F478534

General Info

Members Datasets Scaffolds Average Seq Length
740 364 1480 235

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10129590|Ga0207676_101295902
Length 262
Sequence MARDCRQIHGDSQFGRRSAKRMADLYEKRGFMSTSMQGKVVLVAGGTGGLGRAISVAFLTSGAHVAVTYLRKDELAALQAGAGGRSADFSGYLVDVTDDGQVRATVEGIVSAHGRIDVLVNTVGAFAGGIKLWETDPKVFTQMLDLNLRSGYLLARNVVPQMLKQAGGAIVNVAAKAAFDHAAGASAVAMMDSLAEDLRGTGVRVNSILPSIIDTAANRRAMPNADFSKWPKPEEIARVILFVCGEEARLIHGASIPVYGNA

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
14 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
15 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
16 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
17 3300003391 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM Metagenome Rhizosphere
18 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
19 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
20 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
21 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
114 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
115 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
116 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
117 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
118 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
119 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
120 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
121 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
122 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
123 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
124 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
125 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
126 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
127 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
128 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
129 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
130 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
210 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
211 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
246 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
249 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
252 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
253 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
254 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
255 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
259 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
260 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
261 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
262 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
263 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
271 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
272 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
277 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
304 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
313 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
323 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
324 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.3
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10129590 3300026095 Unclassified 2142
2 SwRhRL2b_contig_153209 2162886007 Archaea 2062
3 2214745240 2209111006 Archaea 3566
4 ARcpr5oldR_c002519 3300000041 Archaea 1688
5 ARcpr5yngRDRAFT_c002398 3300000043 Archaea 1950
6 ARcpr5yngRDRAFT_c002474 3300000043 Unclassified 1919
7 ARSoilOldRDRAFT_c001486 3300000044 Archaea 2180
8 ARSoilOldRDRAFT_c001517 3300000044 Unclassified 2154
9 ARSoilOldRDRAFT_c001833 3300000044 Archaea 1950
10 ARCol0oldRDRAFT_c00976 3300000045 Unclassified 2195
11 ARCol0yngRDRAFT_1001540 3300000652 Archaea 1863
12 JGI24746J21847_1018132 3300001977 Unclassified 997
13 JGI24739J22299_10028437 3300001989 Unclassified 1950
14 JGI24033J26618_1010107 3300002155 Unclassified 1108
15 rootH1_10101503 3300003316 Archaea 2722
16 JGI26129J50193_1000798 3300003349 Archaea 2040
17 JGI26142J50222_100799 3300003379 Unclassified 999
18 JGI26139J50223_100420 3300003382 Archaea 1693
19 JGI26140J50224_100333 3300003383 Archaea 2312
20 JGI26135J50243_100693 3300003391 Archaea 1021
21 JGI26137J50245_100520 3300003396 Archaea 1345
22 JGI26130J50248_100101 3300003398 Archaea 4161
23 JGI26136J50244_100587 3300003399 Archaea 1211
24 JGI26131J50246_100815 3300003400 Archaea 976
25 Ga0065704_10003422 3300005289 Archaea 6566
26 Ga0065704_10010947 3300005289 Archaea 2129
27 Ga0065715_10000288 3300005293 Archaea 21023
28 Ga0065707_10000792 3300005295 Archaea 31968
29 Ga0070676_10024704 3300005328 Archaea 3388
30 Ga0070676_10044376 3300005328 Bacteria 2587
31 Ga0070676_10059150 3300005328 Archaea 2272
32 Ga0070683_100085322 3300005329 Unclassified 2960
33 Ga0070690_100067634 3300005330 Unclassified 2315
34 Ga0070670_100003394 3300005331 Bacteria 13200
35 Ga0070670_100125895 3300005331 Archaea 2211
36 Ga0070670_100558768 3300005331 Archaea 1021
37 Ga0070677_10205836 3300005333 Archaea 952
38 Ga0068869_100007542 3300005334 Bacteria 6962
39 Ga0068869_100011597 3300005334 Archaea 5787
40 Ga0070680_100001277 3300005336 Bacteria 18194
41 Ga0070680_100024313 3300005336 Archaea 4838
42 Ga0070680_100354616 3300005336 Archaea 1247
43 Ga0068868_100001054 3300005338 Bacteria 18857
44 Ga0068868_100003839 3300005338 Bacteria 10492
45 Ga0068868_100015070 3300005338 Archaea 5710
46 Ga0068868_100027217 3300005338 Unclassified 4362
47 Ga0070660_100525973 3300005339 Unclassified 985
48 Ga0070691_10020748 3300005341 Unclassified 3036
49 Ga0070687_100011199 3300005343 Archaea 3914
50 Ga0070661_100098421 3300005344 Archaea 2173
51 Ga0070692_10060318 3300005345 Archaea 1996
52 Ga0070668_100040597 3300005347 Archaea 3561
53 Ga0070669_100030703 3300005353 Archaea 3878
54 Ga0070675_100010912 3300005354 Archaea 7106
55 Ga0070675_100186383 3300005354 Bacteria 1796
56 Ga0070673_100072314 3300005364 Unclassified 2773
57 Ga0070659_100078175 3300005366 Bacteria 2639
58 Ga0070659_100093186 3300005366 Archaea 2417
59 Ga0070667_100001559 3300005367 Archaea 20551
60 Ga0070709_10020341 3300005434 Bacteria 3849
61 Ga0070709_10052140 3300005434 Bacteria 2570
62 Ga0070709_10719744 3300005434 Unclassified 778
63 Ga0070714_100006960 3300005435 Bacteria 8766
64 Ga0070714_100015229 3300005435 Bacteria 6186
65 Ga0070714_100351289 3300005435 Bacteria 1385
66 Ga0070713_100007518 3300005436 Bacteria 7655
67 Ga0070713_100034870 3300005436 Bacteria 4047
68 Ga0070713_100069825 3300005436 Bacteria 2964
69 Ga0070713_100125032 3300005436 Bacteria 2261
70 Ga0070711_100201803 3300005439 Unclassified 1535
71 Ga0070711_100308796 3300005439 Unclassified 1260
72 Ga0070700_100005391 3300005441 Archaea 6771
73 Ga0070694_100011563 3300005444 Archaea 5466
74 Ga0070708_100401044 3300005445 Bacteria 1293
75 Ga0070708_100440350 3300005445 Archaea 1229
76 Ga0070708_100824613 3300005445 Unclassified 872
77 Ga0070663_100342918 3300005455 Bacteria 1208
78 Ga0070662_100003575 3300005457 Archaea 9697
79 Ga0070662_100040509 3300005457 Bacteria 3317
80 Ga0070662_100162134 3300005457 Archaea 1749
81 Ga0070681_10000592 3300005458 Bacteria 29787
82 Ga0070681_10002188 3300005458 Bacteria 17789
83 Ga0070681_10054077 3300005458 Bacteria 4000
84 Ga0070681_10063025 3300005458 Unclassified 3680
