670_1001641502 233
72 3300005353 Ga0070669_100012537 Ga0070669_1000125372 233
73 3300005354 Ga0070675_100067887 Ga0070675_1000678872 233
74 3300005356 Ga0070674_100010227 Ga0070674_1000102272 233
75 3300005364 Ga0070673_100027663 Ga0070673_1000276632 233
76 3300005459 Ga0068867_100036682 Ga0068867_1000366822 233
77 3300005543 Ga0070672_100007320 Ga0070672_1000073206 233
78 3300009093 Ga0105240_10015301 Ga0105240_100153016 233
79 3300009545 Ga0105237_10000441 Ga0105237_1000044119 233
80 3300014326 Ga0157380_10269980 Ga0157380_102699802 233
81 3300025315 Ga0207697_10029145 Ga0207697_100291452 233
82 3300025913 Ga0207695_10024383 Ga0207695_100243835 233
83 3300025914 Ga0207671_10001929 Ga0207671_1000192923 233
84 3300025923 Ga0207681_10062794 Ga0207681_100627942 233
85 3300025924 Ga0207694_10062742 Ga0207694_100627421 233
86 3300025925 Ga0207650_10072212 Ga0207650_100722122 233
87 3300025926 Ga0207659_10090565 Ga0207659_100905652 233
88 3300025937 Ga0207669_10027345 Ga0207669_100273452 233
89 3300025940 Ga0207691_10006575 Ga0207691_100065756 233
90 3300026095 Ga0207676_10476828 Ga0207676_104768282 233
91 3300026121 Ga0207683_10861978 Ga0207683_108619781 233
92 3300044656 Ga0466969_0002697 Ga0466969_0002697_4590_5318 233
93 3300044683 Ga0466965_0000290 Ga0466965_0000290_11764_12492 233
94 3300044684 Ga0466966_0001287 Ga0466966_0001287_2810_3538 233
95 3300044706 Ga0466964_0000836 Ga0466964_0000836_4544_5272 233
96 3300044719 Ga0466971_0000304 Ga0466971_0000304_11551_12279 233
97 3300044735 Ga0466968_0006186 Ga0466968_0006186_373_1101 233
98 3300044765 Ga0466970_0000659 Ga0466970_0000659_10250_10978 233
99 3300044842 Ga0466957_0001020 Ga0466957_0001020_9890_10618 233
100 3300045049 Ga0466959_0002228 Ga0466959_0002228_823_1551 233
101 3300045836 Ga0466958_0015806 Ga0466958_0015806_2030_2758 233
102 3300046537 Ga0495598_0045602 Ga0495598_0045602_23_724 233
103 3300046539 Ga0495621_0002970 Ga0495621_0002970_796_1521 233
104 3300048913 Ga0496110_0697743 Ga0496110_0697743_14_715 233
105 3300050493 nmdc:mga0k408_404264_c1 nmdc:mga0k408_404264_c1_92_802 233
106 3300005328 Ga0070676_10001564 Ga0070676_100015645 234
107 3300005334 Ga0068869_100032102 Ga0068869_1000321024 234
108 3300005338 Ga0068868_100015353 Ga0068868_1000153534 234
109 3300005338 Ga0068868_100150412 Ga0068868_1001504122 234
110 3300005341 Ga0070691_10093657 Ga0070691_100936572 234
111 3300005347 Ga0070668_100017395 Ga0070668_1000173952 234
112 3300005353 Ga0070669_100009995 Ga0070669_1000099956 234
113 3300005354 Ga0070675_100005126 Ga0070675_10000512611 234
114 3300005354 Ga0070675_100018606 Ga0070675_1000186066 234
115 3300005355 Ga0070671_100164531 Ga0070671_1001645312 234
116 3300005455 Ga0070663_100040338 Ga0070663_1000403383 234
117 3300005456 Ga0070678_100383983 Ga0070678_1003839832 234
118 3300005457 Ga0070662_100011606 Ga0070662_1000116065 234
119 3300005459 Ga0068867_100013500 Ga0068867_1000135004 234
120 3300005459 Ga0068867_100159120 Ga0068867_1001591201 234
121 3300005535 Ga0070684_100431796 Ga0070684_1004317962 234
122 3300005563 Ga0068855_100036949 Ga0068855_1000369495 234
123 3300005614 Ga0068856_100024851 Ga0068856_1000248514 234
124 3300005616 Ga0068852_100043701 Ga0068852_1000437014 234
125 3300005618 Ga0068864_100710494 Ga0068864_1007104941 234
126 3300005719 Ga0068861_100022301 Ga0068861_1000223014 234
127 3300005842 Ga0068858_100120280 Ga0068858_1001202802 234
128 3300005843 Ga0068860_100097662 Ga0068860_1000976624 234
129 3300005844 Ga0068862_100063807 Ga0068862_1000638072 234
130 3300006358 Ga0068871_100020051 Ga0068871_1000200512 234
131 3300009098 Ga0105245_10013187 Ga0105245_100131874 234
132 3300009148 Ga0105243_10091822 Ga0105243_100918223 234
133 3300010375 Ga0105239_10081431 Ga0105239_100814312 234
134 3300013102 Ga0157371_10167673 Ga0157371_101676732 234
135 3300013105 Ga0157369_10842038 Ga0157369_108420381 234
136 3300013296 Ga0157374_10029986 Ga0157374_100299862 234
137 3300013306 Ga0163162_10025537 Ga0163162_100255373 234
138 3300013307 Ga0157372_10033672 Ga0157372_100336724 234
139 3300013308 Ga0157375_10226234 Ga0157375_102262341 234
140 3300014325 Ga0163163_11011645 Ga0163163_110116451 234
141 3300014745 Ga0157377_10016804 Ga0157377_100168041 234
142 3300014968 Ga0157379_10019670 Ga0157379_100196702 234
143 3300014969 Ga0157376_10014494 Ga0157376_100144942 234
144 3300017792 Ga0163161_10019047 Ga0163161_100190473 234
145 3300021361 Ga0213872_10000417 Ga0213872_1000041726 234
146 3300025315 Ga0207697_10101257 Ga0207697_101012572 234
147 3300025893 Ga0207682_10026607 Ga0207682_100266073 234
148 3300025901 Ga0207688_10036249 Ga0207688_100362493 234
149 3300025907 Ga0207645_10001787 Ga0207645_100017877 234
150 3300025919 Ga0207657_10044064 Ga0207657_100440642 234
151 3300025923 Ga0207681_10035283 Ga0207681_100352833 234
152 3300025926 Ga0207659_10020790 Ga0207659_100207903 234
153 3300025927 Ga0207687_10082878 Ga0207687_100828783 234
154 3300025931 Ga0207644_10024152 Ga0207644_100241524 234
155 3300025931 Ga0207644_10368925 Ga0207644_103689252 234
156 3300025933 Ga0207706_10000993 Ga0207706_1000099312 234
157 3300025935 Ga0207709_10084466 Ga0207709_100844662 234
158 3300025941 Ga0207711_10005046 Ga0207711_1000504612 234
159 3300025942 Ga0207689_10000855 Ga0207689_1000085524 234
160 3300025945 Ga0207679_10453235 Ga0207679_104532351 234
161 3300025949 Ga0207667_10159584 Ga0207667_101595842 234
162 3300026023 Ga0207677_10017341 Ga0207677_100173412 234
163 3300026023 Ga0207677_10158644 Ga0207677_101586442 234
164 3300026035 Ga0207703_10246180 Ga0207703_102461802 234
165 3300026041 Ga0207639_10015071 Ga0207639_100150714 234
166 3300026067 Ga0207678_10023385 Ga0207678_100233853 234
167 3300026078 Ga0207702_10047997 Ga0207702_100479975 234
168 3300026089 Ga0207648_10040097 Ga0207648_100400972 234
