F478495

General Info

Members Datasets Scaffolds Average Seq Length
739 403 727 180

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2791355199|2793080827
Length 210
Sequence RILTFLVAIAALCGATSLAQAQGTASKGAKENAKDAAKSAPAPAAKQPAKPESAAAAAAGGAEPTLIGQYGTWGAYTATPNGRKVCFALAKPSSSKTNPPNRPRDPAYAFVSTRPAERVVNEVSIMMGYALKPGSESSLEVGGAAYAMYTQGDGLWIKNAAEEEQMVSAMRKSAEVTVKGISAKGTETTDIFSLKGLSQALDRLAQDCKR

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
3 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
4 2791355199
5 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
6 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
7 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
8 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
9 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
10 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
11 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
12 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
120 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
121 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
122 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
200 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
204 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
297 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
298 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
324 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
358 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
362 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
367 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
373 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
379 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
380 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
381 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
382 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
383 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
384 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
387 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
391 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
392 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
393 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
394 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
395 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
396 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
399 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
403 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.14
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.07
Nodule 1.49
Rhizoplane 6.22
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004407 3300000549 Bacteria 1836
2 JGI24739J22299_10003081 3300001989 Bacteria 6366
3 JGI24737J22298_10001562 3300001990 Bacteria 8149
4 JGI25406J46586_10000084 3300003203 Bacteria 42873
5 JGI25153J46596_10004214 3300003215 Bacteria 7794
6 rootL2_10098350 3300003322 Bacteria 1156
7 JGI25404J52841_10006328 3300003659 Bacteria 2474
8 JGI25404J52841_10017978 3300003659 Bacteria 1532
9 Ga0070658_10177258 3300005327 Bacteria 1793
10 Ga0070683_100016037 3300005329 Bacteria 6594
11 Ga0068869_100140325 3300005334 Bacteria 1865
12 Ga0070680_100017817 3300005336 Bacteria 5603
13 Ga0070680_100047058 3300005336 Bacteria 3511
14 Ga0070680_100188278 3300005336 Bacteria 1739
15 Ga0070682_100376895 3300005337 Bacteria 1066
16 Ga0068868_100022449 3300005338 Bacteria 4762
17 Ga0068868_100080304 3300005338 Bacteria 2614
18 Ga0068868_100143537 3300005338 Bacteria 1962
19 Ga0070660_100004126 3300005339 Bacteria 10025
20 Ga0070660_100205647 3300005339 Bacteria 1597
21 Ga0070689_100174326 3300005340 Bacteria 1744
22 Ga0070661_100080664 3300005344 Bacteria 2401
23 Ga0070661_100130039 3300005344 Bacteria 1890
24 Ga0070661_100206410 3300005344 Bacteria 1503
25 Ga0070692_10430735 3300005345 Bacteria 840
26 Ga0070668_100024015 3300005347 Bacteria 4616
27 Ga0070668_101030544 3300005347 Bacteria 740
28 Ga0070675_100614301 3300005354 Bacteria 986
29 Ga0070671_100130971 3300005355 Bacteria 2113
30 Ga0070673_100109913 3300005364 Bacteria 2285
31 Ga0070673_100404974 3300005364 Bacteria 1220
32 Ga0070659_100223559 3300005366 Bacteria 1555
33 Ga0070709_10001493 3300005434 Bacteria 12637
34 Ga0070709_10021213 3300005434 Bacteria 3781
35 Ga0070709_10469679 3300005434 Bacteria 951
36 Ga0070714_100016089 3300005435 Bacteria 6030
37 Ga0070714_100112792 3300005435 Bacteria 2410
38 Ga0070713_100018419 3300005436 Bacteria 5306
39 Ga0070713_100499101 3300005436 Bacteria 1148
40 Ga0070710_10213368 3300005437 Bacteria 1224
41 Ga0070711_100001085 3300005439 Bacteria 14533
42 Ga0070711_100008899 3300005439 Bacteria 6161
43 Ga0070705_100437775 3300005440 Bacteria 977
44 Ga0070700_100158256 3300005441 Bacteria 1556
45 Ga0070700_100307384 3300005441 Bacteria 1160
46 Ga0070700_100445948 3300005441 Bacteria 984
47 Ga0070700_100457295 3300005441 Bacteria 973
48 Ga0070663_100015823 3300005455 Bacteria 4880
49 Ga0070663_100045325 3300005455 Bacteria 3106
50 Ga0070663_100097054 3300005455 Bacteria 2193
51 Ga0070663_100129104 3300005455 Bacteria 1917
52 Ga0070663_100166764 3300005455 Bacteria 1699
53 Ga0070678_100482853 3300005456 Bacteria 1091
54 Ga0070662_100033660 3300005457 Bacteria 3610
55 Ga0070681_10001992 3300005458 Bacteria 18473
56 Ga0070681_10074024 3300005458 Bacteria 3367
57 Ga0070681_10276400 3300005458 Bacteria 1591