85 Ga0070681_10064462 3300005458 Unclassified 3634
86 Ga0068867_100003286 3300005459 Archaea 11384
87 Ga0068867_100022849 3300005459 Archaea 4475
88 Ga0068867_100054458 3300005459 Unclassified 2955
89 Ga0068867_100432193 3300005459 Bacteria 1118
90 Ga0070706_100080495 3300005467 Unclassified 3017
91 Ga0070679_100031772 3300005530 Bacteria 5220
92 Ga0070679_100038388 3300005530 Bacteria 4761
93 Ga0070679_100062904 3300005530 Bacteria 3699
94 Ga0070679_100148921 3300005530 Archaea 2318
95 Ga0070684_100041200 3300005535 Unclassified 3981
96 Ga0070697_100045747 3300005536 Bacteria 3547
97 Ga0068853_100009142 3300005539 Bacteria 7980
98 Ga0068853_100529531 3300005539 Archaea 1115
99 Ga0068853_100908202 3300005539 Unclassified 846
100 Ga0068853_100916085 3300005539 Bacteria 842
101 Ga0070672_100002822 3300005543 Archaea 11125
102 Ga0070672_100020824 3300005543 Archaea 4789
103 Ga0070672_100142936 3300005543 Bacteria 1975
104 Ga0070686_100220160 3300005544 Bacteria 1371
105 Ga0070695_100027015 3300005545 Archaea 3554
106 Ga0070695_100231255 3300005545 Archaea 1336
107 Ga0070696_100121533 3300005546 Archaea 1891
108 Ga0070693_100174174 3300005547 Archaea 1380
109 Ga0070693_100340761 3300005547 Archaea 1023
110 Ga0070704_100108433 3300005549 Archaea 2108
111 Ga0068855_100000143 3300005563 Bacteria 91719
112 Ga0068855_100002066 3300005563 Bacteria 24882
113 Ga0068855_100002068 3300005563 Bacteria 24857
114 Ga0068855_100011945 3300005563 Bacteria 10500
115 Ga0068855_100160113 3300005563 Bacteria 2556
116 Ga0070664_100001111 3300005564 Bacteria 21282
117 Ga0068857_100000254 3300005577 Bacteria 35845
118 Ga0068857_100002868 3300005577 Bacteria 14179
119 Ga0068857_100124789 3300005577 Unclassified 2319
120 Ga0068857_100175148 3300005577 Archaea 1951
121 Ga0068854_100005050 3300005578 Bacteria 8313
122 Ga0068854_100022304 3300005578 Bacteria 4310
123 Ga0068854_100033970 3300005578 Bacteria 3559
124 Ga0068854_100592512 3300005578 Unclassified 945
125 Ga0068856_100000148 3300005614 Bacteria 71173
126 Ga0068856_100006425 3300005614 Bacteria 11534
127 Ga0068856_100017282 3300005614 Bacteria 6991
128 Ga0068856_100034311 3300005614 Bacteria 4970
129 Ga0070702_100073143 3300005615 Archaea 2030
130 Ga0068852_100013029 3300005616 Archaea 6347
131 Ga0068852_100024544 3300005616 Bacteria 4875
132 Ga0068852_100082677 3300005616 Bacteria 2854
133 Ga0068859_100008657 3300005617 Bacteria 10284
134 Ga0068859_100753115 3300005617 Archaea 1063
135 Ga0068864_100024408 3300005618 Archaea 5087
136 Ga0068864_100034506 3300005618 Unclassified 4304
137 Ga0068864_100424876 3300005618 Archaea 1267
138 Ga0068866_10146537 3300005718 Archaea 1362
139 Ga0068851_10020301 3300005834 Bacteria 3216
140 Ga0068870_10002262 3300005840 Archaea 7992
141 Ga0068870_10002578 3300005840 Archaea 7582
142 Ga0068870_10103975 3300005840 Bacteria 1610
143 Ga0068863_100148552 3300005841 Unclassified 2242
144 Ga0068858_100005061 3300005842 Bacteria 12923
145 Ga0068858_100008323 3300005842 Bacteria 9977
146 Ga0068858_100036995 3300005842 Unclassified 4525
147 Ga0068860_100016062 3300005843 Archaea 7302
148 Ga0068860_100125570 3300005843 Unclassified 2459
149 Ga0068860_100295892 3300005843 Archaea 1585
150 Ga0068862_100002454 3300005844 Archaea 16443
151 Ga0068862_100189605 3300005844 Archaea 1849
152 Ga0081455_10030896 3300005937 Bacteria 4858
153 Ga0081455_10038928 3300005937 Archaea 4207
154 Ga0081455_10133194 3300005937 Bacteria 1940
155 Ga0070717_10004008 3300006028 Bacteria 10604
156 Ga0070717_10018181 3300006028 Bacteria 5485
157 Ga0070717_10265588 3300006028 Bacteria 1519
158 Ga0070717_10356831 3300006028 Unclassified 1308
159 Ga0075432_10016635 3300006058 Archaea 2510
160 Ga0070716_100015560 3300006173 Bacteria 3911
161 Ga0070716_100235277 3300006173 Bacteria 1239
162 Ga0070712_100007963 3300006175 Bacteria 6645
163 Ga0070712_100278086 3300006175 Bacteria 1347
164 Ga0097621_100000136 3300006237 Bacteria 43536
165 Ga0097621_100001188 3300006237 Bacteria 18057
166 Ga0097621_100003510 3300006237 Bacteria 10824
167 Ga0097621_100010332 3300006237 Bacteria 6824
168 Ga0097621_100269939 3300006237 Unclassified 1494
169 Ga0068871_100000057 3300006358 Bacteria 59839
170 Ga0068871_100000125 3300006358 Bacteria 48494
171 Ga0068871_100008009 3300006358 Bacteria 7586
172 Ga0068871_100141670 3300006358 Bacteria 2045
173 Ga0068871_100389128 3300006358 Bacteria 1240
174 Ga0075428_100077985 3300006844 Archaea 3616
175 Ga0075428_100124515 3300006844 Archaea 2805
176 Ga0075428_100154761 3300006844 Bacteria 2491
177 Ga0075428_100164452 3300006844 Archaea 2407
178 Ga0075430_100134107 3300006846 Bacteria 2063
179 Ga0075430_100421032 3300006846 Bacteria 1102
180 Ga0075430_100547917 3300006846 Unclassified 954
181 Ga0075431_100068090 3300006847 Archaea 3674
182 Ga0075433_10017339 3300006852 Archaea 5963
183 Ga0075433_10040918 3300006852 Bacteria 4014
184 Ga0075434_100434244 3300006871 Unclassified 1334
185 Ga0075429_100077966 3300006880 Archaea 2887
186 Ga0075429_100103448 3300006880 Archaea 2487
187 Ga0075429_100241692 3300006880 Bacteria 1581
188 Ga0068865_100004165 3300006881 Archaea 8702
189 Ga0068865_100305213 3300006881 Bacteria 1275
190 Ga0068865_100482153 3300006881 Archaea 1031
191 Ga0075436_100004298 3300006914 Archaea 9786
192 Ga0075436_100005582 3300006914 Bacteria 8635
193 Ga0075436_100095667 3300006914 Bacteria 2066
194 Ga0097620_100008657 3300006931 Bacteria 10284
195 Ga0097620_100753065 3300006931 Archaea 1063
196 Ga0075435_100024305 3300007076 Bacteria 4700
197 Ga0075435_100068450 3300007076 Archaea 2892
198 Ga0075435_100129673 3300007076 Archaea 2110
199 Ga0075435_100462759 3300007076 Unclassified 1094
200 Ga0075435_100464518 3300007076 Unclassified 1092
201 Ga0099794_10003666 3300007265 Bacteria 5905
202 Ga0099794_10037622 3300007265 Bacteria 2292
203 Ga0099794_10275549 3300007265 Bacteria 869
204 Ga0105240_10000001 3300009093 Bacteria 2887840
205 Ga0105240_10006536 3300009093 Bacteria 17114
206 Ga0105240_10027728 3300009093 Bacteria 7412
207 Ga0105240_10046455 3300009093 Bacteria 5501
208 Ga0105240_10219215 3300009093 Bacteria 2218
209 Ga0105240_10569892 3300009093 Bacteria 1250
210 Ga0105240_10589120 3300009093 Bacteria 1226
211 Ga0111539_10109765 3300009094 Unclassified 3237
212 Ga0111539_10461537 3300009094 Bacteria 1479
213 Ga0111539_11227079 3300009094 Bacteria 871
214 Ga0105245_10000025 3300009098 Bacteria 175673
215 Ga0105245_10072976 3300009098 Bacteria 3119
216 Ga0105245_10084480 3300009098 Bacteria 2908
217 Ga0114129_10057228 3300009147 Archaea 5458
218 Ga0114129_10170284 3300009147 Archaea 2970
219 Ga0105241_10060498 3300009174 Bacteria 2914
220 Ga0105241_10061566 3300009174 Unclassified 2891
221 Ga0105242_10098440 3300009176 Bacteria 2474
222 Ga0105242_10176507 3300009176 Unclassified 1881
223 Ga0105242_10299482 3300009176 Archaea 1467
224 Ga0105242_10869123 3300009176 Unclassified 899
225 Ga0105248_10019895 3300009177 Bacteria 7431
226 Ga0105248_10097049 3300009177 Unclassified 3320
227 Ga0105248_10786368 3300009177 Bacteria 1074
228 Ga0105237_10015922 3300009545 Bacteria 7818
229 Ga0105237_10133083 3300009545 Bacteria 2481
230 Ga0105237_10144506 3300009545 Unclassified 2373
231 Ga0105238_10000344 3300009551 Bacteria 50133