169 3300026116 Ga0207674_10026355 Ga0207674_100263552 234
170 3300026116 Ga0207674_10112313 Ga0207674_101123132 234
171 3300026118 Ga0207675_100000911 Ga0207675_10000091124 234
172 3300026121 Ga0207683_10247414 Ga0207683_102474142 234
173 3300026142 Ga0207698_10006990 Ga0207698_100069903 234
174 3300028380 Ga0268265_10158640 Ga0268265_101586402 234
175 3300028381 Ga0268264_10223286 Ga0268264_102232863 234
176 3300034820 Ga0373959_0040877 Ga0373959_0040877_10_735 234
177 3300035112 Ga0373932_0116696 Ga0373932_0116696_121_846 234
178 3300035242 Ga0373962_0010650 Ga0373962_0010650_1050_1775 234
179 3300035691 Ga0373931_0001365 Ga0373931_0001365_4463_5188 234
180 3300039447 Ga0436361_0275830 Ga0436361_0275830_4882_5616 234
181 3300045051 Ga0451576_0103352 Ga0451576_0103352_145_870 234
182 3300045051 Ga0451576_0483882 Ga0451576_0483882_70_798 234
183 3300048904 Ga0496101_0072926 Ga0496101_0072926_887_1612 234
184 3300048910 Ga0496107_0004920 Ga0496107_0004920_4159_4884 234
185 3300048911 Ga0496108_0028353 Ga0496108_0028353_3783_4508 234
186 3300048912 Ga0496109_0184833 Ga0496109_0184833_571_1296 234
187 3300048913 Ga0496110_0008007 Ga0496110_0008007_1887_2612 234
188 3300048914 Ga0496111_0053758 Ga0496111_0053758_30_755 234
189 3300048915 Ga0496112_0277599 Ga0496112_0277599_415_1140 234
190 3300048917 Ga0496114_0047847 Ga0496114_0047847_2344_3069 234
191 3300048918 Ga0496115_0036144 Ga0496115_0036144_887_1612 234
192 3300003323 rootH1_10031598 rootH1_100315982 235
193 3300013296 Ga0157374_10707214 Ga0157374_107072141 235
194 3300035691 Ga0373931_0001168 Ga0373931_0001168_3553_4281 235
195 3300046512 Ga0495610_0090865 Ga0495610_0090865_422_1147 235
196 3300046519 Ga0495632_0011879 Ga0495632_0011879_1854_2579 235
197 3300046660 Ga0495625_0456567 Ga0495625_0456567_42_767 235
198 3300046694 Ga0495649_0005186 Ga0495649_0005186_6124_6849 235
199 3300048091 Ga0495626_0156711 Ga0495626_0156711_180_905 235
200 3300049460 Ga0495682_0077610 Ga0495682_0077610_372_1097 235
201 3300053080 Ga0500635_0000187 Ga0500635_0000187_19719_20444 236
202 iso_pu_bacteria 2721755763 2723879822 236
203 iso_pu_bacteria 2585428062 2587756219 237
204 iso_pu_bacteria 2643221544 2643746401 237
205 iso_pu_bacteria 2643221585 2643933122 237
206 iso_pu_bacteria 2643221639 2644217265 237
207 iso_pu_bacteria 2643221644 2644243740 237
208 iso_pu_bacteria 2643221646 2644258966 237
209 iso_pu_bacteria 2643221654 2644301795 237
210 iso_pu_bacteria 2643221656 2644314371 237
211 iso_pu_bacteria 2643221660 2644338730 237
212 iso_pu_bacteria 2738541337 2739055700 237
213 iso_pu_bacteria 2831864461 2831866170 237
214 iso_pu_bacteria 2886848708 2886852453 237
215 3300009177 Ga0105248_10022270 Ga0105248_1002227010 238
216 3300013297 Ga0157378_10501530 Ga0157378_105015302 238
217 3300025304 Ga0209257_1060265 Ga0209257_10602652 238
218 3300041456 Ga0451795_0619171 Ga0451795_0619171_134_859 238
219 3300047472 Ga0495686_0138772 Ga0495686_0138772_628_1344 238
220 3300048906 Ga0496103_0150067 Ga0496103_0150067_521_1237 238
221 3300048907 Ga0496104_0071764 Ga0496104_0071764_1250_1966 238
222 3300048911 Ga0496108_0065613 Ga0496108_0065613_1937_2653 238
223 3300048912 Ga0496109_0185790 Ga0496109_0185790_168_884 238
224 3300053086 Ga0500578_0025540 Ga0500578_0025540_1844_2560 238
225 3300053730 Ga0500645_006071 Ga0500645_006071_1267_1983 238
226 3300044656 Ga0466969_0019974 Ga0466969_0019974_705_1448 239
227 3300044666 Ga0466977_0000007 Ga0466977_0000007_1369_2112 239
228 3300046471 Ga0495650_0000002 Ga0495650_0000002_563347_564093 239
229 3300046512 Ga0495610_0000002 Ga0495610_0000002_207177_207923 239
230 3300046520 Ga0495637_0000005 Ga0495637_0000005_202961_203707 239
231 3300046522 Ga0495643_0000002 Ga0495643_0000002_220484_221230 239
232 3300046542 Ga0495597_0000015 Ga0495597_0000015_68042_68788 239
233 3300046660 Ga0495625_0004458 Ga0495625_0004458_3325_4071 239
234 3300046692 Ga0495671_0001269 Ga0495671_0001269_12556_13302 239
235 3300047469 Ga0495673_0094227 Ga0495673_0094227_202_948 239
236 3300047470 Ga0495681_0000088 Ga0495681_0000088_28990_29736 239
237 3300047472 Ga0495686_0065561 Ga0495686_0065561_423_1169 239
238 3300049459 Ga0495678_002620 Ga0495678_002620_560_1306 239
239 3300006195 Ga0075366_10029844 Ga0075366_100298444 240
240 3300032002 Ga0307416_100078114 Ga0307416_1000781141 240
241 3300032005 Ga0307411_10392620 Ga0307411_103926201 240
242 3300046471 Ga0495650_0000478 Ga0495650_0000478_42096_42848 240
243 3300046474 Ga0495605_0004250 Ga0495605_0004250_4647_5399 240
244 3300046499 Ga0495594_0007426 Ga0495594_0007426_3614_4366 240
245 3300046500 Ga0495596_0000001 Ga0495596_0000001_4331_5083 240
246 3300046501 Ga0495607_0000175 Ga0495607_0000175_54046_54798 240
247 3300046519 Ga0495632_0014006 Ga0495632_0014006_1588_2340 240
248 3300046526 Ga0495666_0010876 Ga0495666_0010876_999_1751 240
249 3300046530 Ga0495654_0091466 Ga0495654_0091466_633_1385 240
250 3300046542 Ga0495597_0001359 Ga0495597_0001359_10389_11141 240
251 3300047320 Ga0495672_0182064 Ga0495672_0182064_117_869 240
252 3300047470 Ga0495681_0000426 Ga0495681_0000426_19942_20694 240
253 3300048091 Ga0495626_0000001 Ga0495626_0000001_374443_375195 240
254 3300049653 Ga0501206_016782 Ga0501206_016782_266_988 240
255 3300050493 nmdc:mga0k408_18851_c1 nmdc:mga0k408_18851_c1_1791_2513 240
256 3300002705 JGI25156J39149_1000819 JGI25156J39149_10008191 241
257 3300002738 JGI25154J39366_1000824 JGI25154J39366_10008246 241
258 3300002741 JGI25157J39369_1000027 JGI25157J39369_1000027108 241
259 3300002772 JGI25164J39214_1003672 JGI25164J39214_10036722 241
260 3300002773 JGI25152J39213_1001390 JGI25152J39213_10013905 241
261 3300002774 JGI25150J39212_1012465 JGI25150J39212_10124651 241
262 3300003215 JGI25153J46596_10003685 JGI25153J46596_100036858 241
263 3300003316 rootH1_10004916 rootH1_100049162 241