58 Ga0070707_100567640 3300005468 Bacteria 1097
59 Ga0070698_100204644 3300005471 Bacteria 1909
60 Ga0070698_100330834 3300005471 Bacteria 1455
61 Ga0070679_100011919 3300005530 Bacteria 8298
62 Ga0070679_100736119 3300005530 Bacteria 929
63 Ga0070679_100867617 3300005530 Bacteria 846
64 Ga0070684_100010508 3300005535 Bacteria 7337
65 Ga0070684_100011123 3300005535 Bacteria 7162
66 Ga0070697_100199038 3300005536 Bacteria 1703
67 Ga0068853_100001665 3300005539 Bacteria 16258
68 Ga0068853_100097223 3300005539 Bacteria 2599
69 Ga0068853_100197591 3300005539 Bacteria 1829
70 Ga0068853_100669388 3300005539 Bacteria 989
71 Ga0068853_100854860 3300005539 Bacteria 873
72 Ga0070672_100066280 3300005543 Bacteria 2859
73 Ga0070672_100542954 3300005543 Bacteria 1009
74 Ga0070686_100575021 3300005544 Bacteria 884
75 Ga0070693_100040877 3300005547 Bacteria 2606
76 Ga0070665_100041983 3300005548 Bacteria 4598
77 Ga0070665_100232811 3300005548 Bacteria 1842
78 Ga0070665_100249049 3300005548 Bacteria 1777
79 Ga0068855_100018783 3300005563 Bacteria 8311
80 Ga0068855_100077134 3300005563 Bacteria 3866
81 Ga0068855_100236381 3300005563 Bacteria 2043
82 Ga0068855_100495226 3300005563 Bacteria 1329
83 Ga0070664_100238571 3300005564 Bacteria 1631
84 Ga0068857_100024046 3300005577 Bacteria 5363
85 Ga0068857_100072529 3300005577 Bacteria 3068
86 Ga0068854_100189213 3300005578 Bacteria 1612
87 Ga0068856_100023911 3300005614 Bacteria 5942
88 Ga0068856_100102708 3300005614 Bacteria 2852
89 Ga0068856_100344821 3300005614 Bacteria 1508
90 Ga0068856_100463424 3300005614 Bacteria 1288
91 Ga0070702_100087640 3300005615 Bacteria 1880
92 Ga0070702_100096312 3300005615 Bacteria 1806
93 Ga0068852_100134708 3300005616 Bacteria 2280
94 Ga0068852_100180915 3300005616 Bacteria 1982
95 Ga0068852_100269226 3300005616 Bacteria 1639
96 Ga0068852_100611579 3300005616 Bacteria 1095
97 Ga0068852_100709052 3300005616 Bacteria 1017
98 Ga0068859_100509805 3300005617 Bacteria 1298
99 Ga0068864_100066634 3300005618 Bacteria 3125
100 Ga0068864_100152522 3300005618 Bacteria 2094
101 Ga0068864_100259304 3300005618 Bacteria 1616
102 Ga0068866_10148146 3300005718 Bacteria 1356
103 Ga0068866_10413109 3300005718 Bacteria 873
104 Ga0068861_100085730 3300005719 Bacteria 2474
105 Ga0068861_100146106 3300005719 Bacteria 1935
106 Ga0068851_10048225 3300005834 Bacteria 2159
107 Ga0068863_100210004 3300005841 Bacteria 1875
108 Ga0068863_100395831 3300005841 Bacteria 1350
109 Ga0068863_100411663 3300005841 Bacteria 1323
110 Ga0068863_100536006 3300005841 Bacteria 1155
111 Ga0068858_100062483 3300005842 Bacteria 3443
112 Ga0068860_100221470 3300005843 Bacteria 1837
113 Ga0068860_100222819 3300005843 Bacteria 1832
114 Ga0068860_100224696 3300005843 Bacteria 1824
115 Ga0068860_100251412 3300005843 Bacteria 1721
116 Ga0068862_100145341 3300005844 Bacteria 2107
117 Ga0068862_100588853 3300005844 Bacteria 1066
118 Ga0068862_100607833 3300005844 Bacteria 1050
119 Ga0081455_10016975 3300005937 Bacteria 6997
120 Ga0081455_10028194 3300005937 Bacteria 5133
121 Ga0081455_10051561 3300005937 Bacteria 3529
122 Ga0081455_10161849 3300005937 Bacteria 1714
123 Ga0081538_10052170 3300005981 Bacteria 2447
124 Ga0081540_1001674 3300005983 Bacteria 18853
125 Ga0081540_1002221 3300005983 Bacteria 16011
126 Ga0081540_1006582 3300005983 Bacteria 8432
127 Ga0081540_1018565 3300005983 Bacteria 4260
128 Ga0081540_1037369 3300005983 Bacteria 2575
129 Ga0081540_1041905 3300005983 Bacteria 2368
130 Ga0081539_10000265 3300005985 Bacteria 120457
131 Ga0070717_10082702 3300006028 Bacteria 2699
132 Ga0075365_10002290 3300006038 Bacteria 9305
133 Ga0075365_10052404 3300006038 Bacteria 2698
134 Ga0075365_10054575 3300006038 Bacteria 2650
135 Ga0075368_10021336 3300006042 Bacteria 2460
136 Ga0075363_100072702 3300006048 Bacteria 1870
137 Ga0075363_100302289 3300006048 Bacteria 929
138 Ga0075364_10053334 3300006051 Bacteria 2644
139 Ga0070715_10001806 3300006163 Bacteria 6379
140 Ga0070716_100014088 3300006173 Bacteria 4090
141 Ga0070716_100054078 3300006173 Bacteria 2292
142 Ga0070716_100426178 3300006173 Bacteria 961
143 Ga0070712_100012707 3300006175 Bacteria 5359
144 Ga0070712_100035671 3300006175 Bacteria 3377
145 Ga0070712_100869998 3300006175 Bacteria 776
146 Ga0075362_10031828 3300006177 Bacteria 2285
147 Ga0075362_10124023 3300006177 Bacteria 1224
148 Ga0075367_10145921 3300006178 Bacteria 1467
149 Ga0075367_10146480 3300006178 Bacteria 1464
150 Ga0075369_10031630 3300006186 Bacteria 2235
151 Ga0075369_10103416 3300006186 Bacteria 1279
152 Ga0075366_10047218 3300006195 Bacteria 2552
153 Ga0075366_10192574 3300006195 Bacteria 1239
154 Ga0075366_10583674 3300006195 Bacteria 693
155 Ga0097621_100092247 3300006237 Bacteria 2536
156 Ga0097621_100144016 3300006237 Bacteria 2039
157 Ga0075370_10006907 3300006353 Bacteria 5746
158 Ga0075370_10131120 3300006353 Bacteria 1462
159 Ga0075370_10158511 3300006353 Bacteria 1327
160 Ga0068871_100868655 3300006358 Bacteria 835
161 Ga0075428_100326409 3300006844 Bacteria 1649
162 Ga0075434_100058879 3300006871 Bacteria 3818
163 Ga0075434_100675566 3300006871 Bacteria 1051
164 Ga0097620_100509836 3300006931 Bacteria 1298
165 Ga0099795_10042024 3300007788 Bacteria 1630
166 Ga0099795_10121495 3300007788 Bacteria 1045
167 Ga0105240_10004498 3300009093 Bacteria 21190
168 Ga0105240_10011557 3300009093 Bacteria 12285
169 Ga0105240_10153098 3300009093 Bacteria 2745