232 Ga0105238_10004991 3300009551 Bacteria 13123
233 Ga0105238_10023145 3300009551 Bacteria 6335
234 Ga0105238_10077732 3300009551 Bacteria 3309
235 Ga0105238_10408204 3300009551 Bacteria 1352
236 Ga0105238_11089327 3300009551 Bacteria 821
237 Ga0105249_10016270 3300009553 Archaea 6596
238 Ga0105249_10504373 3300009553 Archaea 1255
239 Ga0099796_10031830 3300010159 Bacteria 1724
240 Ga0105239_10099963 3300010375 Bacteria 3208
241 Ga0105239_10266759 3300010375 Bacteria 1925
242 Ga0105239_10293866 3300010375 Bacteria 1829
243 Ga0105239_10986603 3300010375 Archaea 968
244 Ga0105246_10011226 3300011119 Archaea 5555
245 Ga0105246_10364565 3300011119 Unclassified 1188
246 Ga0157340_1000947 3300012473 Unclassified 1238
247 Ga0157336_1000147 3300012477 Unclassified 2943
248 Ga0157328_1001776 3300012478 Unclassified 964
249 Ga0157346_1001391 3300012480 Archaea 1143
250 Ga0157325_1000907 3300012485 Archaea 1254
251 Ga0157343_1000328 3300012488 Unclassified 1833
252 Ga0157341_1000037 3300012494 Archaea 5284
253 Ga0157323_1000165 3300012495 Unclassified 3068
254 Ga0157314_1000626 3300012500 Unclassified 3185
255 Ga0157347_1003507 3300012502 Archaea 1411
256 Ga0157313_1000098 3300012503 Archaea 3729
257 Ga0157339_1001002 3300012505 Unclassified 1613
258 Ga0157324_1002947 3300012506 Unclassified 1079
259 Ga0157342_1006754 3300012507 Archaea 1096
260 Ga0157315_1001225 3300012508 Unclassified 1384
261 Ga0157316_1001068 3300012510 Unclassified 1608
262 Ga0157326_1006508 3300012513 Archaea 1247
263 Ga0157338_1000509 3300012515 Archaea 2328
264 Ga0157373_10028026 3300013100 Unclassified 4063
265 Ga0157373_10161834 3300013100 Bacteria 1575
266 Ga0157371_10093321 3300013102 Unclassified 2133
267 Ga0157371_10186348 3300013102 Unclassified 1485
268 Ga0157370_10012346 3300013104 Bacteria 8863
269 Ga0157370_10053381 3300013104 Bacteria 3854
270 Ga0157370_10496728 3300013104 Bacteria 1120
271 Ga0157369_10000187 3300013105 Bacteria 85960
272 Ga0157369_10010757 3300013105 Bacteria 10415
273 Ga0157369_10058940 3300013105 Bacteria 4141
274 Ga0157369_10244677 3300013105 Bacteria 1873
275 Ga0157369_10396612 3300013105 Unclassified 1432
276 Ga0157369_10881460 3300013105 Unclassified 918
277 Ga0157374_10000801 3300013296 Bacteria 27561
278 Ga0157374_10000844 3300013296 Bacteria 26813
279 Ga0157374_10001328 3300013296 Bacteria 21017
280 Ga0157374_10001799 3300013296 Bacteria 18040
281 Ga0157374_10004806 3300013296 Archaea 11336
282 Ga0157374_10302952 3300013296 Bacteria 1581
283 Ga0157378_10000072 3300013297 Bacteria 91281
284 Ga0157378_10000604 3300013297 Bacteria 33691
285 Ga0157378_10000886 3300013297 Bacteria 27619
286 Ga0157378_10001546 3300013297 Archaea 20792
287 Ga0157378_10055764 3300013297 Unclassified 3520
288 Ga0157378_10168299 3300013297 Bacteria 2054
289 Ga0163162_10002864 3300013306 Archaea 16418
290 Ga0163162_10231052 3300013306 Bacteria 1980
291 Ga0163162_10371577 3300013306 Bacteria 1563
292 Ga0157372_10000083 3300013307 Bacteria 99009
293 Ga0157372_10000359 3300013307 Bacteria 50182
294 Ga0157372_10002354 3300013307 Bacteria 20447
295 Ga0157372_10028472 3300013307 Bacteria 6097
296 Ga0157372_10088347 3300013307 Bacteria 3519
297 Ga0157372_10513303 3300013307 Bacteria 1397
298 Ga0157375_10003837 3300013308 Archaea 13037
299 Ga0157375_10221320 3300013308 Archaea 2051
300 Ga0157375_10431204 3300013308 Bacteria 1484
301 Ga0163163_10099099 3300014325 Bacteria 2936
302 Ga0157377_10002748 3300014745 Archaea 7833
303 Ga0157379_10062065 3300014968 Archaea 3342
304 Ga0157379_10086070 3300014968 Unclassified 2818
305 Ga0157379_10514018 3300014968 Bacteria 1111
306 Ga0157376_10013161 3300014969 Bacteria 6166
307 Ga0157376_10109345 3300014969 Unclassified 2430
308 Ga0157376_10172516 3300014969 Unclassified 1971
309 Ga0163161_10039769 3300017792 Archaea 3378
310 Ga0213871_10013130 3300021441 Bacteria 1939
311 Ga0228598_1004030 3300024227 Bacteria 3124
312 Ga0207697_10000425 3300025315 Archaea 23802
313 Ga0207656_10013454 3300025321 Bacteria 3129
314 Ga0207682_10128593 3300025893 Archaea 1129
315 Ga0207642_10112236 3300025899 Archaea 1390
316 Ga0207688_10000369 3300025901 Archaea 20956
317 Ga0207647_10001147 3300025904 Archaea 20384
318 Ga0207647_10024919 3300025904 Bacteria 3939
319 Ga0207647_10079316 3300025904 Archaea 1971
320 Ga0207699_10037787 3300025906 Bacteria 2763
321 Ga0207699_10090153 3300025906 Bacteria 1923
322 Ga0207699_10118447 3300025906 Bacteria 1709
323 Ga0207699_10130095 3300025906 Unclassified 1641
324 Ga0207645_10001346 3300025907 Archaea 20165
325 Ga0207645_10009055 3300025907 Archaea 6908
326 Ga0207643_10000332 3300025908 Archaea 32314
327 Ga0207643_10002342 3300025908 Archaea 10298
328 Ga0207643_10108309 3300025908 Bacteria 1635
329 Ga0207654_10142037 3300025911 Unclassified 1532
330 Ga0207707_10001316 3300025912 Bacteria 23106
331 Ga0207707_10004990 3300025912 Bacteria 11656
332 Ga0207707_10051214 3300025912 Unclassified 3596
333 Ga0207707_10062149 3300025912 Unclassified 3250
334 Ga0207707_10142037 3300025912 Bacteria 2099
335 Ga0207707_10520901 3300025912 Archaea 1012
336 Ga0207695_10000001 3300025913 Bacteria 2888630
337 Ga0207695_10011625 3300025913 Bacteria 10645
338 Ga0207695_10036360 3300025913 Bacteria 5325
339 Ga0207695_10161540 3300025913 Bacteria 2171
340 Ga0207695_10508531 3300025913 Bacteria 1086
341 Ga0207671_10027515 3300025914 Bacteria 4251
342 Ga0207671_10368889 3300025914 Bacteria 1140
343 Ga0207693_10012554 3300025915 Bacteria 6842
344 Ga0207663_10058197 3300025916 Unclassified 2438
345 Ga0207660_10000265 3300025917 Bacteria 34314
346 Ga0207660_10031752 3300025917 Unclassified 3641
347 Ga0207660_10057693 3300025917 Archaea 2781
348 Ga0207660_10107440 3300025917 Archaea 2094
349 Ga0207662_10064098 3300025918 Bacteria 2210
350 Ga0207649_10129288 3300025920 Archaea 1713
351 Ga0207652_10002798 3300025921 Bacteria 14637
352 Ga0207652_10003444 3300025921 Bacteria 13054
353 Ga0207652_10043656 3300025921 Bacteria 3818
354 Ga0207652_10165654 3300025921 Unclassified 1982
355 Ga0207652_10330915 3300025921 Archaea 1375
356 Ga0207681_10009269 3300025923 Archaea 6012
357 Ga0207681_10169956 3300025923 Archaea 1651
358 Ga0207694_10000178 3300025924 Bacteria 65835
359 Ga0207694_10036629 3300025924 Bacteria 3766
360 Ga0207694_10206408 3300025924 Bacteria 1600
361 Ga0207694_10362242 3300025924 Bacteria 1202
362 Ga0207650_10005201 3300025925 Bacteria 8873
363 Ga0207650_10013356 3300025925 Archaea 5686
364 Ga0207659_10042258 3300025926 Unclassified 3195
365 Ga0207659_10260701 3300025926 Bacteria 1410
366 Ga0207687_10000439 3300025927 Bacteria 28274
367 Ga0207687_10202748 3300025927 Bacteria 1552
368 Ga0207700_10018363 3300025928 Bacteria 4696
369 Ga0207700_10055021 3300025928 Bacteria 2990
370 Ga0207700_10127763 3300025928 Bacteria 2071
371 Ga0207664_10017946 3300025929 Bacteria 5200
372 Ga0207664_10161634 3300025929 Bacteria 1910
373 Ga0207664_10472715 3300025929 Bacteria 1121
374 Ga0207706_10001689 3300025933 Archaea 21768
375 Ga0207706_10024898 3300025933 Archaea 5365
376 Ga0207686_10133107 3300025934 Bacteria 1708
377 Ga0207686_10421654 3300025934 Archaea 1021
378 Ga0207704_10052201 3300025938 Archaea 2477
379 Ga0207704_10273635 3300025938 Bacteria 1280
380 Ga0207665_10006691 3300025939 Bacteria 7650
381 Ga0207691_10001451 3300025940 Archaea 23602