264 3300003316 rootH1_10006365 rootH1_1000636511 241
265 3300003320 rootH2_10047071 rootH2_100470714 241
266 3300003322 rootL2_10003861 rootL2_1000386118 241
267 3300003322 rootL2_10009273 rootL2_1000927320 241
268 3300003323 rootH1_10006621 rootH1_100066215 241
269 3300003323 rootH1_10019349 rootH1_1001934910 241
270 3300003323 rootH1_10027533 rootH1_100275334 241
271 3300003752 Ga0055539_1004569 Ga0055539_10045691 241
272 3300003752 Ga0055539_1004861 Ga0055539_10048611 241
273 3300003756 Ga0055533_1000073 Ga0055533_1000073120 241
274 3300003759 Ga0055525_1000038 Ga0055525_1000038106 241
275 3300003759 Ga0055525_1000687 Ga0055525_10006874 241
276 3300003771 Ga0055526_1002388 Ga0055526_10023887 241
277 3300003791 Ga0055530_10029662 Ga0055530_100296622 241
278 3300003792 Ga0055540_1009954 Ga0055540_10099543 241
279 3300003792 Ga0055540_1024456 Ga0055540_10244562 241
280 3300003794 Ga0055531_10003179 Ga0055531_100031796 241
281 3300004625 Ga0055543_1002234 Ga0055543_10022342 241
282 3300004625 Ga0055543_1013363 Ga0055543_10133631 241
283 3300005262 Ga0065165_1000283 Ga0065165_100028332 241
284 3300005327 Ga0070658_10112110 Ga0070658_101121102 241
285 3300005327 Ga0070658_10162910 Ga0070658_101629101 241
286 3300005327 Ga0070658_10336633 Ga0070658_103366332 241
287 3300005327 Ga0070658_10386740 Ga0070658_103867402 241
288 3300005328 Ga0070676_10008248 Ga0070676_100082484 241
289 3300005328 Ga0070676_10021053 Ga0070676_100210532 241
290 3300005331 Ga0070670_100058457 Ga0070670_1000584572 241
291 3300005331 Ga0070670_100078920 Ga0070670_1000789202 241
292 3300005334 Ga0068869_100006946 Ga0068869_1000069465 241
293 3300005335 Ga0070666_10010360 Ga0070666_100103603 241
294 3300005337 Ga0070682_100011477 Ga0070682_1000114772 241
295 3300005344 Ga0070661_100000220 Ga0070661_10000022041 241
296 3300005344 Ga0070661_100122816 Ga0070661_1001228161 241
297 3300005347 Ga0070668_100404298 Ga0070668_1004042982 241
298 3300005354 Ga0070675_100065579 Ga0070675_1000655792 241
299 3300005354 Ga0070675_100085117 Ga0070675_1000851172 241
300 3300005354 Ga0070675_100235705 Ga0070675_1002357051 241
301 3300005355 Ga0070671_100027816 Ga0070671_1000278164 241
302 3300005356 Ga0070674_100015369 Ga0070674_1000153692 241
303 3300005356 Ga0070674_100034505 Ga0070674_1000345053 241
304 3300005364 Ga0070673_100007297 Ga0070673_1000072972 241
305 3300005365 Ga0070688_100323478 Ga0070688_1003234782 241
306 3300005366 Ga0070659_100011721 Ga0070659_1000117215 241
307 3300005366 Ga0070659_100279317 Ga0070659_1002793172 241
308 3300005366 Ga0070659_100541699 Ga0070659_1005416991 241
309 3300005367 Ga0070667_100015900 Ga0070667_1000159007 241
310 3300005367 Ga0070667_100413156 Ga0070667_1004131561 241
311 3300005367 Ga0070667_100644164 Ga0070667_1006441641 241
312 3300005441 Ga0070700_100072194 Ga0070700_1000721941 241
313 3300005455 Ga0070663_100000511 Ga0070663_10000051112 241
314 3300005455 Ga0070663_100047246 Ga0070663_1000472463 241
315 3300005455 Ga0070663_100147313 Ga0070663_1001473132 241
316 3300005456 Ga0070678_100299788 Ga0070678_1002997882 241
317 3300005457 Ga0070662_100025773 Ga0070662_1000257733 241
318 3300005457 Ga0070662_100059050 Ga0070662_1000590502 241
319 3300005457 Ga0070662_100075848 Ga0070662_1000758482 241
320 3300005457 Ga0070662_100162304 Ga0070662_1001623041 241
321 3300005457 Ga0070662_100179951 Ga0070662_1001799511 241
322 3300005457 Ga0070662_100182899 Ga0070662_1001828992 241
323 3300005458 Ga0070681_10803284 Ga0070681_108032841 241
324 3300005459 Ga0068867_100000790 Ga0068867_10000079010 241
325 3300005459 Ga0068867_100026443 Ga0068867_1000264432 241
326 3300005459 Ga0068867_100052050 Ga0068867_1000520501 241
327 3300005467 Ga0070706_100006257 Ga0070706_10000625714 241
328 3300005467 Ga0070706_100091805 Ga0070706_1000918052 241
329 3300005471 Ga0070698_100147344 Ga0070698_1001473442 241
330 3300005518 Ga0070699_100039909 Ga0070699_1000399093 241
331 3300005535 Ga0070684_100184945 Ga0070684_1001849451 241
332 3300005539 Ga0068853_100054053 Ga0068853_1000540531 241
333 3300005543 Ga0070672_100025782 Ga0070672_1000257823 241
334 3300005543 Ga0070672_100077068 Ga0070672_1000770682 241
335 3300005543 Ga0070672_100201268 Ga0070672_1002012682 241
336 3300005543 Ga0070672_100248257 Ga0070672_1002482572 241
337 3300005548 Ga0070665_100593165 Ga0070665_1005931651 241
338 3300005549 Ga0070704_100738292 Ga0070704_1007382921 241
339 3300005563 Ga0068855_100232839 Ga0068855_1002328392 241
340 3300005563 Ga0068855_100234373 Ga0068855_1002343732 241
341 3300005563 Ga0068855_100804494 Ga0068855_1008044941 241
342 3300005564 Ga0070664_100000267 Ga0070664_10000026731 241
343 3300005577 Ga0068857_100029449 Ga0068857_1000294492 241
344 3300005577 Ga0068857_100095589 Ga0068857_1000955893 241
345 3300005578 Ga0068854_100024167 Ga0068854_1000241672 241
346 3300005614 Ga0068856_100002053 Ga0068856_10000205310 241
347 3300005614 Ga0068856_100341809 Ga0068856_1003418092 241
348 3300005616 Ga0068852_100056636 Ga0068852_1000566362 241
349 3300005616 Ga0068852_100093722 Ga0068852_1000937223 241
350 3300005616 Ga0068852_100142284 Ga0068852_1001422842 241
351 3300005616 Ga0068852_100216417 Ga0068852_1002164172 241
352 3300005616 Ga0068852_100356599 Ga0068852_1003565992 241
353 3300005616 Ga0068852_100679484 Ga0068852_1006794841 241
354 3300005617 Ga0068859_100106772 Ga0068859_1001067723 241
355 3300005617 Ga0068859_100108883 Ga0068859_1001088832 241
356 3300005618 Ga0068864_100060031 Ga0068864_1000600313 241
357 3300005618 Ga0068864_100219491 Ga0068864_1002194912 241
358 3300005618 Ga0068864_100421101 Ga0068864_1004211011 241
359 3300005718 Ga0068866_10110123 Ga0068866_101101232 241
360 3300005719 Ga0068861_100015673 Ga0068861_1000156734 241
361 3300005719 Ga0068861_100022104 Ga0068861_1000221043 241
362 3300005834 Ga0068851_10037386 Ga0068851_100373862 241