170 Ga0105240_10199947 3300009093 Bacteria 2343
171 Ga0105245_10117167 3300009098 Bacteria 2484
172 Ga0105245_10169785 3300009098 Bacteria 2076
173 Ga0105245_10448366 3300009098 Bacteria 1298
174 Ga0105247_10200160 3300009101 Bacteria 1342
175 Ga0114129_10415165 3300009147 Bacteria 1771
176 Ga0105241_10323502 3300009174 Bacteria 1331
177 Ga0105241_10797878 3300009174 Bacteria 870
178 Ga0105242_10162896 3300009176 Bacteria 1954
179 Ga0105248_10085942 3300009177 Bacteria 3539
180 Ga0105248_10227154 3300009177 Bacteria 2101
181 Ga0105248_10228366 3300009177 Bacteria 2095
182 Ga0105248_10491871 3300009177 Bacteria 1383
183 Ga0105248_10537052 3300009177 Bacteria 1319
184 Ga0105248_10560242 3300009177 Bacteria 1289
185 Ga0105248_10760976 3300009177 Bacteria 1093
186 Ga0105237_10028299 3300009545 Bacteria 5710
187 Ga0105237_10093189 3300009545 Bacteria 3002
188 Ga0105237_10295718 3300009545 Bacteria 1622
189 Ga0105237_10556846 3300009545 Bacteria 1153
190 Ga0105238_10000767 3300009551 Bacteria 33436
191 Ga0105238_10007795 3300009551 Bacteria 10711
192 Ga0105238_10229005 3300009551 Bacteria 1835
193 Ga0105249_10344301 3300009553 Bacteria 1508
194 Ga0105249_10679457 3300009553 Bacteria 1089
195 Ga0099796_10116095 3300010159 Bacteria 1024
196 Ga0105239_10020968 3300010375 Bacteria 7211
197 Ga0105239_10048539 3300010375 Bacteria 4655
198 Ga0105239_10403051 3300010375 Bacteria 1548
199 Ga0105239_10403686 3300010375 Bacteria 1547
200 Ga0105239_10440587 3300010375 Bacteria 1477
201 Ga0105239_10534742 3300010375 Bacteria 1334
202 Ga0105239_10609964 3300010375 Bacteria 1245
203 Ga0105239_10644279 3300010375 Bacteria 1210
204 Ga0105239_10924799 3300010375 Bacteria 1001
205 Ga0105246_10291370 3300011119 Bacteria 1313
206 Ga0157371_10029771 3300013102 Bacteria 3944
207 Ga0157370_10011199 3300013104 Bacteria 9404
208 Ga0157370_10175523 3300013104 Bacteria 1992
209 Ga0157370_10281542 3300013104 Bacteria 1536
210 Ga0157369_10014719 3300013105 Bacteria 8826
211 Ga0157369_10036939 3300013105 Bacteria 5351
212 Ga0157369_10357788 3300013105 Bacteria 1516
213 Ga0157369_10424549 3300013105 Bacteria 1378
214 Ga0157374_10208313 3300013296 Bacteria 1916
215 Ga0157374_10980821 3300013296 Bacteria 864
216 Ga0157378_10083215 3300013297 Bacteria 2895
217 Ga0157372_10335300 3300013307 Bacteria 1761
218 Ga0157372_10464990 3300013307 Bacteria 1474
219 Ga0157372_10629768 3300013307 Bacteria 1250
220 Ga0163163_10052545 3300014325 Bacteria 4020
221 Ga0163163_10194775 3300014325 Bacteria 2075
222 Ga0157380_10573375 3300014326 Bacteria 1111
223 Ga0157377_10201737 3300014745 Bacteria 1263
224 Ga0157379_10047548 3300014968 Bacteria 3827
225 Ga0157379_10111976 3300014968 Bacteria 2452
226 Ga0157379_10745312 3300014968 Bacteria 922
227 Ga0157376_10447832 3300014969 Bacteria 1259
228 Ga0163161_10021791 3300017792 Bacteria 4506
229 Ga0214544_1000016 3300021320 Bacteria 204278
230 Ga0214542_1000016 3300021321 Bacteria 210332
231 Ga0214545_1000008 3300021324 Bacteria 215190
232 Ga0214543_1000043 3300021327 Bacteria 160517
233 Ga0209758_1005787 3300025297 Bacteria 9270
234 Ga0207656_10069669 3300025321 Bacteria 1560
235 Ga0207682_10190194 3300025893 Bacteria 940
236 Ga0207692_10006026 3300025898 Bacteria 4901
237 Ga0207688_10023383 3300025901 Bacteria 3384
238 Ga0207688_10486389 3300025901 Bacteria 772
239 Ga0207647_10002312 3300025904 Bacteria 14514
240 Ga0207647_10078653 3300025904 Bacteria 1981
241 Ga0207647_10207626 3300025904 Bacteria 1132
242 Ga0207647_10317888 3300025904 Bacteria 884
243 Ga0207685_10014596 3300025905 Bacteria 2464
244 Ga0207699_10018399 3300025906 Bacteria 3701
245 Ga0207699_10494027 3300025906 Bacteria 883
246 Ga0207645_10134097 3300025907 Bacteria 1612
247 Ga0207705_10053520 3300025909 Bacteria 2908
248 Ga0207705_10136184 3300025909 Bacteria 1831
249 Ga0207654_10104095 3300025911 Bacteria 1754
250 Ga0207707_10000445 3300025912 Bacteria 42982
251 Ga0207707_10000990 3300025912 Bacteria 27321
252 Ga0207707_10084648 3300025912 Bacteria 2769
253 Ga0207707_10112081 3300025912 Bacteria 2385
254 Ga0207695_10021945 3300025913 Bacteria 7266
255 Ga0207695_10174609 3300025913 Bacteria 2072
256 Ga0207671_10579235 3300025914 Bacteria 895
257 Ga0207693_10001330 3300025915 Bacteria 21856
258 Ga0207693_10017779 3300025915 Bacteria 5669
259 Ga0207663_10001827 3300025916 Bacteria 10032
260 Ga0207663_10026590 3300025916 Bacteria 3361
261 Ga0207660_10007283 3300025917 Bacteria 7160
262 Ga0207660_10161006 3300025917 Bacteria 1731
263 Ga0207660_10246492 3300025917 Bacteria 1409
264 Ga0207657_10057982 3300025919 Bacteria 3335
265 Ga0207657_10180129 3300025919 Bacteria 1708
266 Ga0207657_10328153 3300025919 Bacteria 1209
267 Ga0207649_10273327 3300025920 Bacteria 1226
268 Ga0207649_10686403 3300025920 Bacteria 793
269 Ga0207652_10003759 3300025921 Bacteria 12435
270 Ga0207652_10011887 3300025921 Bacteria 7023
271 Ga0207681_10467722 3300025923 Bacteria 1028
272 Ga0207694_10011956 3300025924 Bacteria 6545
273 Ga0207694_10020073 3300025924 Bacteria 5054
274 Ga0207694_10266493 3300025924 Bacteria 1404
275 Ga0207694_10277251 3300025924 Bacteria 1376
276 Ga0207659_10195990 3300025926 Bacteria 1610
277 Ga0207687_10016378 3300025927 Bacteria 4869
278 Ga0207687_10173374 3300025927 Bacteria 1665
279 Ga0207700_10011006 3300025928 Bacteria 5747
280 Ga0207700_10487564 3300025928 Bacteria 1090
281 Ga0207664_10002909 3300025929 Bacteria 11376