382 Ga0207691_10030267 3300025940 Archaea 5060
383 Ga0207691_10385573 3300025940 Bacteria 1196
384 Ga0207689_10004786 3300025942 Archaea 12206
385 Ga0207689_10024177 3300025942 Unclassified 5096
386 Ga0207689_10257435 3300025942 Bacteria 1444
387 Ga0207661_10140475 3300025944 Unclassified 2078
388 Ga0207667_10000281 3300025949 Bacteria 70283
389 Ga0207667_10001064 3300025949 Bacteria 34781
390 Ga0207667_10048563 3300025949 Unclassified 4487
391 Ga0207667_10071997 3300025949 Bacteria 3593
392 Ga0207651_10026497 3300025960 Unclassified 3623
393 Ga0207712_10008622 3300025961 Archaea 6445
394 Ga0207712_10060726 3300025961 Archaea 2681
395 Ga0207668_10016782 3300025972 Archaea 4578
396 Ga0207640_10029767 3300025981 Bacteria 3355
397 Ga0207640_10040048 3300025981 Bacteria 2970
398 Ga0207640_10132179 3300025981 Archaea 1806
399 Ga0207658_10011048 3300025986 Archaea 6148
400 Ga0207677_10007738 3300026023 Bacteria 5964
401 Ga0207677_10022300 3300026023 Archaea 3889
402 Ga0207677_10027823 3300026023 Bacteria 3568
403 Ga0207703_10006971 3300026035 Bacteria 8995
404 Ga0207703_10018108 3300026035 Bacteria 5501
405 Ga0207703_10245920 3300026035 Bacteria 1610
406 Ga0207703_10303973 3300026035 Bacteria 1456
407 Ga0207639_10001891 3300026041 Bacteria 14068
408 Ga0207678_10252133 3300026067 Archaea 1512
409 Ga0207708_10010385 3300026075 Archaea 6913
410 Ga0207702_10000152 3300026078 Bacteria 81294
411 Ga0207702_10000906 3300026078 Bacteria 30750
412 Ga0207702_10021248 3300026078 Bacteria 5371
413 Ga0207702_10040094 3300026078 Bacteria 3925
414 Ga0207641_10185436 3300026088 Unclassified 1908
415 Ga0207648_10001495 3300026089 Archaea 25754
416 Ga0207648_10005215 3300026089 Archaea 13145
417 Ga0207648_10236970 3300026089 Bacteria 1624
418 Ga0207676_10027972 3300026095 Unclassified 4206
419 Ga0207676_10038417 3300026095 Archaea 3653
420 Ga0207676_10257279 3300026095 Archaea 1574
421 Ga0207674_10002198 3300026116 Bacteria 24689
422 Ga0207674_10009972 3300026116 Bacteria 10810
423 Ga0207674_10013748 3300026116 Bacteria 8960
424 Ga0207683_10135895 3300026121 Bacteria 2213
425 Ga0207698_10025097 3300026142 Bacteria 4193
426 Ga0207698_10061925 3300026142 Bacteria 2919
427 Ga0207698_10155458 3300026142 Bacteria 1992
428 Ga0207698_10394496 3300026142 Bacteria 1321
429 Ga0209967_1000150 3300027364 Archaea 9461
430 Ga0209967_1007208 3300027364 Unclassified 1518
431 Ga0209981_1008278 3300027378 Archaea 1411
432 Ga0209984_1007240 3300027424 Unclassified 1376
433 Ga0210000_1000171 3300027462 Archaea 9412
434 Ga0210000_1002489 3300027462 Unclassified 2621
435 Ga0209982_1005007 3300027552 Unclassified 1910
436 Ga0209983_1000907 3300027665 Archaea 6506
437 Ga0209983_1011701 3300027665 Unclassified 1796
438 Ga0209966_1007358 3300027695 Archaea 1928
439 Ga0209998_10000382 3300027717 Archaea 12773
440 Ga0209998_10001382 3300027717 Unclassified 5884
441 Ga0209974_10000193 3300027876 Archaea 19341
442 Ga0207428_10001647 3300027907 Archaea 23246
443 Ga0207428_10002019 3300027907 Archaea 20504
444 Ga0207428_10017215 3300027907 Archaea 6208
445 Ga0207428_10159037 3300027907 Bacteria 1716
446 Ga0207428_10232785 3300027907 Unclassified 1378
447 Ga0268265_10028618 3300028380 Archaea 3991
448 Ga0268264_10022873 3300028381 Archaea 5100
449 Ga0268264_10174797 3300028381 Archaea 1945
450 Ga0268264_10717202 3300028381 Unclassified 994
451 Ga0268264_10723307 3300028381 Bacteria 990
452 Ga0265319_1001247 3300028563 Bacteria 15542
453 Ga0265338_10137880 3300028800 Bacteria 1915
454 Ga0265338_10149728 3300028800 Bacteria 1815
455 Ga0265338_10151940 3300028800 Bacteria 1798
456 Ga0265338_10188720 3300028800 Bacteria 1564
457 Ga0265760_10015429 3300031090 Bacteria 2189
458 Ga0265330_10056557 3300031235 Bacteria 1712
459 Ga0265320_10000385 3300031240 Bacteria 35771
460 Ga0265325_10009187 3300031241 Bacteria 5787
461 Ga0265325_10133697 3300031241 Bacteria 1185
462 Ga0265329_10000973 3300031242 Bacteria 14361
463 Ga0265340_10003173 3300031247 Bacteria 9318
464 Ga0265339_10004421 3300031249 Bacteria 9595
465 Ga0265339_10124772 3300031249 Bacteria 1321
466 Ga0265331_10000025 3300031250 Bacteria 229346
467 Ga0265331_10016080 3300031250 Bacteria 3936
468 Ga0265331_10172384 3300031250 Bacteria 979
469 Ga0265316_10000827 3300031344 Bacteria 34240
470 Ga0265316_10018017 3300031344 Bacteria 6083
471 Ga0307509_10039792 3300031507 Bacteria 5118
472 Ga0307408_100075235 3300031548 Bacteria 2508
473 Ga0265313_10000796 3300031595 Bacteria 31957
474 Ga0265313_10074749 3300031595 Bacteria 1553
475 Ga0265314_10169100 3300031711 Bacteria 1321
476 Ga0265342_10000648 3300031712 Bacteria 36508
477 Ga0373926_0000044 3300035083 Bacteria 20723
478 Ga0373926_0008175 3300035083 Bacteria 3483
479 Ga0373934_0036863 3300035086 Unclassified 1926
480 Ga0373949_0008409 3300035090 Unclassified 2258
481 Ga0373952_0008218 3300035092 Unclassified 1977
482 Ga0373936_0080674 3300035113 Bacteria 1354
483 Ga0373943_0032356 3300035170 Bacteria 2486
484 Ga0373946_0004082 3300035171 Bacteria 5204
485 Ga0373946_0028011 3300035171 Bacteria 2232
486 Ga0373955_0341849 3300035172 Bacteria 906
487 Ga0373955_0394090 3300035172 Bacteria 841
488 Ga0373942_0105024 3300035207 Unclassified 867
489 Ga0373961_0016090 3300035241 Archaea 1923
490 Ga0373924_0137457 3300035410 Bacteria 1065
491 Ga0373931_0010668 3300035691 Archaea 4420
492 Ga0373931_0016767 3300035691 Unclassified 3612
493 Ga0373935_0007966 3300035692 Bacteria 6353
494 Ga0373927_0000357 3300035695 Bacteria 35562
495 Ga0373927_0005950 3300035695 Bacteria 8353
496 Ga0373927_0019570 3300035695 Bacteria 4438
497 Ga0373927_0468676 3300035695 Unclassified 832
498 Ga0373947_0002044 3300035725 Bacteria 12313
499 Ga0373947_0006244 3300035725 Bacteria 6930
500 Ga0373947_0065196 3300035725 Unclassified 2221
501 Ga0373947_0233819 3300035725 Unclassified 1211
502 Ga0373937_0024425 3300036401 Bacteria 5451
503 Ga0373937_0280326 3300036401 Bacteria 1574
504 Ga0373925_0000225 3300037068 Bacteria 60424
505 Ga0373925_0040492 3300037068 Bacteria 3450
506 Ga0373925_0151325 3300037068 Bacteria 1822
507 Ga0436365_0523233 3300039437 Bacteria 1563
508 Ga0436361_0142725 3300039447 Bacteria 1131
509 Ga0436363_1092030 3300039450 Unclassified 991
510 Ga0439453_0000225 3300041408 Archaea 5592
511 Ga0439461_0092128 3300041410 Unclassified 728
512 Ga0439466_0107465 3300041411 Unclassified 867
513 Ga0439441_000726 3300042001 Archaea 3826
514 Ga0439443_000024 3300042003 Archaea 8207
515 Ga0439432_075773 3300042006 Unclassified 1022
516 Ga0439450_000270 3300042008 Archaea 6313
517 Ga0439451_001016 3300042009 Archaea 5441
518 Ga0439452_018075 3300042010 Unclassified 1884
519 Ga0439456_001168 3300042013 Archaea 5218
520 Ga0439463_001852 3300042016 Archaea 5491
521 Ga0439446_0003789 3300042156 Unclassified 3784
522 Ga0439434_0041790 3300042435 Unclassified 1409
523 Ga0439435_0000871 3300042436 Archaea 5180
524 Ga0439444_0000037 3300042437 Archaea 9708
525 Ga0439464_0000330 3300042439 Archaea 9060
526 Ga0439460_0001015 3300042461 Archaea 6498
527 Ga0450893_0000404 3300042532 Archaea 6087
528 Ga0439440_0001030 3300042993 Archaea 4940
529 Ga0439440_0008357 3300042993 Archaea 2124
530 Ga0466963_0002432 3300044694 Bacteria 10418
531 Ga0466963_0510940 3300044694 Unclassified 848