363 3300005840 Ga0068870_10267380 Ga0068870_102673801 241
364 3300005841 Ga0068863_100049597 Ga0068863_1000495973 241
365 3300005842 Ga0068858_100006620 Ga0068858_10000662014 241
366 3300005843 Ga0068860_100172086 Ga0068860_1001720862 241
367 3300005844 Ga0068862_100228663 Ga0068862_1002286632 241
368 3300006048 Ga0075363_100038359 Ga0075363_1000383592 241
369 3300006051 Ga0075364_10053170 Ga0075364_100531702 241
370 3300006177 Ga0075362_10012284 Ga0075362_100122842 241
371 3300006177 Ga0075362_10028110 Ga0075362_100281102 241
372 3300006178 Ga0075367_10002209 Ga0075367_100022093 241
373 3300006178 Ga0075367_10088704 Ga0075367_100887042 241
374 3300006186 Ga0075369_10023004 Ga0075369_100230042 241
375 3300006195 Ga0075366_10007775 Ga0075366_100077751 241
376 3300006195 Ga0075366_10013362 Ga0075366_100133626 241
377 3300006195 Ga0075366_10078048 Ga0075366_100780482 241
378 3300006195 Ga0075366_10086045 Ga0075366_100860452 241
379 3300006195 Ga0075366_10134156 Ga0075366_101341562 241
380 3300006195 Ga0075366_10356339 Ga0075366_103563392 241
381 3300006237 Ga0097621_100168995 Ga0097621_1001689952 241
382 3300006353 Ga0075370_10000201 Ga0075370_1000020127 241
383 3300006353 Ga0075370_10001234 Ga0075370_100012344 241
384 3300006353 Ga0075370_10003435 Ga0075370_100034352 241
385 3300006353 Ga0075370_10009591 Ga0075370_100095912 241
386 3300006353 Ga0075370_10010256 Ga0075370_100102564 241
387 3300006353 Ga0075370_10029300 Ga0075370_100293003 241
388 3300006353 Ga0075370_10034024 Ga0075370_100340243 241
389 3300006353 Ga0075370_10044650 Ga0075370_100446502 241
390 3300006353 Ga0075370_10044825 Ga0075370_100448252 241
391 3300006358 Ga0068871_100081992 Ga0068871_1000819922 241
392 3300006881 Ga0068865_100014886 Ga0068865_1000148862 241
393 3300006881 Ga0068865_100221348 Ga0068865_1002213481 241
394 3300006931 Ga0097620_100106761 Ga0097620_1001067613 241
395 3300006931 Ga0097620_100108885 Ga0097620_1001088852 241
396 3300006944 Ga0099823_1000083 Ga0099823_100008317 241
397 3300006946 Ga0079104_1000013 Ga0079104_100001318 241
398 3300009093 Ga0105240_10118894 Ga0105240_101188942 241
399 3300009098 Ga0105245_10228508 Ga0105245_102285082 241
400 3300009098 Ga0105245_10470397 Ga0105245_104703972 241
401 3300009148 Ga0105243_10002845 Ga0105243_1000284510 241
402 3300009148 Ga0105243_10004374 Ga0105243_100043742 241
403 3300009148 Ga0105243_10010965 Ga0105243_100109652 241
404 3300009148 Ga0105243_10078629 Ga0105243_100786293 241
405 3300009148 Ga0105243_10120701 Ga0105243_101207012 241
406 3300009148 Ga0105243_10124756 Ga0105243_101247562 241
407 3300009176 Ga0105242_10313640 Ga0105242_103136402 241
408 3300009176 Ga0105242_10351715 Ga0105242_103517152 241
409 3300009176 Ga0105242_10726124 Ga0105242_107261241 241
410 3300009177 Ga0105248_10095190 Ga0105248_100951901 241
411 3300009177 Ga0105248_10124017 Ga0105248_101240173 241
412 3300009545 Ga0105237_10005851 Ga0105237_1000585113 241
413 3300009551 Ga0105238_10171909 Ga0105238_101719092 241
414 3300009553 Ga0105249_10029198 Ga0105249_100291984 241
415 3300010375 Ga0105239_10037957 Ga0105239_100379572 241
416 3300010375 Ga0105239_10083030 Ga0105239_100830303 241
417 3300010375 Ga0105239_10239407 Ga0105239_102394072 241
418 3300011119 Ga0105246_10115928 Ga0105246_101159282 241
419 3300012497 Ga0157319_1000037 Ga0157319_10000372 241
420 3300013105 Ga0157369_10028648 Ga0157369_100286486 241
421 3300013296 Ga0157374_10524788 Ga0157374_105247881 241
422 3300013297 Ga0157378_10095407 Ga0157378_100954073 241
423 3300013297 Ga0157378_10208963 Ga0157378_102089633 241
424 3300013306 Ga0163162_10065803 Ga0163162_100658033 241
425 3300013306 Ga0163162_10939741 Ga0163162_109397411 241
426 3300013308 Ga0157375_10196704 Ga0157375_101967042 241
427 3300013308 Ga0157375_11210744 Ga0157375_112107441 241
428 3300014745 Ga0157377_10000091 Ga0157377_1000009154 241
429 3300014745 Ga0157377_10198369 Ga0157377_101983691 241
430 3300014968 Ga0157379_10048077 Ga0157379_100480774 241
431 3300014968 Ga0157379_10257130 Ga0157379_102571302 241
432 3300014968 Ga0157379_10446633 Ga0157379_104466332 241
433 3300014969 Ga0157376_10325280 Ga0157376_103252802 241
434 3300014969 Ga0157376_10494306 Ga0157376_104943061 241
435 3300017792 Ga0163161_10031397 Ga0163161_100313975 241
436 3300021361 Ga0213872_10000018 Ga0213872_1000001877 241
437 3300025226 Ga0209674_100039 Ga0209674_100039312 241
438 3300025230 Ga0209563_100005 Ga0209563_1000051166 241
439 3300025230 Ga0209563_100110 Ga0209563_10011018 241
440 3300025231 Ga0207427_101215 Ga0207427_1012152 241
441 3300025242 Ga0209258_105648 Ga0209258_1056483 241
442 3300025245 Ga0207425_1000333 Ga0207425_100033317 241
443 3300025246 Ga0209646_1000196 Ga0209646_100019634 241
444 3300025250 Ga0209026_1000011 Ga0209026_100001139 241
445 3300025253 Ga0209677_100151 Ga0209677_10015123 241
446 3300025253 Ga0209677_100488 Ga0209677_1004882 241
447 3300025253 Ga0209677_100877 Ga0209677_10087710 241
448 3300025256 Ga0209759_1000107 Ga0209759_100010739 241
449 3300025256 Ga0209759_1019767 Ga0209759_10197672 241
450 3300025258 Ga0209129_1000027 Ga0209129_1000027314 241
451 3300025291 Ga0209675_1019509 Ga0209675_10195091 241
452 3300025295 Ga0209564_1000003 Ga0209564_1000003344 241
453 3300025295 Ga0209564_1000014 Ga0209564_1000014468 241
454 3300025297 Ga0209758_1000208 Ga0209758_100020823 241
455 3300025298 Ga0209050_1008652 Ga0209050_10086523 241
456 3300025299 Ga0209256_1000130 Ga0209256_1000130135 241
457 3300025299 Ga0209256_1000471 Ga0209256_100047117 241
458 3300025303 Ga0209051_1001932 Ga0209051_10019327 241
459 3300025303 Ga0209051_1002398 Ga0209051_100239815 241
460 3300025303 Ga0209051_1006338 Ga0209051_10063385 241
461 3300025303 Ga0209051_1009233 Ga0209051_10092335 241
462 3300025304 Ga0209257_1000049 Ga0209257_100004916 241