282 Ga0207664_10245040 3300025929 Bacteria 1562
283 Ga0207664_10933610 3300025929 Bacteria 779
284 Ga0207690_10315214 3300025932 Bacteria 1228
285 Ga0207709_10029659 3300025935 Bacteria 3176
286 Ga0207704_10181384 3300025938 Bacteria 1522
287 Ga0207704_10780522 3300025938 Bacteria 797
288 Ga0207665_10000843 3300025939 Bacteria 20718
289 Ga0207665_10051404 3300025939 Bacteria 2774
290 Ga0207665_10161046 3300025939 Bacteria 1614
291 Ga0207691_10038499 3300025940 Bacteria 4426
292 Ga0207691_10171660 3300025940 Bacteria 1899
293 Ga0207711_10254616 3300025941 Bacteria 1613
294 Ga0207689_10010002 3300025942 Bacteria 8177
295 Ga0207689_10124484 3300025942 Bacteria 2121
296 Ga0207689_10352424 3300025942 Bacteria 1224
297 Ga0207661_10001081 3300025944 Bacteria 18103
298 Ga0207661_10039324 3300025944 Bacteria 3712
299 Ga0207661_10790502 3300025944 Bacteria 874
300 Ga0207679_10104904 3300025945 Bacteria 2219
301 Ga0207679_10830377 3300025945 Bacteria 843
302 Ga0207667_10011487 3300025949 Bacteria 10286
303 Ga0207667_10124632 3300025949 Bacteria 2654
304 Ga0207667_10336237 3300025949 Bacteria 1542
305 Ga0207712_10034760 3300025961 Bacteria 3418
306 Ga0207668_10023936 3300025972 Bacteria 3934
307 Ga0207668_10549444 3300025972 Bacteria 1000
308 Ga0207668_10600198 3300025972 Bacteria 959
309 Ga0207640_10016790 3300025981 Bacteria 4267
310 Ga0207640_10217350 3300025981 Bacteria 1461
311 Ga0207658_10147477 3300025986 Bacteria 1913
312 Ga0207677_10167246 3300026023 Bacteria 1715
313 Ga0207677_10310024 3300026023 Bacteria 1307
314 Ga0207703_10185692 3300026035 Bacteria 1838
315 Ga0207639_10003274 3300026041 Bacteria 10910
316 Ga0207639_10382364 3300026041 Bacteria 1264
317 Ga0207678_10011118 3300026067 Bacteria 7907
318 Ga0207678_10043469 3300026067 Bacteria 3888
319 Ga0207678_10088296 3300026067 Bacteria 2650
320 Ga0207678_10129958 3300026067 Bacteria 2148
321 Ga0207678_10277926 3300026067 Bacteria 1437
322 Ga0207678_10903668 3300026067 Bacteria 781
323 Ga0207678_11029127 3300026067 Bacteria 729
324 Ga0207708_10227305 3300026075 Bacteria 1497
325 Ga0207702_10060716 3300026078 Bacteria 3223
326 Ga0207702_10748509 3300026078 Bacteria 965
327 Ga0207641_10195997 3300026088 Bacteria 1859
328 Ga0207641_10256679 3300026088 Bacteria 1635
329 Ga0207641_10474214 3300026088 Bacteria 1212
330 Ga0207648_10983761 3300026089 Bacteria 790
331 Ga0207676_10053412 3300026095 Bacteria 3163
332 Ga0207676_10694248 3300026095 Bacteria 985
333 Ga0207674_10002936 3300026116 Bacteria 21181
334 Ga0207674_10005387 3300026116 Bacteria 15226
335 Ga0207674_10043166 3300026116 Bacteria 4651
336 Ga0207674_10466219 3300026116 Bacteria 1221
337 Ga0207675_100025514 3300026118 Bacteria 5500
338 Ga0207675_100327350 3300026118 Bacteria 1497
339 Ga0207683_10377637 3300026121 Bacteria 1302
340 Ga0207683_10470225 3300026121 Bacteria 1160
341 Ga0207698_10197105 3300026142 Bacteria 1800
342 Ga0207698_10419681 3300026142 Bacteria 1283
343 Ga0207698_10499776 3300026142 Bacteria 1183
344 Ga0207698_10551643 3300026142 Bacteria 1130
345 Ga0209813_10019215 3300027866 Bacteria 1897
346 Ga0268266_10003674 3300028379 Bacteria 15150
347 Ga0268266_10004060 3300028379 Bacteria 14149
348 Ga0268266_10015017 3300028379 Bacteria 6647
349 Ga0268266_10040844 3300028379 Bacteria 3955
350 Ga0268266_10300988 3300028379 Bacteria 1496
351 Ga0268266_10839131 3300028379 Bacteria 888
352 Ga0268266_11166968 3300028379 Bacteria 745
353 Ga0268265_10203958 3300028380 Bacteria 1717
354 Ga0268265_10920568 3300028380 Bacteria 859
355 Ga0268264_10181539 3300028381 Bacteria 1912
356 Ga0268264_10206815 3300028381 Bacteria 1799
357 Ga0268264_10275684 3300028381 Bacteria 1573
358 Ga0265763_1018696 3300030763 Bacteria 712
359 Ga0265332_10073435 3300031238 Bacteria 1455
360 Ga0265332_10106507 3300031238 Bacteria 1182
361 Ga0265332_10114411 3300031238 Bacteria 1135
362 Ga0265339_10017310 3300031249 Bacteria 4272
363 Ga0265331_10041531 3300031250 Bacteria 2235
364 Ga0307513_10113448 3300031456 Bacteria 2698
365 Ga0307408_100107661 3300031548 Bacteria 2135
366 Ga0307508_10036258 3300031616 Bacteria 4441
367 Ga0265314_10030517 3300031711 Bacteria 3988
368 Ga0265314_10106031 3300031711 Bacteria 1796
369 Ga0265314_10210176 3300031711 Bacteria 1143
370 Ga0265342_10005300 3300031712 Bacteria 9883
371 Ga0307516_10013268 3300031730 Bacteria 8793
372 Ga0307405_10241089 3300031731 Bacteria 1339
373 Ga0307406_10248410 3300031901 Bacteria 1339
374 Ga0307406_10954488 3300031901 Bacteria 733
375 Ga0307407_10334716 3300031903 Bacteria 1067
376 Ga0307412_10866129 3300031911 Bacteria 789
377 Ga0307416_100137467 3300032002 Bacteria 2214
378 Ga0307416_100298320 3300032002 Bacteria 1600
379 Ga0307416_100974368 3300032002 Bacteria 950
380 Ga0307411_11209872 3300032005 Bacteria 685
381 Ga0307415_100102777 3300032126 Bacteria 2101
382 Ga0307415_100390794 3300032126 Bacteria 1184
383 Ga0373930_0010827 3300034816 Bacteria 1637
384 Ga0373948_0027421 3300034817 Bacteria 1128
385 Ga0373959_0072765 3300034820 Bacteria 780
386 Ga0373928_0033945 3300035084 Bacteria 1143
387 Ga0373934_0071200 3300035086 Bacteria 1391
388 Ga0373944_0016469 3300035089 Bacteria 2086
389 Ga0373951_0047821 3300035091 Bacteria 1046
390 Ga0373951_0079506 3300035091 Bacteria 847
391 Ga0373952_0017696 3300035092 Bacteria 1465
392 Ga0373932_0134792 3300035112 Bacteria 835
393 Ga0373936_0006488 3300035113 Bacteria 4412
394 Ga0373936_0036855 3300035113 Bacteria 1951