532 Ga0453684_0015340 3300044712 Archaea 12136
533 Ga0466959_0362212 3300045049 Bacteria 988
534 Ga0451576_0067841 3300045051 Archaea 3712
535 Ga0466967_0008639 3300045976 Bacteria 7487
536 Ga0466967_0010460 3300045976 Bacteria 6964
537 Ga0495592_0007008 3300046454 Bacteria 8426
538 Ga0495651_0000845 3300046462 Bacteria 23857
539 Ga0495651_0002579 3300046462 Bacteria 14009
540 Ga0495651_0038429 3300046462 Bacteria 3727
541 Ga0495653_0004861 3300046463 Bacteria 10900
542 Ga0495653_0151838 3300046463 Bacteria 1617
543 Ga0495650_0024665 3300046471 Bacteria 2836
544 Ga0495580_0007984 3300046472 Bacteria 8459
545 Ga0495580_0012291 3300046472 Bacteria 6572
546 Ga0495580_0023526 3300046472 Bacteria 4522
547 Ga0495580_0066315 3300046472 Unclassified 2527
548 Ga0495639_0169203 3300046475 Bacteria 1060
549 Ga0495664_0044061 3300046477 Bacteria 2644
550 Ga0495584_0033554 3300046491 Archaea 2597
551 Ga0495594_0026237 3300046499 Bacteria 3134
552 Ga0495596_0017231 3300046500 Bacteria 2995
553 Ga0495608_0008455 3300046511 Bacteria 7211
554 Ga0495618_0006052 3300046514 Bacteria 7344
555 Ga0495618_0045804 3300046514 Bacteria 2760
556 Ga0495628_0001882 3300046516 Bacteria 19051
557 Ga0495630_0002997 3300046517 Bacteria 11710
558 Ga0495630_0004734 3300046517 Bacteria 9546
559 Ga0495630_0048063 3300046517 Bacteria 3193
560 Ga0495630_0808629 3300046517 Bacteria 716
561 Ga0495666_0005110 3300046526 Bacteria 6632
562 Ga0495666_0079411 3300046526 Bacteria 1553
563 Ga0495642_0125946 3300046528 Bacteria 1101
564 Ga0495652_0005736 3300046529 Bacteria 11630
565 Ga0495652_0005835 3300046529 Bacteria 11521
566 Ga0495665_0005119 3300046531 Bacteria 7069
567 Ga0495665_0150927 3300046531 Bacteria 1213
568 Ga0495586_0001491 3300046535 Bacteria 12909
569 Ga0495586_0229469 3300046535 Bacteria 1056
570 Ga0495587_0001476 3300046536 Bacteria 15659
571 Ga0495587_0011183 3300046536 Bacteria 5691
572 Ga0495587_0362636 3300046536 Unclassified 807
573 Ga0495667_0001535 3300046559 Bacteria 15274
574 Ga0495667_0012956 3300046559 Bacteria 5654
575 Ga0495667_0282087 3300046559 Bacteria 1054
576 Ga0495667_0289129 3300046559 Unclassified 1040
577 Ga0495656_0070208 3300046615 Archaea 1554
578 Ga0495634_0053998 3300046642 Bacteria 2690
579 Ga0495635_0007553 3300046663 Bacteria 7585
580 Ga0495635_0030914 3300046663 Bacteria 3719
581 Ga0495659_0156340 3300046664 Archaea 918
582 Ga0495657_0014030 3300046675 Bacteria 5885
583 Ga0495657_0017687 3300046675 Bacteria 5171
584 Ga0495599_0090251 3300046678 Unclassified 1912
585 Ga0495599_0187503 3300046678 Bacteria 1273
586 Ga0495623_0006319 3300046679 Bacteria 7703
587 Ga0495646_0007833 3300046680 Bacteria 6783
588 Ga0495647_0180257 3300046681 Unclassified 919
589 Ga0495613_0025450 3300046689 Unclassified 4409
590 Ga0495613_0094378 3300046689 Unclassified 2165
591 Ga0495624_0002258 3300046690 Bacteria 14686
592 Ga0495624_0030777 3300046690 Bacteria 3494
593 Ga0495670_0036300 3300046691 Archaea 2456
594 Ga0495600_0006435 3300046809 Bacteria 7153
595 Ga0495604_0004539 3300047317 Bacteria 10994
596 Ga0495604_0014733 3300047317 Bacteria 6232
597 Ga0495604_0015183 3300047317 Bacteria 6148
598 Ga0495636_0054720 3300047318 Bacteria 1677
599 Ga0495674_0034746 3300047319 Bacteria 4555
600 Ga0495674_0035045 3300047319 Bacteria 4531
601 Ga0495674_0041533 3300047319 Bacteria 4107
602 Ga0495674_0141518 3300047319 Bacteria 2022
603 Ga0495674_0405235 3300047319 Bacteria 1100
604 Ga0495680_0001573 3300047322 Bacteria 24448
605 Ga0495680_0021811 3300047322 Bacteria 5352
606 Ga0495675_0000350 3300047444 Bacteria 32505
607 Ga0495675_0010613 3300047444 Bacteria 5758
608 Ga0495675_0012918 3300047444 Bacteria 5263
609 Ga0495675_0033322 3300047444 Bacteria 3288
610 Ga0495675_0040731 3300047444 Bacteria 2961
611 Ga0495677_0023853 3300047445 Bacteria 2220
612 Ga0495684_0007907 3300047471 Bacteria 8224
613 Ga0495684_0177461 3300047471 Bacteria 1581
614 Ga0495602_0007361 3300048088 Bacteria 11527
615 Ga0495602_0023867 3300048088 Bacteria 5947
616 Ga0495602_0101702 3300048088 Bacteria 2357
617 Ga0495602_0156909 3300048088 Bacteria 1781
618 Ga0495614_0009716 3300048089 Bacteria 4251
619 Ga0496100_0017971 3300048903 Archaea 4186
620 Ga0496100_0299284 3300048903 Bacteria 1204
621 Ga0496101_0082392 3300048904 Unclassified 2381
622 Ga0496102_0006312 3300048905 Archaea 10106
623 Ga0496102_0052914 3300048905 Unclassified 3701
624 Ga0496103_0056929 3300048906 Unclassified 2427
625 Ga0496104_0049517 3300048907 Unclassified 3962
626 Ga0496106_0005230 3300048909 Archaea 9612
627 Ga0496106_0390019 3300048909 Bacteria 1119
628 Ga0496107_0018474 3300048910 Archaea 4909
629 Ga0496109_0422083 3300048912 Bacteria 1260
630 Ga0496112_0000850 3300048915 Bacteria 21801
631 Ga0496112_0226848 3300048915 Unclassified 1823
632 Ga0496112_0230824 3300048915 Bacteria 1805
633 Ga0496112_0632468 3300048915 Bacteria 1001
634 Ga0496126_0021608 3300048929 Bacteria 6283
635 Ga0501290_003730 3300049513 Bacteria 1910
636 Ga0501297_010383 3300049520 Archaea 1053
637 Ga0501031_0044858 3300049568 Archaea 2885
638 Ga0501031_0130598 3300049568 Bacteria 1641
639 Ga0501032_0107010 3300049569 Unclassified 1852
640 Ga0501033_0200131 3300049570 Bacteria 1427
641 Ga0501033_0205204 3300049570 Bacteria 1407
642 Ga0501034_0212418 3300049571 Unclassified 1890
643 Ga0501036_0004787 3300049572 Archaea 10940
644 Ga0501036_0012112 3300049572 Archaea 7148
645 Ga0501036_0763303 3300049572 Unclassified 797
646 Ga0501037_0012304 3300049573 Archaea 6298
647 Ga0501037_0117441 3300049573 Archaea 1914
648 Ga0501038_0362944 3300049574 Archaea 1126
649 Ga0501038_0389162 3300049574 Unclassified 1080
650 Ga0501039_0012437 3300049575 Archaea 6499
651 Ga0501039_0110321 3300049575 Archaea 2151
652 Ga0501039_0387089 3300049575 Unclassified 1098
653 Ga0501041_0003523 3300049577 Archaea 9006
654 Ga0501041_0004623 3300049577 Archaea 7987
655 Ga0501041_0039959 3300049577 Bacteria 2847
656 Ga0501042_0011353 3300049578 Archaea 6009
657 Ga0501042_0013730 3300049578 Archaea 5516
658 Ga0501042_0120888 3300049578 Bacteria 1885
659 Ga0501046_0110619 3300049580 Archaea 2099
660 Ga0501046_0130412 3300049580 Archaea 1907
661 Ga0501048_0013359 3300049582 Archaea 6094
662 Ga0501048_0018313 3300049582 Archaea 5153
663 Ga0501068_0087245 3300049584 Archaea 1921
664 Ga0501068_0247305 3300049584 Unclassified 1136
665 Ga0501070_0022145 3300049586 Bacteria 5323
666 Ga0501070_0695639 3300049586 Unclassified 804
667 Ga0501071_0006990 3300049587 Archaea 7370
668 Ga0501071_0415584 3300049587 Archaea 1028
669 Ga0501071_0503061 3300049587 Unclassified 930
670 Ga0501072_0008897 3300049588 Archaea 7630
671 Ga0501072_0011198 3300049588 Archaea 6846
672 Ga0501072_0359830 3300049588 Unclassified 1155
673 Ga0501073_0006100 3300049589 Bacteria 8993
674 Ga0501074_0021808 3300049590 Bacteria 4650
675 Ga0501074_0039931 3300049590 Archaea 3398
676 Ga0501075_0000345 3300049591 Archaea 26364
677 Ga0501075_0000553 3300049591 Archaea 22715
678 Ga0501075_0024250 3300049591 Archaea 4445
679 Ga0501076_0000749 3300049592 Archaea 21006
680 Ga0501076_0012168 3300049592 Archaea 6432
681 Ga0501076_0093343 3300049592 Archaea 2422
682 Ga0501076_0328431 3300049592 Unclassified 1255
683 Ga0501077_0016771 3300049593 Archaea 4619
684 Ga0501077_0079663 3300049593 Archaea 2075