463 3300025304 Ga0209257_1001013 Ga0209257_100101327 241
464 3300025304 Ga0209257_1001664 Ga0209257_100166415 241
465 3300025315 Ga0207697_10024132 Ga0207697_100241323 241
466 3300025321 Ga0207656_10088785 Ga0207656_100887852 241
467 3300025893 Ga0207682_10022146 Ga0207682_100221463 241
468 3300025893 Ga0207682_10081982 Ga0207682_100819822 241
469 3300025901 Ga0207688_10030413 Ga0207688_100304132 241
470 3300025901 Ga0207688_10095062 Ga0207688_100950621 241
471 3300025903 Ga0207680_10456126 Ga0207680_104561261 241
472 3300025907 Ga0207645_10008457 Ga0207645_100084574 241
473 3300025907 Ga0207645_10014732 Ga0207645_100147322 241
474 3300025907 Ga0207645_10110772 Ga0207645_101107722 241
475 3300025908 Ga0207643_10082044 Ga0207643_100820443 241
476 3300025908 Ga0207643_10335907 Ga0207643_103359071 241
477 3300025908 Ga0207643_10492395 Ga0207643_104923951 241
478 3300025909 Ga0207705_10126816 Ga0207705_101268162 241
479 3300025909 Ga0207705_10439247 Ga0207705_104392471 241
480 3300025910 Ga0207684_10041453 Ga0207684_100414535 241
481 3300025911 Ga0207654_10019687 Ga0207654_100196872 241
482 3300025913 Ga0207695_10023628 Ga0207695_100236286 241
483 3300025913 Ga0207695_10731186 Ga0207695_107311861 241
484 3300025914 Ga0207671_10045543 Ga0207671_100455432 241
485 3300025919 Ga0207657_10127028 Ga0207657_101270281 241
486 3300025920 Ga0207649_10001581 Ga0207649_1000158116 241
487 3300025920 Ga0207649_10079481 Ga0207649_100794812 241
488 3300025923 Ga0207681_10000974 Ga0207681_100009746 241
489 3300025924 Ga0207694_10106435 Ga0207694_101064353 241
490 3300025925 Ga0207650_10060020 Ga0207650_100600202 241
491 3300025925 Ga0207650_10093142 Ga0207650_100931422 241
492 3300025925 Ga0207650_10191466 Ga0207650_101914662 241
493 3300025926 Ga0207659_10042645 Ga0207659_100426452 241
494 3300025926 Ga0207659_10086103 Ga0207659_100861032 241
495 3300025926 Ga0207659_10197159 Ga0207659_101971592 241
496 3300025927 Ga0207687_10289598 Ga0207687_102895982 241
497 3300025931 Ga0207644_10016843 Ga0207644_100168433 241
498 3300025932 Ga0207690_10147841 Ga0207690_101478412 241
499 3300025932 Ga0207690_10434774 Ga0207690_104347742 241
500 3300025933 Ga0207706_10001576 Ga0207706_100015766 241
501 3300025933 Ga0207706_10091398 Ga0207706_100913983 241
502 3300025933 Ga0207706_10129692 Ga0207706_101296924 241
503 3300025933 Ga0207706_10182261 Ga0207706_101822612 241
504 3300025933 Ga0207706_10184163 Ga0207706_101841632 241
505 3300025934 Ga0207686_10192095 Ga0207686_101920951 241
506 3300025935 Ga0207709_10004566 Ga0207709_100045667 241
507 3300025935 Ga0207709_10026089 Ga0207709_100260892 241
508 3300025935 Ga0207709_10035015 Ga0207709_100350152 241
509 3300025937 Ga0207669_10019498 Ga0207669_100194983 241
510 3300025938 Ga0207704_10056029 Ga0207704_100560293 241
511 3300025938 Ga0207704_10205333 Ga0207704_102053332 241
512 3300025938 Ga0207704_10450450 Ga0207704_104504502 241
513 3300025938 Ga0207704_10715257 Ga0207704_107152571 241
514 3300025939 Ga0207665_10239116 Ga0207665_102391162 241
515 3300025940 Ga0207691_10042436 Ga0207691_100424362 241
516 3300025940 Ga0207691_10115314 Ga0207691_101153142 241
517 3300025940 Ga0207691_10469389 Ga0207691_104693891 241
518 3300025941 Ga0207711_10015814 Ga0207711_100158148 241
519 3300025942 Ga0207689_10003648 Ga0207689_1000364811 241
520 3300025942 Ga0207689_10009091 Ga0207689_100090912 241
521 3300025942 Ga0207689_10113469 Ga0207689_101134691 241
522 3300025945 Ga0207679_10000486 Ga0207679_1000048616 241
523 3300025945 Ga0207679_10256730 Ga0207679_102567302 241
524 3300025945 Ga0207679_10365409 Ga0207679_103654092 241
525 3300025945 Ga0207679_10782839 Ga0207679_107828391 241
526 3300025949 Ga0207667_10099975 Ga0207667_100999753 241
527 3300025949 Ga0207667_10360759 Ga0207667_103607592 241
528 3300025960 Ga0207651_10243179 Ga0207651_102431792 241
529 3300025961 Ga0207712_10106021 Ga0207712_101060211 241
530 3300025972 Ga0207668_10129350 Ga0207668_101293502 241
531 3300025981 Ga0207640_10011945 Ga0207640_100119452 241
532 3300025981 Ga0207640_10058408 Ga0207640_100584082 241
533 3300025981 Ga0207640_10496267 Ga0207640_104962672 241
534 3300025986 Ga0207658_10005961 Ga0207658_100059618 241
535 3300025986 Ga0207658_10168912 Ga0207658_101689122 241
536 3300025986 Ga0207658_10599759 Ga0207658_105997591 241
537 3300026023 Ga0207677_10168103 Ga0207677_101681032 241
538 3300026035 Ga0207703_10065050 Ga0207703_100650501 241
539 3300026035 Ga0207703_10436691 Ga0207703_104366912 241
540 3300026041 Ga0207639_10680217 Ga0207639_106802171 241
541 3300026067 Ga0207678_10005512 Ga0207678_100055128 241
542 3300026067 Ga0207678_10166497 Ga0207678_101664972 241
543 3300026067 Ga0207678_10236701 Ga0207678_102367013 241
544 3300026067 Ga0207678_10319869 Ga0207678_103198693 241
545 3300026075 Ga0207708_10041755 Ga0207708_100417553 241
546 3300026078 Ga0207702_10000356 Ga0207702_1000035637 241
547 3300026078 Ga0207702_10183623 Ga0207702_101836232 241
548 3300026088 Ga0207641_10001680 Ga0207641_100016803 241
549 3300026088 Ga0207641_10559869 Ga0207641_105598691 241
550 3300026089 Ga0207648_10002162 Ga0207648_1000216210 241
551 3300026089 Ga0207648_10010360 Ga0207648_1001036011 241
552 3300026089 Ga0207648_10058384 Ga0207648_100583842 241
553 3300026089 Ga0207648_10410318 Ga0207648_104103182 241
554 3300026095 Ga0207676_10200144 Ga0207676_102001442 241
555 3300026116 Ga0207674_10054067 Ga0207674_100540674 241
556 3300026116 Ga0207674_10122177 Ga0207674_101221772 241
557 3300026118 Ga0207675_100025343 Ga0207675_1000253434 241
558 3300026118 Ga0207675_100112287 Ga0207675_1001122873 241
559 3300026121 Ga0207683_10067518 Ga0207683_100675182 241
560 3300026121 Ga0207683_10280562 Ga0207683_102805622 241
561 3300026121 Ga0207683_10734175 Ga0207683_107341751 241
562 3300026142 Ga0207698_10043539 Ga0207698_100435394 241