395 Ga0373936_0133424 3300035113 Bacteria 1068
396 Ga0373945_0009473 3300035116 Bacteria 3191
397 Ga0373953_0003561 3300035117 Bacteria 4870
398 Ga0373953_0052366 3300035117 Bacteria 1652
399 Ga0373954_0005495 3300035118 Bacteria 5483
400 Ga0373956_0012061 3300035119 Bacteria 3574
401 Ga0373957_0006428 3300035120 Bacteria 3701
402 Ga0373946_0001985 3300035171 Bacteria 7160
403 Ga0373955_0006993 3300035172 Bacteria 5164
404 Ga0373955_0270636 3300035172 Bacteria 1021
405 Ga0373942_0012242 3300035207 Bacteria 2046
406 Ga0373924_0008980 3300035410 Bacteria 3653
407 Ga0373931_0039790 3300035691 Bacteria 2464
408 Ga0373935_0000046 3300035692 Bacteria 48734
409 Ga0373927_0000209 3300035695 Bacteria 46820
410 Ga0373927_0018902 3300035695 Bacteria 4521
411 Ga0373927_0056990 3300035695 Bacteria 2527
412 Ga0373927_0326902 3300035695 Bacteria 1010
413 Ga0373933_0344625 3300035724 Bacteria 967
414 Ga0373947_0002390 3300035725 Bacteria 11333
415 Ga0373947_0318240 3300035725 Bacteria 1040
416 Ga0373937_0122269 3300036401 Bacteria 2426
417 Ga0373937_0270653 3300036401 Bacteria 1603
418 Ga0373925_0128019 3300037068 Bacteria 1977
419 Ga0373925_0142028 3300037068 Bacteria 1880
420 Ga0395899_0064309 3300037312 Bacteria 2697
421 Ga0395900_0006715 3300037418 Bacteria 11947
422 Ga0395900_0260653 3300037418 Bacteria 1732
423 Ga0395900_0399889 3300037418 Bacteria 1338
424 Ga0395898_0017586 3300037466 Bacteria 7296
425 Ga0395898_0023802 3300037466 Bacteria 6184
426 Ga0395898_0129003 3300037466 Bacteria 2422
427 Ga0395898_0136817 3300037466 Bacteria 2346
428 Ga0395898_0172868 3300037466 Bacteria 2065
429 Ga0395905_0031610 3300037471 Bacteria 4983
430 Ga0395905_1092588 3300037471 Bacteria 701
431 Ga0395901_0055054 3300038443 Bacteria 4136
432 Ga0395901_0078214 3300038443 Bacteria 3454
433 Ga0395901_0258187 3300038443 Bacteria 1814
434 Ga0395901_0270747 3300038443 Bacteria 1766
435 Ga0436363_1457096 3300039450 Bacteria 840
436 Ga0439465_0029497 3300041413 Bacteria 1743
437 Ga0451793_0130578 3300041452 Bacteria 635
438 Ga0451795_0972193 3300041456 Bacteria 855
439 Ga0451806_270177 3300041462 Bacteria 772
440 Ga0451843_1570788 3300041509 Bacteria 711
441 Ga0450905_035059 3300042142 Bacteria 784
442 Ga0466963_0005447 3300044694 Bacteria 7455
443 Ga0466964_0034844 3300044706 Bacteria 2010
444 Ga0466971_0209137 3300044719 Bacteria 922
445 Ga0466968_0004513 3300044735 Bacteria 5207
446 Ga0466959_0313446 3300045049 Bacteria 1073
447 Ga0466967_0013380 3300045976 Bacteria 6337
448 Ga0466967_0060474 3300045976 Bacteria 3357
449 Ga0466967_0162440 3300045976 Bacteria 2097
450 Ga0466967_0230370 3300045976 Bacteria 1764
451 Ga0466967_0508706 3300045976 Bacteria 1183
452 Ga0495617_030574 3300046452 Bacteria 1810
453 Ga0495592_0008934 3300046454 Bacteria 7523
454 Ga0495592_0051355 3300046454 Bacteria 3062
455 Ga0495603_0000259 3300046455 Bacteria 27881
456 Ga0495603_0008575 3300046455 Bacteria 6177
457 Ga0495603_0041656 3300046455 Bacteria 2746
458 Ga0495629_0002432 3300046459 Bacteria 14294
459 Ga0495629_0437676 3300046459 Bacteria 886
460 Ga0495641_0002618 3300046461 Bacteria 14079
461 Ga0495651_0014811 3300046462 Bacteria 6030
462 Ga0495653_0026125 3300046463 Bacteria 4686
463 Ga0495653_0051592 3300046463 Bacteria 3157
464 Ga0495650_0138376 3300046471 Bacteria 883
465 Ga0495580_0003494 3300046472 Bacteria 13369
466 Ga0495582_0000486 3300046473 Bacteria 21751
467 Ga0495605_0068744 3300046474 Bacteria 1678
468 Ga0495639_0000862 3300046475 Bacteria 13749
469 Ga0495662_0001965 3300046476 Bacteria 10318
470 Ga0495662_0125383 3300046476 Bacteria 1261
471 Ga0495664_0012483 3300046477 Bacteria 4812
472 Ga0495664_0029399 3300046477 Bacteria 3214
473 Ga0495664_0337075 3300046477 Bacteria 909
474 Ga0495594_0002058 3300046499 Bacteria 10471
475 Ga0495594_0101589 3300046499 Bacteria 1618
476 Ga0495606_0003660 3300046507 Bacteria 16112
477 Ga0495606_0207676 3300046507 Bacteria 1111
478 Ga0495608_0013574 3300046511 Bacteria 5650
479 Ga0495628_0019320 3300046516 Bacteria 5634
480 Ga0495630_0003436 3300046517 Bacteria 11013
481 Ga0495630_0027345 3300046517 Bacteria 4231
482 Ga0495648_0001251 3300046524 Bacteria 25398
483 Ga0495663_0016702 3300046525 Bacteria 2076
484 Ga0495666_0013538 3300046526 Bacteria 4066
485 Ga0495652_0074294 3300046529 Bacteria 2827
486 Ga0495665_0000311 3300046531 Bacteria 24696
487 Ga0495640_0008655 3300046533 Bacteria 7976
488 Ga0495640_0035491 3300046533 Bacteria 3529
489 Ga0495640_0358015 3300046533 Bacteria 900
490 Ga0495587_0011369 3300046536 Bacteria 5641
491 Ga0495609_0161912 3300046538 Bacteria 948
492 Ga0495621_0018370 3300046539 Bacteria 2270
493 Ga0495645_0003153 3300046543 Bacteria 11175
494 Ga0495622_0002639 3300046557 Bacteria 8628
495 Ga0495622_0157255 3300046557 Bacteria 1026
496 Ga0495633_0127781 3300046558 Bacteria 1176
497 Ga0495633_0168142 3300046558 Bacteria 1011
498 Ga0495667_0036954 3300046559 Bacteria 3256
499 Ga0495667_0037997 3300046559 Bacteria 3207
500 Ga0495668_0133751 3300046616 Bacteria 1357
501 Ga0495668_0405584 3300046616 Bacteria 749
502 Ga0495634_0001829 3300046642 Bacteria 18374
503 Ga0495634_0103387 3300046642 Bacteria 1838
504 Ga0495625_0249331 3300046660 Bacteria 1153
505 Ga0495635_0002849 3300046663 Bacteria 11881
506 Ga0495588_0213103 3300046674 Bacteria 1020
507 Ga0495657_0015384 3300046675 Bacteria 5601
508 Ga0495599_0004679 3300046678 Bacteria 8115
509 Ga0495599_0044545 3300046678 Bacteria 2783