685 Ga0501079_0082313 3300049741 Unclassified 2489
686 Ga0501079_0089338 3300049741 Bacteria 2386
687 Ga0501080_0007167 3300049742 Bacteria 10061
688 Ga0501081_0002216 3300049743 Archaea 12229
689 Ga0501081_0005875 3300049743 Archaea 7943
690 Ga0501083_0038043 3300049744 Bacteria 3272
691 Ga0501035_0037509 3300049822 Bacteria 4389
692 Ga0501035_0183639 3300049822 Archaea 1801
693 Ga0501035_0382767 3300049822 Unclassified 1173
694 Ga0501044_0057609 3300049823 Bacteria 3987
695 Ga0501045_0004573 3300049824 Archaea 9554
696 Ga0501045_0008874 3300049824 Archaea 7019
697 nmdc:mga05p37_111060_c1 3300050507 Archaea 3372
698 nmdc:mga05p37_146459_c1 3300050507 Archaea 2892
699 nmdc:mga05p37_242508_c1 3300050507 Bacteria 2166
700 nmdc:mga05p37_56279_c1 3300050507 Archaea 4842
701 nmdc:mga09592_189375_c1 3300050508 Archaea 1781
702 nmdc:mga09592_29059_c1 3300050508 Archaea 4598
703 nmdc:mga09592_381745_c1 3300050508 Bacteria 1218
704 nmdc:mga09592_44233_c1 3300050508 Archaea 3748
705 nmdc:mga0qj67_124617_c1 3300050509 Bacteria 2085
706 nmdc:mga0qj67_424629_c1 3300050509 Unclassified 1072
707 nmdc:mga0qj67_626094_c1 3300050509 Unclassified 860
708 nmdc:mga06r32_172408_c1 3300050510 Archaea 2147
709 nmdc:mga06r32_23148_c1 3300050510 Archaea 5748
710 nmdc:mga06r32_302035_c1 3300050510 Bacteria 1587
711 nmdc:mga06r32_366380_c1 3300050510 Archaea 1424
712 nmdc:mga08y16_202585_c1 3300050511 Archaea 2057
713 nmdc:mga08y16_262754_c1 3300050511 Archaea 1783
714 nmdc:mga08y16_35884_c1 3300050511 Archaea 5208
715 nmdc:mga08y16_54979_c1 3300050511 Archaea 4161
716 nmdc:mga08y16_627551_c1 3300050511 Bacteria 1081
717 nmdc:mga0n895_10435_c1 3300050512 Bacteria 8205
718 nmdc:mga0n895_22_c1 3300050512 Archaea 92594
719 nmdc:mga0n895_75861_c1 3300050512 Archaea 3343
720 nmdc:mga0n895_8992_c1 3300050512 Archaea 8709
721 nmdc:mga0rr50_232341_c1 3300050513 Unclassified 1526
722 nmdc:mga0rr50_44254_c1 3300050513 Bacteria 3264
723 nmdc:mga0rr50_5304_c1 3300050513 Archaea 7669
724 nmdc:mga0rr50_69702_c1 3300050513 Archaea 2677
725 nmdc:mga08x19_11314_c1 3300050514 Archaea 5370
726 nmdc:mga08x19_118226_c1 3300050514 Bacteria 1774
727 nmdc:mga08x19_2334_c1 3300050514 Bacteria 11514
728 nmdc:mga0a205_111500_c1 3300050515 Archaea 2635
729 nmdc:mga0a205_167101_c1 3300050515 Unclassified 2096
730 nmdc:mga0a205_42664_c1 3300050515 Bacteria 4371
731 nmdc:mga0a205_54720_c1 3300050515 Archaea 3853
732 Ga0495612_0003555 3300053078 Bacteria 6463
733 Ga0501084_0013339 3300054114 Archaea 6799
734 Ga0501084_0119606 3300054114 Archaea 2214
735 Ga0501082_0002992 3300060353 Archaea 14760
736 Ga0501082_0022017 3300060353 Archaea 5496
737 Ga0501082_0067068 3300060353 Bacteria 3090
738 Ga0501082_0240065 3300060353 Unclassified 1577
739 Ga0530510_0001835 3300061734 Archaea 14508
740 Ga0530510_0042400 3300061734 Archaea 3288
741 Ga0207676_10129590
742 SwRhRL2b_contig_153209
743 2214745240
744 ARcpr5oldR_c002519
745 ARcpr5yngRDRAFT_c002398
746 ARcpr5yngRDRAFT_c002474
747 ARSoilOldRDRAFT_c001486
748 ARSoilOldRDRAFT_c001517
749 ARSoilOldRDRAFT_c001833
750 ARCol0oldRDRAFT_c00976
751 ARCol0yngRDRAFT_1001540
752 JGI24746J21847_1018132
753 JGI24739J22299_10028437
754 JGI24033J26618_1010107
755 rootH1_10101503
756 JGI26129J50193_1000798
757 JGI26142J50222_100799
758 JGI26139J50223_100420
759 JGI26140J50224_100333
760 JGI26135J50243_100693
761 JGI26137J50245_100520
762 JGI26130J50248_100101
763 JGI26136J50244_100587
764 JGI26131J50246_100815
765 Ga0065704_10003422
766 Ga0065704_10010947
767 Ga0065715_10000288
768 Ga0065707_10000792
769 Ga0070676_10024704
770 Ga0070676_10044376
771 Ga0070676_10059150
772 Ga0070683_100085322
773 Ga0070690_100067634
774 Ga0070670_100003394
775 Ga0070670_100125895
776 Ga0070670_100558768
777 Ga0070677_10205836
778 Ga0068869_100007542
779 Ga0068869_100011597
780 Ga0070680_100001277
781 Ga0070680_100024313
782 Ga0070680_100354616
783 Ga0068868_100001054
784 Ga0068868_100003839
785 Ga0068868_100015070
786 Ga0068868_100027217
787 Ga0070660_100525973
788 Ga0070691_10020748
789 Ga0070687_100011199
790 Ga0070661_100098421
791 Ga0070692_10060318
792 Ga0070668_100040597
793 Ga0070669_100030703
794 Ga0070675_100010912
795 Ga0070675_100186383
796 Ga0070673_100072314
797 Ga0070659_100078175
798 Ga0070659_100093186
799 Ga0070667_100001559
800 Ga0070709_10020341
801 Ga0070709_10052140
802 Ga0070709_10719744
803 Ga0070714_100006960
804 Ga0070714_100015229
805 Ga0070714_100351289
806 Ga0070713_100007518
807 Ga0070713_100034870
808 Ga0070713_100069825
809 Ga0070713_100125032
810 Ga0070711_100201803
811 Ga0070711_100308796
812 Ga0070700_100005391
813 Ga0070694_100011563
814 Ga0070708_100401044
815 Ga0070708_100440350
816 Ga0070708_100824613
817 Ga0070663_100342918
818 Ga0070662_100003575
819 Ga0070662_100040509
820 Ga0070662_100162134
821 Ga0070681_10000592
822 Ga0070681_10002188
823 Ga0070681_10054077
824 Ga0070681_10063025
825 Ga0070681_10064462
826 Ga0068867_100003286
827 Ga0068867_100022849
828 Ga0068867_100054458
829 Ga0068867_100432193
830 Ga0070706_100080495
831 Ga0070679_100031772
832 Ga0070679_100038388
833 Ga0070679_100062904
834 Ga0070679_100148921
835 Ga0070684_100041200
836 Ga0070697_100045747
837 Ga0068853_100009142
838 Ga0068853_100529531
839 Ga0068853_100908202
840 Ga0068853_100916085
841 Ga0070672_100002822
842 Ga0070672_100020824
843 Ga0070672_100142936
844 Ga0070686_100220160
845 Ga0070695_100027015
846 Ga0070695_100231255
847 Ga0070696_100121533
848 Ga0070693_100174174
849 Ga0070693_100340761
850 Ga0070704_100108433
851 Ga0068855_100000143
852 Ga0068855_100002066
853 Ga0068855_100002068
854 Ga0068855_100011945
855 Ga0068855_100160113
856 Ga0070664_100001111
857 Ga0068857_100000254
858 Ga0068857_100002868
859 Ga0068857_100124789
860 Ga0068857_100175148
861 Ga0068854_100005050
862 Ga0068854_100022304
863 Ga0068854_100033970
864 Ga0068854_100592512
865 Ga0068856_100000148
866 Ga0068856_100006425
867 Ga0068856_100017282
868 Ga0068856_100034311
869 Ga0070702_100073143
870 Ga0068852_100013029
871 Ga0068852_100024544
872 Ga0068852_100082677
873 Ga0068859_100008657
874 Ga0068859_100753115
875 Ga0068864_100024408
876 Ga0068864_100034506
877 Ga0068864_100424876
878 Ga0068866_10146537
879 Ga0068851_10020301
880 Ga0068870_10002262
881 Ga0068870_10002578
882 Ga0068870_10103975
883 Ga0068863_100148552
884 Ga0068858_100005061
885 Ga0068858_100008323
886 Ga0068858_100036995
887 Ga0068860_100016062
888 Ga0068860_100125570
889 Ga0068860_100295892
890 Ga0068862_100002454
891 Ga0068862_100189605
892 Ga0081455_10030896
893 Ga0081455_10038928
894 Ga0081455_10133194
895 Ga0070717_10004008
896 Ga0070717_10018181
897 Ga0070717_10265588
898 Ga0070717_10356831
899 Ga0075432_10016635
900 Ga0070716_100015560
901 Ga0070716_100235277
902 Ga0070712_100007963
903 Ga0070712_100278086
904 Ga0097621_100000136
905 Ga0097621_100001188
906 Ga0097621_100003510
907 Ga0097621_100010332
908 Ga0097621_100269939
909 Ga0068871_100000057
910 Ga0068871_100000125
911 Ga0068871_100008009
912 Ga0068871_100141670
913 Ga0068871_100389128
914 Ga0075428_100077985
915 Ga0075428_100124515
916 Ga0075428_100154761
917 Ga0075428_100164452
918 Ga0075430_100134107
919 Ga0075430_100421032
920 Ga0075430_100547917
921 Ga0075431_100068090
922 Ga0075433_10017339
923 Ga0075433_10040918
924 Ga0075434_100434244
925 Ga0075429_100077966