563 3300026142 Ga0207698_10171264 Ga0207698_101712641 241
564 3300027111 Ga0209281_1000076 Ga0209281_100007661 241
565 3300027395 Ga0209996_1004814 Ga0209996_10048142 241
566 3300028380 Ga0268265_10016231 Ga0268265_100162315 241
567 3300028380 Ga0268265_10843370 Ga0268265_108433701 241
568 3300028381 Ga0268264_10052692 Ga0268264_100526925 241
569 3300028573 Ga0265334_10067856 Ga0265334_100678562 241
570 3300028666 Ga0265336_10000022 Ga0265336_1000002272 241
571 3300028786 Ga0307517_10335046 Ga0307517_103350461 241
572 3300028794 Ga0307515_10000232 Ga0307515_1000023222 241
573 3300028794 Ga0307515_10001456 Ga0307515_1000145634 241
574 3300028794 Ga0307515_10003007 Ga0307515_100030077 241
575 3300028794 Ga0307515_10027050 Ga0307515_100270508 241
576 3300028794 Ga0307515_10101925 Ga0307515_101019254 241
577 3300029957 Ga0265324_10002326 Ga0265324_100023263 241
578 3300030500 Ga0268256_1021399 Ga0268256_10213992 241
579 3300031507 Ga0307509_10246280 Ga0307509_102462802 241
580 3300031548 Ga0307408_100000160 Ga0307408_10000016022 241
581 3300031548 Ga0307408_100039869 Ga0307408_1000398691 241
582 3300031548 Ga0307408_100064966 Ga0307408_1000649661 241
583 3300031548 Ga0307408_100096425 Ga0307408_1000964252 241
584 3300031548 Ga0307408_100216238 Ga0307408_1002162382 241
585 3300031616 Ga0307508_10001328 Ga0307508_1000132819 241
586 3300031649 Ga0307514_10001289 Ga0307514_1000128912 241
587 3300031730 Ga0307516_10002032 Ga0307516_1000203222 241
588 3300031730 Ga0307516_10002726 Ga0307516_1000272619 241
589 3300031730 Ga0307516_10015871 Ga0307516_100158715 241
590 3300031730 Ga0307516_10276676 Ga0307516_102766762 241
591 3300031995 Ga0307409_100464726 Ga0307409_1004647262 241
592 3300032004 Ga0307414_10005757 Ga0307414_100057573 241
593 3300032004 Ga0307414_10777095 Ga0307414_107770951 241
594 3300032005 Ga0307411_10009492 Ga0307411_100094926 241
595 3300032005 Ga0307411_10212005 Ga0307411_102120052 241
596 3300035088 Ga0373940_0096976 Ga0373940_0096976_93_824 241
597 3300035090 Ga0373949_0022695 Ga0373949_0022695_154_885 241
598 3300035114 Ga0373939_0001481 Ga0373939_0001481_115_846 241
599 3300035119 Ga0373956_0228389 Ga0373956_0228389_11_736 241
600 3300035121 Ga0373960_0012261 Ga0373960_0012261_246_977 241
601 3300035170 Ga0373943_0256544 Ga0373943_0256544_79_804 241
602 3300035691 Ga0373931_0000429 Ga0373931_0000429_2316_3047 241
603 3300035695 Ga0373927_0164516 Ga0373927_0164516_663_1391 241
604 3300036401 Ga0373937_0201608 Ga0373937_0201608_1020_1745 241
605 3300037068 Ga0373925_0046695 Ga0373925_0046695_754_1482 241
606 3300037471 Ga0395905_0008848 Ga0395905_0008848_128_862 241
607 3300037471 Ga0395905_0015785 Ga0395905_0015785_6029_6760 241
608 3300037471 Ga0395905_0242112 Ga0395905_0242112_839_1564 241
609 3300038443 Ga0395901_0004869 Ga0395901_0004869_2929_3654 241
610 3300039447 Ga0436361_0677882 Ga0436361_0677882_143046_143777 241
611 3300041410 Ga0439461_0046392 Ga0439461_0046392_62_793 241
612 3300041452 Ga0451793_1137656 Ga0451793_1137656_47_781 241
613 3300041486 Ga0451807_2445078 Ga0451807_2445078_674_1408 241
614 3300041491 Ga0451833_0114255 Ga0451833_0114255_486_1211 241
615 3300041512 Ga0451853_3442311 Ga0451853_3442311_807_1541 241
616 3300042011 Ga0439454_003233 Ga0439454_003233_382_1110 241
617 3300042120 Ga0450917_000073 Ga0450917_000073_2788_3519 241
618 3300042121 Ga0450919_007815 Ga0450919_007815_139_873 241
619 3300042125 Ga0450923_013417 Ga0450923_013417_196_930 241
620 3300042127 Ga0450890_001264 Ga0450890_001264_1763_2491 241
621 3300042127 Ga0450890_003134 Ga0450890_003134_964_1695 241
622 3300042129 Ga0450891_000191 Ga0450891_000191_1616_2347 241
623 3300042144 Ga0450889_000610 Ga0450889_000610_1285_2016 241
624 3300042157 Ga0439458_0020111 Ga0439458_0020111_549_1277 241
625 3300042157 Ga0439458_0027396 Ga0439458_0027396_207_941 241
626 3300042438 Ga0439459_0001224 Ga0439459_0001224_2410_3138 241
627 3300042438 Ga0439459_0011217 Ga0439459_0011217_778_1509 241
628 3300042531 Ga0450918_000573 Ga0450918_000573_1686_2420 241
629 3300042876 Ga0451577_0000152 Ga0451577_0000152_14578_15312 241
630 3300042876 Ga0451577_0007214 Ga0451577_0007214_6567_7301 241
631 3300042876 Ga0451577_0021763 Ga0451577_0021763_1250_1978 241
632 3300044656 Ga0466969_0048861 Ga0466969_0048861_380_1108 241
633 3300044658 Ga0466972_0000265 Ga0466972_0000265_13776_14507 241
634 3300044684 Ga0466966_0084879 Ga0466966_0084879_489_1217 241
635 3300044694 Ga0466963_0018757 Ga0466963_0018757_2554_3282 241
636 3300044694 Ga0466963_0171347 Ga0466963_0171347_347_1075 241
637 3300044706 Ga0466964_0293918 Ga0466964_0293918_26_754 241
638 3300044712 Ga0453684_0000122 Ga0453684_0000122_287131_287865 241
639 3300044712 Ga0453684_0074293 Ga0453684_0074293_2010_2735 241
640 3300044712 Ga0453684_0198585 Ga0453684_0198585_1586_2320 241
641 3300044735 Ga0466968_0009938 Ga0466968_0009938_2153_2878 241
642 3300044765 Ga0466970_0008455 Ga0466970_0008455_1416_2144 241
643 3300045049 Ga0466959_0001171 Ga0466959_0001171_14988_15716 241
644 3300045051 Ga0451576_0000559 Ga0451576_0000559_14552_15286 241
645 3300045051 Ga0451576_0074522 Ga0451576_0074522_2501_3232 241
646 3300045051 Ga0451576_0333617 Ga0451576_0333617_590_1315 241
647 3300045836 Ga0466958_0157085 Ga0466958_0157085_499_1227 241
648 3300045976 Ga0466967_0033285 Ga0466967_0033285_3039_3767 241
649 3300046459 Ga0495629_0007894 Ga0495629_0007894_902_1627 241
650 3300046460 Ga0495638_0087017 Ga0495638_0087017_38_766 241
651 3300046471 Ga0495650_0042201 Ga0495650_0042201_417_1142 241
652 3300046475 Ga0495639_0018631 Ga0495639_0018631_843_1568 241
653 3300046492 Ga0495585_0230808 Ga0495585_0230808_63_788 241
654 3300046506 Ga0495583_0000123 Ga0495583_0000123_123163_123888 241
655 3300046507 Ga0495606_0001921 Ga0495606_0001921_17922_18647 241