510 Ga0495599_0059544 3300046678 Bacteria 2389
511 Ga0495623_0011461 3300046679 Bacteria 5738
512 Ga0495623_0201202 3300046679 Bacteria 1145
513 Ga0495646_0027225 3300046680 Bacteria 3587
514 Ga0495646_0089061 3300046680 Bacteria 1786
515 Ga0495647_0000389 3300046681 Bacteria 12524
516 Ga0495658_0273016 3300046683 Bacteria 1066
517 Ga0495669_0036562 3300046684 Bacteria 2171
518 Ga0495669_0337178 3300046684 Bacteria 728
519 Ga0495613_0009884 3300046689 Bacteria 7092
520 Ga0495613_0272797 3300046689 Bacteria 1176
521 Ga0495613_0281743 3300046689 Bacteria 1154
522 Ga0495624_0000622 3300046690 Bacteria 27706
523 Ga0495670_0215813 3300046691 Bacteria 1018
524 Ga0495589_0084979 3300046794 Bacteria 1538
525 Ga0495600_0010405 3300046809 Bacteria 5776
526 Ga0495600_0308079 3300046809 Bacteria 998
527 Ga0495581_0003143 3300047315 Bacteria 9446
528 Ga0495581_0048593 3300047315 Bacteria 2450
529 Ga0495581_0071475 3300047315 Bacteria 2008
530 Ga0495581_0190372 3300047315 Bacteria 1200
531 Ga0495604_0057212 3300047317 Bacteria 2998
532 Ga0495674_0001665 3300047319 Bacteria 21844
533 Ga0495674_0036515 3300047319 Bacteria 4422
534 Ga0495672_0015332 3300047320 Bacteria 5208
535 Ga0495676_0242944 3300047321 Bacteria 1232
536 Ga0495680_0018556 3300047322 Bacteria 5898
537 Ga0495680_0071033 3300047322 Bacteria 2652
538 Ga0495677_0053716 3300047445 Bacteria 1486
539 Ga0495679_049955 3300047446 Bacteria 1260
540 Ga0495685_114342 3300047447 Bacteria 887
541 Ga0495673_0056055 3300047469 Bacteria 1707
542 Ga0495681_0168542 3300047470 Bacteria 907
543 Ga0495684_0019406 3300047471 Bacteria 5234
544 Ga0495684_0024969 3300047471 Bacteria 4596
545 Ga0495686_0267660 3300047472 Bacteria 954
546 Ga0495593_0000007 3300047673 Bacteria 87657
547 Ga0495602_0044685 3300048088 Bacteria 4015
548 Ga0495614_0012905 3300048089 Bacteria 3663
549 Ga0496100_0791650 3300048903 Bacteria 743
550 Ga0496100_0828050 3300048903 Bacteria 725
551 Ga0496101_0134723 3300048904 Bacteria 1878
552 Ga0496102_0156343 3300048905 Bacteria 2143
553 Ga0496102_0185750 3300048905 Bacteria 1959
554 Ga0496102_0323693 3300048905 Bacteria 1452
555 Ga0496102_0612127 3300048905 Bacteria 1012
556 Ga0496102_0966195 3300048905 Bacteria 773
557 Ga0496104_0024983 3300048907 Bacteria 5504
558 Ga0496104_0035278 3300048907 Bacteria 4670
559 Ga0496104_0074642 3300048907 Bacteria 3228
560 Ga0496104_0206984 3300048907 Bacteria 1874
561 Ga0496105_0089112 3300048908 Bacteria 2549
562 Ga0496105_0097528 3300048908 Bacteria 2428
563 Ga0496105_0152995 3300048908 Bacteria 1895
564 Ga0496106_0050023 3300048909 Bacteria 3149
565 Ga0496106_0059255 3300048909 Bacteria 2900
566 Ga0496106_0097281 3300048909 Bacteria 2279
567 Ga0496106_0607019 3300048909 Bacteria 876
568 Ga0496107_0055526 3300048910 Bacteria 2860
569 Ga0496108_0191328 3300048911 Bacteria 1773
570 Ga0496108_0236997 3300048911 Bacteria 1587
571 Ga0496108_0240436 3300048911 Bacteria 1575
572 Ga0496109_0024467 3300048912 Bacteria 5369
573 Ga0496109_0273723 3300048912 Bacteria 1591
574 Ga0496110_0054316 3300048913 Bacteria 3523
575 Ga0496110_0247840 3300048913 Bacteria 1621
576 Ga0496111_0114108 3300048914 Bacteria 1991
577 Ga0496111_0273228 3300048914 Bacteria 1254
578 Ga0496112_0000035 3300048915 Bacteria 106983
579 Ga0496112_0018177 3300048915 Bacteria 6616
580 Ga0496112_0063564 3300048915 Bacteria 3641
581 Ga0496112_0116195 3300048915 Bacteria 2646
582 Ga0496112_0242050 3300048915 Bacteria 1756
583 Ga0496113_0055405 3300048916 Bacteria 2972
584 Ga0496113_0220280 3300048916 Bacteria 1512
585 Ga0496113_0256439 3300048916 Bacteria 1397
586 Ga0496113_0506112 3300048916 Bacteria 970
587 Ga0496114_0025578 3300048917 Bacteria 4825
588 Ga0496114_0130553 3300048917 Bacteria 2169
589 Ga0496115_0052603 3300048918 Bacteria 3268
590 Ga0496115_0104691 3300048918 Bacteria 2322
591 Ga0496115_0190455 3300048918 Bacteria 1695
592 Ga0496116_0272092 3300048919 Bacteria 827
593 Ga0496118_0094094 3300048921 Bacteria 2050
594 Ga0496118_0114421 3300048921 Bacteria 1779
595 Ga0496119_0110145 3300048922 Bacteria 1530
596 Ga0496119_0132290 3300048922 Bacteria 1358
597 Ga0496120_0028338 3300048923 Bacteria 3433
598 Ga0496121_0023544 3300048924 Bacteria 5925
599 Ga0496121_0117259 3300048924 Bacteria 2017
600 Ga0496121_0359293 3300048924 Bacteria 967
601 Ga0496124_0233967 3300048927 Bacteria 1371
602 Ga0496125_0000516 3300048928 Bacteria 67232
603 Ga0496125_0067862 3300048928 Bacteria 2808
604 Ga0496126_0009932 3300048929 Bacteria 10048
605 Ga0496126_0013584 3300048929 Bacteria 8269
606 Ga0496126_0057284 3300048929 Bacteria 3519
607 Ga0496126_0435123 3300048929 Bacteria 1058
608 Ga0501031_0000248 3300049568 Bacteria 30285
609 Ga0501031_0064221 3300049568 Bacteria 2391
610 Ga0501032_0000387 3300049569 Bacteria 36261
611 Ga0501032_0356671 3300049569 Bacteria 942
612 Ga0501033_0000110 3300049570 Bacteria 78954
613 Ga0501033_0021023 3300049570 Bacteria 4926
614 Ga0501033_0554813 3300049570 Bacteria 791
615 Ga0501034_0000198 3300049571 Bacteria 113672
616 Ga0501034_0404884 3300049571 Bacteria 1287
617 Ga0501034_0791798 3300049571 Bacteria 841
618 Ga0501036_0000047 3300049572 Bacteria 75675
619 Ga0501036_0193246 3300049572 Bacteria 1712
620 Ga0501036_0237956 3300049572 Bacteria 1527
621 Ga0501037_0000050 3300049573 Bacteria 112824
622 Ga0501037_0299472 3300049573 Bacteria 1117
623 Ga0501038_0000463 3300049574 Bacteria 35636
624 Ga0501038_0485578 3300049574 Bacteria 946