926 Ga0075429_100103448
927 Ga0075429_100241692
928 Ga0068865_100004165
929 Ga0068865_100305213
930 Ga0068865_100482153
931 Ga0075436_100004298
932 Ga0075436_100005582
933 Ga0075436_100095667
934 Ga0097620_100008657
935 Ga0097620_100753065
936 Ga0075435_100024305
937 Ga0075435_100068450
938 Ga0075435_100129673
939 Ga0075435_100462759
940 Ga0075435_100464518
941 Ga0099794_10003666
942 Ga0099794_10037622
943 Ga0099794_10275549
944 Ga0105240_10000001
945 Ga0105240_10006536
946 Ga0105240_10027728
947 Ga0105240_10046455
948 Ga0105240_10219215
949 Ga0105240_10569892
950 Ga0105240_10589120
951 Ga0111539_10109765
952 Ga0111539_10461537
953 Ga0111539_11227079
954 Ga0105245_10000025
955 Ga0105245_10072976
956 Ga0105245_10084480
957 Ga0114129_10057228
958 Ga0114129_10170284
959 Ga0105241_10060498
960 Ga0105241_10061566
961 Ga0105242_10098440
962 Ga0105242_10176507
963 Ga0105242_10299482
964 Ga0105242_10869123
965 Ga0105248_10019895
966 Ga0105248_10097049
967 Ga0105248_10786368
968 Ga0105237_10015922
969 Ga0105237_10133083
970 Ga0105237_10144506
971 Ga0105238_10000344
972 Ga0105238_10004991
973 Ga0105238_10023145
974 Ga0105238_10077732
975 Ga0105238_10408204
976 Ga0105238_11089327
977 Ga0105249_10016270
978 Ga0105249_10504373
979 Ga0099796_10031830
980 Ga0105239_10099963
981 Ga0105239_10266759
982 Ga0105239_10293866
983 Ga0105239_10986603
984 Ga0105246_10011226
985 Ga0105246_10364565
986 Ga0157340_1000947
987 Ga0157336_1000147
988 Ga0157328_1001776
989 Ga0157346_1001391
990 Ga0157325_1000907
991 Ga0157343_1000328
992 Ga0157341_1000037
993 Ga0157323_1000165
994 Ga0157314_1000626
995 Ga0157347_1003507
996 Ga0157313_1000098
997 Ga0157339_1001002
998 Ga0157324_1002947
999 Ga0157342_1006754
1000 Ga0157315_1001225
1001 Ga0157316_1001068
1002 Ga0157326_1006508
1003 Ga0157338_1000509
1004 Ga0157373_10028026
1005 Ga0157373_10161834
1006 Ga0157371_10093321
1007 Ga0157371_10186348
1008 Ga0157370_10012346
1009 Ga0157370_10053381
1010 Ga0157370_10496728
1011 Ga0157369_10000187
1012 Ga0157369_10010757
1013 Ga0157369_10058940
1014 Ga0157369_10244677
1015 Ga0157369_10396612
1016 Ga0157369_10881460
1017 Ga0157374_10000801
1018 Ga0157374_10000844
1019 Ga0157374_10001328
1020 Ga0157374_10001799
1021 Ga0157374_10004806
1022 Ga0157374_10302952
1023 Ga0157378_10000072
1024 Ga0157378_10000604
1025 Ga0157378_10000886
1026 Ga0157378_10001546
1027 Ga0157378_10055764
1028 Ga0157378_10168299
1029 Ga0163162_10002864
1030 Ga0163162_10231052
1031 Ga0163162_10371577
1032 Ga0157372_10000083
1033 Ga0157372_10000359
1034 Ga0157372_10002354
1035 Ga0157372_10028472
1036 Ga0157372_10088347
1037 Ga0157372_10513303
1038 Ga0157375_10003837
1039 Ga0157375_10221320
1040 Ga0157375_10431204
1041 Ga0163163_10099099
1042 Ga0157377_10002748
1043 Ga0157379_10062065
1044 Ga0157379_10086070
1045 Ga0157379_10514018
1046 Ga0157376_10013161
1047 Ga0157376_10109345
1048 Ga0157376_10172516
1049 Ga0163161_10039769
1050 Ga0213871_10013130
1051 Ga0228598_1004030
1052 Ga0207697_10000425
1053 Ga0207656_10013454
1054 Ga0207682_10128593
1055 Ga0207642_10112236
1056 Ga0207688_10000369
1057 Ga0207647_10001147
1058 Ga0207647_10024919
1059 Ga0207647_10079316
1060 Ga0207699_10037787
1061 Ga0207699_10090153
1062 Ga0207699_10118447
1063 Ga0207699_10130095
1064 Ga0207645_10001346
1065 Ga0207645_10009055
1066 Ga0207643_10000332
1067 Ga0207643_10002342
1068 Ga0207643_10108309
1069 Ga0207654_10142037
1070 Ga0207707_10001316
1071 Ga0207707_10004990
1072 Ga0207707_10051214
1073 Ga0207707_10062149
1074 Ga0207707_10142037
1075 Ga0207707_10520901
1076 Ga0207695_10000001
1077 Ga0207695_10011625
1078 Ga0207695_10036360
1079 Ga0207695_10161540
1080 Ga0207695_10508531
1081 Ga0207671_10027515
1082 Ga0207671_10368889
1083 Ga0207693_10012554
1084 Ga0207663_10058197
1085 Ga0207660_10000265
1086 Ga0207660_10031752
1087 Ga0207660_10057693
1088 Ga0207660_10107440
1089 Ga0207662_10064098
1090 Ga0207649_10129288
1091 Ga0207652_10002798
1092 Ga0207652_10003444
1093 Ga0207652_10043656
1094 Ga0207652_10165654
1095 Ga0207652_10330915
1096 Ga0207681_10009269
1097 Ga0207681_10169956
1098 Ga0207694_10000178
1099 Ga0207694_10036629
1100 Ga0207694_10206408
1101 Ga0207694_10362242
1102 Ga0207650_10005201
1103 Ga0207650_10013356
1104 Ga0207659_10042258
1105 Ga0207659_10260701
1106 Ga0207687_10000439
1107 Ga0207687_10202748
1108 Ga0207700_10018363
1109 Ga0207700_10055021
1110 Ga0207700_10127763
1111 Ga0207664_10017946
1112 Ga0207664_10161634
1113 Ga0207664_10472715
1114 Ga0207706_10001689
1115 Ga0207706_10024898
1116 Ga0207686_10133107
1117 Ga0207686_10421654
1118 Ga0207704_10052201
1119 Ga0207704_10273635
1120 Ga0207665_10006691
1121 Ga0207691_10001451
1122 Ga0207691_10030267
1123 Ga0207691_10385573
1124 Ga0207689_10004786
1125 Ga0207689_10024177
1126 Ga0207689_10257435
1127 Ga0207661_10140475
1128 Ga0207667_10000281
1129 Ga0207667_10001064
1130 Ga0207667_10048563
1131 Ga0207667_10071997
1132 Ga0207651_10026497
1133 Ga0207712_10008622
1134 Ga0207712_10060726
1135 Ga0207668_10016782
1136 Ga0207640_10029767
1137 Ga0207640_10040048
1138 Ga0207640_10132179
1139 Ga0207658_10011048
1140 Ga0207677_10007738
1141 Ga0207677_10022300
1142 Ga0207677_10027823
1143 Ga0207703_10006971
1144 Ga0207703_10018108
1145 Ga0207703_10245920
1146 Ga0207703_10303973
1147 Ga0207639_10001891
1148 Ga0207678_10252133
1149 Ga0207708_10010385
1150 Ga0207702_10000152
1151 Ga0207702_10000906
1152 Ga0207702_10021248
1153 Ga0207702_10040094
1154 Ga0207641_10185436
1155 Ga0207648_10001495
1156 Ga0207648_10005215
1157 Ga0207648_10236970
1158 Ga0207676_10027972
1159 Ga0207676_10038417
1160 Ga0207676_10257279
1161 Ga0207674_10002198
1162 Ga0207674_10009972
1163 Ga0207674_10013748
1164 Ga0207683_10135895
1165 Ga0207698_10025097
1166 Ga0207698_10061925
1167 Ga0207698_10155458
1168 Ga0207698_10394496
1169 Ga0209967_1000150
1170 Ga0209967_1007208
1171 Ga0209981_1008278
1172 Ga0209984_1007240
1173 Ga0210000_1000171
1174 Ga0210000_1002489
1175 Ga0209982_1005007
1176 Ga0209983_1000907
1177 Ga0209983_1011701
1178 Ga0209966_1007358
1179 Ga0209998_10000382
1180 Ga0209998_10001382
1181 Ga0209974_10000193
1182 Ga0207428_10001647
1183 Ga0207428_10002019
1184 Ga0207428_10017215
1185 Ga0207428_10159037
1186 Ga0207428_10232785
1187 Ga0268265_10028618
1188 Ga0268264_10022873
1189 Ga0268264_10174797
1190 Ga0268264_10717202
1191 Ga0268264_10723307
1192 Ga0265319_1001247
1193 Ga0265338_10137880
1194 Ga0265338_10149728
1195 Ga0265338_10151940
1196 Ga0265338_10188720
1197 Ga0265760_10015429
1198 Ga0265330_10056557
1199 Ga0265320_10000385
1200 Ga0265325_10009187
1201 Ga0265325_10133697
1202 Ga0265329_10000973
1203 Ga0265340_10003173
1204 Ga0265339_10004421
1205 Ga0265339_10124772
1206 Ga0265331_10000025
1207 Ga0265331_10016080
1208 Ga0265331_10172384
1209 Ga0265316_10000827
1210 Ga0265316_10018017
1211 Ga0307509_10039792
1212 Ga0307408_100075235
1213 Ga0265313_10000796
1214 Ga0265313_10074749
1215 Ga0265314_10169100
1216 Ga0265342_10000648
1217 Ga0373926_0000044
1218 Ga0373926_0008175
1219 Ga0373934_0036863
1220 Ga0373949_0008409
1221 Ga0373952_0008218
1222 Ga0373936_0080674
1223 Ga0373943_0032356
1224 Ga0373946_0004082
1225 Ga0373946_0028011
1226 Ga0373955_0341849
1227 Ga0373955_0394090
1228 Ga0373942_0105024
1229 Ga0373961_0016090
1230 Ga0373924_0137457
1231 Ga0373931_0010668