656 3300046515 Ga0495620_0103979 Ga0495620_0103979_248_982 241
657 3300046519 Ga0495632_0016647 Ga0495632_0016647_53_787 241
658 3300046522 Ga0495643_0012023 Ga0495643_0012023_4073_4807 241
659 3300046542 Ga0495597_0042619 Ga0495597_0042619_1000_1725 241
660 3300046543 Ga0495645_0170854 Ga0495645_0170854_659_1384 241
661 3300046557 Ga0495622_0150409 Ga0495622_0150409_284_1009 241
662 3300046616 Ga0495668_0084528 Ga0495668_0084528_811_1536 241
663 3300046660 Ga0495625_0001732 Ga0495625_0001732_18342_19076 241
664 3300046660 Ga0495625_0003731 Ga0495625_0003731_10286_11011 241
665 3300046660 Ga0495625_0441550 Ga0495625_0441550_42_767 241
666 3300046683 Ga0495658_0080334 Ga0495658_0080334_556_1281 241
667 3300046691 Ga0495670_0214521 Ga0495670_0214521_115_843 241
668 3300046692 Ga0495671_0280824 Ga0495671_0280824_62_787 241
669 3300046694 Ga0495649_0006920 Ga0495649_0006920_155_880 241
670 3300046794 Ga0495589_0002708 Ga0495589_0002708_1923_2648 241
671 3300047321 Ga0495676_0236226 Ga0495676_0236226_409_1134 241
672 3300047322 Ga0495680_0416232 Ga0495680_0416232_78_803 241
673 3300047443 Ga0495687_002069 Ga0495687_002069_15011_15736 241
674 3300047673 Ga0495593_0079323 Ga0495593_0079323_68_793 241
675 3300048905 Ga0496102_0015830 Ga0496102_0015830_65_796 241
676 3300048911 Ga0496108_0075008 Ga0496108_0075008_1683_2411 241
677 3300048911 Ga0496108_0358728 Ga0496108_0358728_415_1140 241
678 3300048917 Ga0496114_0012468 Ga0496114_0012468_2811_3545 241
679 3300048917 Ga0496114_0121229 Ga0496114_0121229_819_1544 241
680 3300048924 Ga0496121_0008194 Ga0496121_0008194_3866_4591 241
681 3300048927 Ga0496124_0000344 Ga0496124_0000344_29957_30682 241
682 3300048927 Ga0496124_0015117 Ga0496124_0015117_3774_4502 241
683 3300048927 Ga0496124_0188253 Ga0496124_0188253_474_1202 241
684 3300048928 Ga0496125_0028418 Ga0496125_0028418_2272_2997 241
685 3300048928 Ga0496125_0387021 Ga0496125_0387021_59_784 241
686 3300049128 Ga0501308_000125 Ga0501308_000125_2899_3630 241
687 3300049129 Ga0501309_000072 Ga0501309_000072_1933_2664 241
688 3300049129 Ga0501309_002714 Ga0501309_002714_121_855 241
689 3300049130 Ga0501310_000166 Ga0501310_000166_2676_3407 241
690 3300049160 Ga0501304_000040 Ga0501304_000040_2591_3322 241
691 3300049528 Ga0501312_000083 Ga0501312_000083_2898_3629 241
692 3300049530 Ga0501314_004425 Ga0501314_004425_136_867 241
693 3300049536 Ga0501320_000886 Ga0501320_000886_1136_1867 241
694 3300049579 Ga0501043_0000004 Ga0501043_0000004_244892_245617 241
695 3300049580 Ga0501046_0000016 Ga0501046_0000016_46219_46944 241
696 3300049581 Ga0501047_0000012 Ga0501047_0000012_45899_46624 241
697 3300049582 Ga0501048_0000091 Ga0501048_0000091_4905_5630 241
698 3300049658 Ga0501211_000060 Ga0501211_000060_2368_3099 241
699 3300049662 Ga0501222_000573 Ga0501222_000573_1635_2366 241
700 3300049668 Ga0501233_001248 Ga0501233_001248_3573_4304 241
701 3300049669 Ga0501235_005384 Ga0501235_005384_1123_1854 241
702 3300049670 Ga0501236_007587 Ga0501236_007587_358_1089 241
703 3300049679 Ga0501249_019913 Ga0501249_019913_17_748 241
704 3300049687 Ga0501258_000044 Ga0501258_000044_4499_5230 241
705 3300049706 Ga0501229_000386 Ga0501229_000386_359_1090 241
706 3300049759 Ga0501262_000731 Ga0501262_000731_1714_2445 241
707 3300049768 Ga0501271_002647 Ga0501271_002647_679_1410 241
708 3300049769 Ga0501272_002879 Ga0501272_002879_498_1229 241
709 3300049824 Ga0501045_0013429 Ga0501045_0013429_1359_2084 241
710 3300050489 nmdc:mga03683_11795_c1 nmdc:mga03683_11795_c1_2151_2876 241
711 3300050489 nmdc:mga03683_26488_c1 nmdc:mga03683_26488_c1_782_1507 241
712 3300050490 nmdc:mga03n38_10564_c1 nmdc:mga03n38_10564_c1_799_1524 241
713 3300050493 nmdc:mga0k408_2669_c1 nmdc:mga0k408_2669_c1_1338_2063 241
714 3300050493 nmdc:mga0k408_2914_c1 nmdc:mga0k408_2914_c1_3968_4693 241
715 3300050493 nmdc:mga0k408_309_c2 nmdc:mga0k408_309_c2_7791_8516 241
716 3300050493 nmdc:mga0k408_3267_c1 nmdc:mga0k408_3267_c1_592_1317 241
717 3300050493 nmdc:mga0k408_540_c1 nmdc:mga0k408_540_c1_19412_20137 241
718 3300050493 nmdc:mga0k408_79520_c1 nmdc:mga0k408_79520_c1_15_746 241
719 3300050494 nmdc:mga06z11_22603_c1 nmdc:mga06z11_22603_c1_1154_1879 241
720 3300050494 nmdc:mga06z11_335668_c1 nmdc:mga06z11_335668_c1_26_760 241
721 3300050494 nmdc:mga06z11_60609_c1 nmdc:mga06z11_60609_c1_740_1465 241
722 3300050496 nmdc:mga07m45_12293_c1 nmdc:mga07m45_12293_c1_1125_1859 241
723 3300050496 nmdc:mga07m45_12332_c1 nmdc:mga07m45_12332_c1_976_1701 241
724 3300050496 nmdc:mga07m45_16204_c1 nmdc:mga07m45_16204_c1_2616_3341 241
725 3300050496 nmdc:mga07m45_239_c1 nmdc:mga07m45_239_c1_5027_5752 241
726 3300050496 nmdc:mga07m45_32789_c1 nmdc:mga07m45_32789_c1_1434_2162 241
727 3300050496 nmdc:mga07m45_3604_c1 nmdc:mga07m45_3604_c1_5765_6496 241
728 3300050496 nmdc:mga07m45_370_c1 nmdc:mga07m45_370_c1_14134_14859 241
729 3300050496 nmdc:mga07m45_41801_c1 nmdc:mga07m45_41801_c1_172_900 241
730 3300050496 nmdc:mga07m45_7408_c1 nmdc:mga07m45_7408_c1_3295_4020 241
731 3300050516 nmdc:mga0sz30_153264_c1 nmdc:mga0sz30_153264_c1_19_744 241
732 3300050516 nmdc:mga0sz30_54366_c1 nmdc:mga0sz30_54366_c1_370_1095 241
733 3300053085 Ga0495619_0313064 Ga0495619_0313064_195_920 241
734 3300053136 Ga0500559_0026005 Ga0500559_0026005_614_1339 241
735 3300053137 Ga0500561_0000912 Ga0500561_0000912_2797_3525 241
736 3300053139 Ga0500568_0004552 Ga0500568_0004552_6221_6946 241
737 3300053139 Ga0500568_0020559 Ga0500568_0020559_1221_1949 241
738 3300053156 Ga0500622_0000874 Ga0500622_0000874_6347_7075 241
739 3300053177 Ga0500636_0066706 Ga0500636_0066706_919_1644 241
740 3300053739 Ga0500587_003671 Ga0500587_003671_1043_1777 241
741 3300055283 Ga0500661_010132 Ga0500661_010132_25_750 241
742 3300061719 Ga0466962_0007408 Ga0466962_0007408_535_1263 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22692