625 Ga0501039_0000260 3300049575 Bacteria 38731
626 Ga0501041_0183242 3300049577 Bacteria 1311
627 Ga0501042_0021886 3300049578 Bacteria 4462
628 Ga0501042_0673143 3300049578 Bacteria 752
629 Ga0501043_0000153 3300049579 Bacteria 64297
630 Ga0501043_0069478 3300049579 Bacteria 2766
631 Ga0501043_0437613 3300049579 Bacteria 984
632 Ga0501043_0709070 3300049579 Bacteria 734
633 Ga0501043_0717479 3300049579 Bacteria 729
634 Ga0501046_0000678 3300049580 Bacteria 33047
635 Ga0501047_0003334 3300049581 Bacteria 15216
636 Ga0501047_0153240 3300049581 Bacteria 2179
637 Ga0501047_0399387 3300049581 Bacteria 1207
638 Ga0501047_0887080 3300049581 Bacteria 705
639 Ga0501048_0000323 3300049582 Bacteria 32874
640 Ga0501067_0000101 3300049583 Bacteria 49019
641 Ga0501067_0335551 3300049583 Bacteria 842
642 Ga0501068_0001632 3300049584 Bacteria 11969
643 Ga0501070_0008034 3300049586 Bacteria 8933
644 Ga0501070_0050622 3300049586 Bacteria 3448
645 Ga0501071_0070981 3300049587 Bacteria 2538
646 Ga0501072_0000168 3300049588 Bacteria 47553
647 Ga0501074_0010655 3300049590 Bacteria 6673
648 Ga0501075_0204613 3300049591 Bacteria 1506
649 Ga0501076_0521497 3300049592 Bacteria 979
650 Ga0501079_0000308 3300049741 Bacteria 30498
651 Ga0501079_0348167 3300049741 Bacteria 1161
652 Ga0501080_0000093 3300049742 Bacteria 60276
653 Ga0501080_0420392 3300049742 Bacteria 1201
654 Ga0501083_0001922 3300049744 Bacteria 14285
655 Ga0501035_0005530 3300049822 Bacteria 11940
656 Ga0501044_0000100 3300049823 Bacteria 106729
657 Ga0501044_0035648 3300049823 Bacteria 5209
658 Ga0501044_0084898 3300049823 Bacteria 3199
659 Ga0501044_0166646 3300049823 Bacteria 2177
660 Ga0501044_0176093 3300049823 Bacteria 2108
661 Ga0501044_0276769 3300049823 Bacteria 1613
662 Ga0501045_0032228 3300049824 Bacteria 3797
663 nmdc:mga03683_188437_c1 3300050489 Bacteria 943
664 nmdc:mga03683_780_c1 3300050489 Bacteria 9142
665 nmdc:mga00v17_566533_c1 3300050491 Bacteria 734
666 nmdc:mga0yw44_29389_c1 3300050492 Bacteria 3173
667 nmdc:mga0yw44_899_c1 3300050492 Bacteria 11227
668 nmdc:mga0yw44_97098_c1 3300050492 Bacteria 1871
669 nmdc:mga0k408_306478_c1 3300050493 Bacteria 948
670 nmdc:mga0k408_48368_c1 3300050493 Bacteria 2460
671 nmdc:mga0k408_61833_c1 3300050493 Bacteria 2177
672 nmdc:mga06z11_150109_c1 3300050494 Bacteria 1324
673 nmdc:mga06z11_19223_c1 3300050494 Bacteria 3136
674 nmdc:mga06z11_78524_c1 3300050494 Bacteria 1765
675 nmdc:mga04h51_127207_c1 3300050495 Bacteria 955
676 nmdc:mga07m45_3481_c1 3300050496 Bacteria 7589
677 nmdc:mga05p37_249646_c1 3300050507 Bacteria 2129
678 nmdc:mga05p37_764282_c1 3300050507 Bacteria 1063
679 nmdc:mga09592_636951_c1 3300050508 Bacteria 911
680 nmdc:mga08y16_469826_c1 3300050511 Bacteria 1281
681 nmdc:mga0n895_109171_c1 3300050512 Bacteria 2782
682 nmdc:mga0rr50_272004_c1 3300050513 Bacteria 1412
683 nmdc:mga0sz30_134437_c1 3300050516 Bacteria 1091
684 nmdc:mga0sz30_223154_c1 3300050516 Bacteria 838
685 nmdc:mga0sz30_3901_c1 3300050516 Bacteria 3185
686 Ga0495601_0044175 3300053077 Bacteria 2801
687 Ga0495601_0052014 3300053077 Bacteria 2585
688 Ga0495612_0017966 3300053078 Bacteria 2830
689 Ga0495612_0024077 3300053078 Bacteria 2445
690 Ga0495612_0307461 3300053078 Bacteria 712
691 Ga0500635_0020934 3300053080 Bacteria 2009
692 Ga0495655_0121695 3300053083 Bacteria 795
693 Ga0495619_0067243 3300053085 Bacteria 2392
694 Ga0495619_0225404 3300053085 Bacteria 1298
695 Ga0495619_0494250 3300053085 Bacteria 842
696 Ga0495619_0617963 3300053085 Bacteria 741
697 Ga0500646_0027972 3300053090 Bacteria 1537
698 Ga0500583_0061412 3300053092 Bacteria 1774
699 Ga0500566_0001201 3300053094 Bacteria 15142
700 Ga0500641_0002974 3300053096 Bacteria 6001
701 Ga0500554_098315 3300053102 Bacteria 977
702 Ga0500572_004757 3300053111 Bacteria 3078
703 Ga0500591_042842 3300053115 Bacteria 2147
704 Ga0500594_0137635 3300053118 Bacteria 777
705 Ga0500607_124196 3300053121 Bacteria 1243
706 Ga0500642_0305205 3300053130 Bacteria 717
707 Ga0500559_0042679 3300053136 Bacteria 1979
708 Ga0500559_0133287 3300053136 Bacteria 1161
709 Ga0500589_058991 3300053147 Bacteria 1762
710 Ga0500603_001229 3300053150 Bacteria 5949
711 Ga0500603_003328 3300053150 Bacteria 3456
712 Ga0500604_0011901 3300053151 Bacteria 2344
713 Ga0500627_0118260 3300053158 Bacteria 1195
714 Ga0500630_047435 3300053159 Bacteria 2082
715 Ga0500634_0099595 3300053161 Bacteria 1457
716 Ga0500638_056238 3300053162 Bacteria 1895
717 Ga0500639_002913 3300053163 Bacteria 8623
718 Ga0500637_0048370 3300053178 Bacteria 2418
719 Ga0500567_119427 3300053723 Bacteria 1055
720 Ga0500611_065472 3300053727 Bacteria 872
721 Ga0500645_015436 3300053730 Bacteria 2419
722 Ga0500596_003108 3300053735 Bacteria 3192
723 Ga0500601_001657 3300053737 Bacteria 2403
724 Ga0501084_0018047 3300054114 Bacteria 5877
725 Ga0501084_0347375 3300054114 Bacteria 1253
726 Ga0501082_0011433 3300060353 Bacteria 7637
727 Ga0466962_0036868 3300061719 Bacteria 2341

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2513237098 2513675042 152
2 3300025904 Ga0207647_10317888 Ga0207647_103178881 157
3 3300037312 Ga0395899_0064309 Ga0395899_0064309_1327_1899 157
4 3300037466 Ga0395898_0129003 Ga0395898_0129003_974_1546 157
5 3300038443 Ga0395901_0270747 Ga0395901_0270747_938_1510 157
6 3300049570 Ga0501033_0554813 Ga0501033_0554813_47_619 157
7 3300049579 Ga0501043_0717479 Ga0501043_0717479_135_707 157