1232 Ga0373931_0016767
1233 Ga0373935_0007966
1234 Ga0373927_0000357
1235 Ga0373927_0005950
1236 Ga0373927_0019570
1237 Ga0373927_0468676
1238 Ga0373947_0002044
1239 Ga0373947_0006244
1240 Ga0373947_0065196
1241 Ga0373947_0233819
1242 Ga0373937_0024425
1243 Ga0373937_0280326
1244 Ga0373925_0000225
1245 Ga0373925_0040492
1246 Ga0373925_0151325
1247 Ga0436365_0523233
1248 Ga0436361_0142725
1249 Ga0436363_1092030
1250 Ga0439453_0000225
1251 Ga0439461_0092128
1252 Ga0439466_0107465
1253 Ga0439441_000726
1254 Ga0439443_000024
1255 Ga0439432_075773
1256 Ga0439450_000270
1257 Ga0439451_001016
1258 Ga0439452_018075
1259 Ga0439456_001168
1260 Ga0439463_001852
1261 Ga0439446_0003789
1262 Ga0439434_0041790
1263 Ga0439435_0000871
1264 Ga0439444_0000037
1265 Ga0439464_0000330
1266 Ga0439460_0001015
1267 Ga0450893_0000404
1268 Ga0439440_0001030
1269 Ga0439440_0008357
1270 Ga0466963_0002432
1271 Ga0466963_0510940
1272 Ga0453684_0015340
1273 Ga0466959_0362212
1274 Ga0451576_0067841
1275 Ga0466967_0008639
1276 Ga0466967_0010460
1277 Ga0495592_0007008
1278 Ga0495651_0000845
1279 Ga0495651_0002579
1280 Ga0495651_0038429
1281 Ga0495653_0004861
1282 Ga0495653_0151838
1283 Ga0495650_0024665
1284 Ga0495580_0007984
1285 Ga0495580_0012291
1286 Ga0495580_0023526
1287 Ga0495580_0066315
1288 Ga0495639_0169203
1289 Ga0495664_0044061
1290 Ga0495584_0033554
1291 Ga0495594_0026237
1292 Ga0495596_0017231
1293 Ga0495608_0008455
1294 Ga0495618_0006052
1295 Ga0495618_0045804
1296 Ga0495628_0001882
1297 Ga0495630_0002997
1298 Ga0495630_0004734
1299 Ga0495630_0048063
1300 Ga0495630_0808629
1301 Ga0495666_0005110
1302 Ga0495666_0079411
1303 Ga0495642_0125946
1304 Ga0495652_0005736
1305 Ga0495652_0005835
1306 Ga0495665_0005119
1307 Ga0495665_0150927
1308 Ga0495586_0001491
1309 Ga0495586_0229469
1310 Ga0495587_0001476
1311 Ga0495587_0011183
1312 Ga0495587_0362636
1313 Ga0495667_0001535
1314 Ga0495667_0012956
1315 Ga0495667_0282087
1316 Ga0495667_0289129
1317 Ga0495656_0070208
1318 Ga0495634_0053998
1319 Ga0495635_0007553
1320 Ga0495635_0030914
1321 Ga0495659_0156340
1322 Ga0495657_0014030
1323 Ga0495657_0017687
1324 Ga0495599_0090251
1325 Ga0495599_0187503
1326 Ga0495623_0006319
1327 Ga0495646_0007833
1328 Ga0495647_0180257
1329 Ga0495613_0025450
1330 Ga0495613_0094378
1331 Ga0495624_0002258
1332 Ga0495624_0030777
1333 Ga0495670_0036300
1334 Ga0495600_0006435
1335 Ga0495604_0004539
1336 Ga0495604_0014733
1337 Ga0495604_0015183
1338 Ga0495636_0054720
1339 Ga0495674_0034746
1340 Ga0495674_0035045
1341 Ga0495674_0041533
1342 Ga0495674_0141518
1343 Ga0495674_0405235
1344 Ga0495680_0001573
1345 Ga0495680_0021811
1346 Ga0495675_0000350
1347 Ga0495675_0010613
1348 Ga0495675_0012918
1349 Ga0495675_0033322
1350 Ga0495675_0040731
1351 Ga0495677_0023853
1352 Ga0495684_0007907
1353 Ga0495684_0177461
1354 Ga0495602_0007361
1355 Ga0495602_0023867
1356 Ga0495602_0101702
1357 Ga0495602_0156909
1358 Ga0495614_0009716
1359 Ga0496100_0017971
1360 Ga0496100_0299284
1361 Ga0496101_0082392
1362 Ga0496102_0006312
1363 Ga0496102_0052914
1364 Ga0496103_0056929
1365 Ga0496104_0049517
1366 Ga0496106_0005230
1367 Ga0496106_0390019
1368 Ga0496107_0018474
1369 Ga0496109_0422083
1370 Ga0496112_0000850
1371 Ga0496112_0226848
1372 Ga0496112_0230824
1373 Ga0496112_0632468
1374 Ga0496126_0021608
1375 Ga0501290_003730
1376 Ga0501297_010383
1377 Ga0501031_0044858
1378 Ga0501031_0130598
1379 Ga0501032_0107010
1380 Ga0501033_0200131
1381 Ga0501033_0205204
1382 Ga0501034_0212418
1383 Ga0501036_0004787
1384 Ga0501036_0012112
1385 Ga0501036_0763303
1386 Ga0501037_0012304
1387 Ga0501037_0117441
1388 Ga0501038_0362944
1389 Ga0501038_0389162
1390 Ga0501039_0012437
1391 Ga0501039_0110321
1392 Ga0501039_0387089
1393 Ga0501041_0003523
1394 Ga0501041_0004623
1395 Ga0501041_0039959
1396 Ga0501042_0011353
1397 Ga0501042_0013730
1398 Ga0501042_0120888
1399 Ga0501046_0110619
1400 Ga0501046_0130412
1401 Ga0501048_0013359
1402 Ga0501048_0018313
1403 Ga0501068_0087245
1404 Ga0501068_0247305
1405 Ga0501070_0022145
1406 Ga0501070_0695639
1407 Ga0501071_0006990
1408 Ga0501071_0415584
1409 Ga0501071_0503061
1410 Ga0501072_0008897
1411 Ga0501072_0011198
1412 Ga0501072_0359830
1413 Ga0501073_0006100
1414 Ga0501074_0021808
1415 Ga0501074_0039931
1416 Ga0501075_0000345
1417 Ga0501075_0000553
1418 Ga0501075_0024250
1419 Ga0501076_0000749
1420 Ga0501076_0012168
1421 Ga0501076_0093343
1422 Ga0501076_0328431
1423 Ga0501077_0016771
1424 Ga0501077_0079663
1425 Ga0501079_0082313
1426 Ga0501079_0089338
1427 Ga0501080_0007167
1428 Ga0501081_0002216
1429 Ga0501081_0005875
1430 Ga0501083_0038043
1431 Ga0501035_0037509
1432 Ga0501035_0183639
1433 Ga0501035_0382767
1434 Ga0501044_0057609
1435 Ga0501045_0004573
1436 Ga0501045_0008874
1437 nmdc:mga05p37_111060_c1
1438 nmdc:mga05p37_146459_c1
1439 nmdc:mga05p37_242508_c1
1440 nmdc:mga05p37_56279_c1
1441 nmdc:mga09592_189375_c1
1442 nmdc:mga09592_29059_c1
1443 nmdc:mga09592_381745_c1
1444 nmdc:mga09592_44233_c1
1445 nmdc:mga0qj67_124617_c1
1446 nmdc:mga0qj67_424629_c1
1447 nmdc:mga0qj67_626094_c1
1448 nmdc:mga06r32_172408_c1
1449 nmdc:mga06r32_23148_c1
1450 nmdc:mga06r32_302035_c1
1451 nmdc:mga06r32_366380_c1
1452 nmdc:mga08y16_202585_c1
1453 nmdc:mga08y16_262754_c1
1454 nmdc:mga08y16_35884_c1
1455 nmdc:mga08y16_54979_c1
1456 nmdc:mga08y16_627551_c1
1457 nmdc:mga0n895_10435_c1
1458 nmdc:mga0n895_22_c1
1459 nmdc:mga0n895_75861_c1
1460 nmdc:mga0n895_8992_c1
1461 nmdc:mga0rr50_232341_c1
1462 nmdc:mga0rr50_44254_c1
1463 nmdc:mga0rr50_5304_c1
1464 nmdc:mga0rr50_69702_c1
1465 nmdc:mga08x19_11314_c1
1466 nmdc:mga08x19_118226_c1
1467 nmdc:mga08x19_2334_c1
1468 nmdc:mga0a205_111500_c1
1469 nmdc:mga0a205_167101_c1
1470 nmdc:mga0a205_42664_c1
1471 nmdc:mga0a205_54720_c1
1472 Ga0495612_0003555
1473 Ga0501084_0013339
1474 Ga0501084_0119606
1475 Ga0501082_0002992
1476 Ga0501082_0022017
1477 Ga0501082_0067068
1478 Ga0501082_0240065
1479 Ga0530510_0001835
1480 Ga0530510_0042400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

39

226

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

260

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3awd-assembly1.cif.gz_D crystal structure of gox2181 0.9549 6 233
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.9497 6 236
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9457 8 233
4npc-assembly1.cif.gz_A crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis 0.945 5 232
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9449 6 234
ID Description Score Start End Superfamily
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 6 233 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.948 7 182 3.40.50.720
4iboB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9461 6 235 3.40.50.720
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.945 5 232 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 6 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N5VS29-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9969 1 189 GO:0016616
AF-A0A3N5VS29-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9916 1 189 GO:0016616
AF-A0A2V8GU96-F1-model_v4 Short-chain dehydrogenase 0.9858 82 237 GO:0016616
GO:0030497
AF-A0A3M1W386-F1-model_v4 deleted 0.985 6 237
AF-A0A6A7LFN5-F1-model_v4 SDR family oxidoreductase 0.9835 2 235 GO:0016616
GO:0030497

Map