LlgE_F_G_D1

Flagellar hook protein FlgE/F/G D1 domain

111

176

0.97

PF00460

Flg_bb_rod

Flagella basal body rod protein

35

65

0.96

PF06429

Flg_bbr_C

Flagellar basal body rod FlgEFG protein C-terminal

225

270

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jf2-assembly1.cif.gz_A crystal structure of a 20kda fragment of flgg 0.8465 67 200
6jf2-assembly2.cif.gz_B crystal structure of a 20kda fragment of flgg 0.7972 61 202
6jf2-assembly1.cif.gz_A crystal structure of a 20kda fragment of flgg 0.7817 67 200
1fx7-assembly1.cif.gz_A crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis 0.7446 134 156
5eq4-assembly2.cif.gz_C crystal structure of the srpa adhesin r347e mutant from streptococcus sanguinis 0.7337 130 156
ID Description Score Start End Superfamily
5eq3A02 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7089 130 156 3.10.20.890
af_K7LJY2_116_288_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6654 126 155 2.130.10.10
6iltB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.6652 133 155 3.40.1190.20
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.6148 133 157 3.40.1190.20
af_Q9XWF9_804_861_3.10.450.750 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.613 131 158 3.10.450.750
ID Description Score Start End GO Terms
AF-A0A7S1GZY5-F1-model_v4 Flagellar hook protein FlgE/F/G-like D1 domain-containing protein 0.9841 74 197
AF-A0A7S1GZY5-F1-model_v4 Flagellar hook protein FlgE/F/G-like D1 domain-containing protein 0.9611 74 197
AF-A0A6G0XZ50-F1-model_v4 Flagellar basal-body rod protein FlgF (Distal rod protein) (Flagellar basal-body rod protein FlgG) (Flagellar hook protein FlgE) 0.8956 74 200 GO:0003774
GO:0016020
GO:0031514
AF-A0A5Q2QAE4-F1-model_v4 Flagellar basal-body rod protein FlgF 0.8763 68 241 GO:0030694
GO:0071978
AF-A0A357D7W2-F1-model_v4 Flagellar basal-body rod protein FlgG 0.8537 65 202 GO:0009426
GO:0071978

Feature Viewer

pLDDT pTM Quality
73.44 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map