8 3300049823 Ga0501044_0276769 Ga0501044_0276769_694_1266 157
9 iso_pu_bacteria 8056681323 8056687176 157
10 3300025981 Ga0207640_10217350 Ga0207640_102173502 159
11 3300026142 Ga0207698_10551643 Ga0207698_105516431 159
12 3300035113 Ga0373936_0006488 Ga0373936_0006488_2345_2917 159
13 3300035116 Ga0373945_0009473 Ga0373945_0009473_2482_3054 159
14 3300035117 Ga0373953_0052366 Ga0373953_0052366_896_1468 159
15 3300035171 Ga0373946_0001985 Ga0373946_0001985_4125_4697 159
16 3300035692 Ga0373935_0000046 Ga0373935_0000046_39292_39864 159
17 3300035695 Ga0373927_0000209 Ga0373927_0000209_27140_27712 159
18 3300035725 Ga0373947_0002390 Ga0373947_0002390_10405_10977 159
19 3300037068 Ga0373925_0128019 Ga0373925_0128019_163_735 159
20 3300046454 Ga0495592_0051355 Ga0495592_0051355_1252_1824 159
21 3300046455 Ga0495603_0000259 Ga0495603_0000259_8332_8904 159
22 3300046459 Ga0495629_0002432 Ga0495629_0002432_2710_3282 159
23 3300046461 Ga0495641_0002618 Ga0495641_0002618_11561_12133 159
24 3300046463 Ga0495653_0026125 Ga0495653_0026125_1002_1574 159
25 3300046472 Ga0495580_0003494 Ga0495580_0003494_1390_1962 159
26 3300046473 Ga0495582_0000486 Ga0495582_0000486_295_867 159
27 3300046475 Ga0495639_0000862 Ga0495639_0000862_10076_10648 159
28 3300046476 Ga0495662_0001965 Ga0495662_0001965_3909_4481 159
29 3300046477 Ga0495664_0029399 Ga0495664_0029399_1819_2391 159
30 3300046499 Ga0495594_0002058 Ga0495594_0002058_6892_7464 159
31 3300046517 Ga0495630_0003436 Ga0495630_0003436_10197_10769 159
32 3300046526 Ga0495666_0013538 Ga0495666_0013538_297_869 159
33 3300046531 Ga0495665_0000311 Ga0495665_0000311_9750_10322 159
34 3300046533 Ga0495640_0035491 Ga0495640_0035491_985_1557 159
35 3300046557 Ga0495622_0002639 Ga0495622_0002639_3254_3826 159
36 3300046559 Ga0495667_0037997 Ga0495667_0037997_2248_2820 159
37 3300046642 Ga0495634_0001829 Ga0495634_0001829_3234_3806 159
38 3300046663 Ga0495635_0002849 Ga0495635_0002849_5749_6321 159
39 3300046678 Ga0495599_0059544 Ga0495599_0059544_871_1443 159
40 3300046679 Ga0495623_0201202 Ga0495623_0201202_388_960 159
41 3300046680 Ga0495646_0027225 Ga0495646_0027225_1801_2373 159
42 3300046681 Ga0495647_0000389 Ga0495647_0000389_11005_11577 159
43 3300046689 Ga0495613_0009884 Ga0495613_0009884_3590_4162 159
44 3300046690 Ga0495624_0000622 Ga0495624_0000622_18395_18967 159
45 3300046809 Ga0495600_0308079 Ga0495600_0308079_184_756 159
46 3300047315 Ga0495581_0003143 Ga0495581_0003143_2931_3503 159
47 3300047319 Ga0495674_0001665 Ga0495674_0001665_2794_3366 159
48 3300047322 Ga0495680_0071033 Ga0495680_0071033_2006_2578 159
49 3300047471 Ga0495684_0024969 Ga0495684_0024969_3993_4565 159
50 3300047673 Ga0495593_0000007 Ga0495593_0000007_67974_68546 159
51 3300048089 Ga0495614_0012905 Ga0495614_0012905_573_1145 159
52 3300053078 Ga0495612_0307461 Ga0495612_0307461_36_608 159
53 3300053085 Ga0495619_0067243 Ga0495619_0067243_507_1079 159
54 3300041452 Ga0451793_0130578 Ga0451793_0130578_26_619 160
55 iso_pu_bacteria 2904690495 2904691091 160
56 iso_pu_bacteria 2908756301 2908756485 160
57 3300009177 Ga0105248_10491871 Ga0105248_104918712 161
58 3300013296 Ga0157374_10980821 Ga0157374_109808211 161
59 3300048922 Ga0496119_0132290 Ga0496119_0132290_319_891 161
60 iso_pu_bacteria 2824773399 2824779787 162
61 3300005548 Ga0070665_100249049 Ga0070665_1002490492 163
62 3300005844 Ga0068862_100145341 Ga0068862_1001453412 163
63 3300026023 Ga0207677_10167246 Ga0207677_101672461 163
64 3300028381 Ga0268264_10181539 Ga0268264_101815392 163
65 3300046678 Ga0495599_0044545 Ga0495599_0044545_355_1029 163
66 3300053078 Ga0495612_0024077 Ga0495612_0024077_1135_1779 163
67 3300049581 Ga0501047_0887080 Ga0501047_0887080_35_568 164
68 3300049741 Ga0501079_0348167 Ga0501079_0348167_266_853 164
69 3300053121 Ga0500607_124196 Ga0500607_124196_383_952 164
70 3300053178 Ga0500637_0048370 Ga0500637_0048370_1734_2384 164
71 3300006173 Ga0070716_100426178 Ga0070716_1004261781 165
72 3300025917 Ga0207660_10161006 Ga0207660_101610061 165
73 3300035089 Ga0373944_0016469 Ga0373944_0016469_1005_1640 165
74 3300047320 Ga0495672_0015332 Ga0495672_0015332_3613_4188 165
75 3300048903 Ga0496100_0828050 Ga0496100_0828050_32_640 165
76 3300046660 Ga0495625_0249331 Ga0495625_0249331_160_810 166
77 3300035091 Ga0373951_0079506 Ga0373951_0079506_14_607 167
78 3300048916 Ga0496113_0220280 Ga0496113_0220280_591_1232 167
79 3300009174 Ga0105241_10323502 Ga0105241_103235022 168
80 3300009177 Ga0105248_10227154 Ga0105248_102271542 168
81 3300010375 Ga0105239_10048539 Ga0105239_100485392 168
82 3300021320 Ga0214544_1000016 Ga0214544_100001672 168
83 3300021321 Ga0214542_1000016 Ga0214542_1000016130 168
84 3300021324 Ga0214545_1000008 Ga0214545_1000008136 168
85 3300021327 Ga0214543_1000043 Ga0214543_100004386 168
86 3300030763 Ga0265763_1018696 Ga0265763_10186961 168
87 3300034816 Ga0373930_0010827 Ga0373930_0010827_705_1346 168
88 3300034817 Ga0373948_0027421 Ga0373948_0027421_382_1023 168
89 3300034820 Ga0373959_0072765 Ga0373959_0072765_38_679 168
90 3300035084 Ga0373928_0033945 Ga0373928_0033945_203_844 168
91 3300035091 Ga0373951_0047821 Ga0373951_0047821_80_721 168
92 3300035092 Ga0373952_0017696 Ga0373952_0017696_163_804 168
93 3300035112 Ga0373932_0134792 Ga0373932_0134792_155_796 168
94 3300035207 Ga0373942_0012242 Ga0373942_0012242_893_1534 168
95 3300048904 Ga0496101_0134723 Ga0496101_0134723_957_1598 168
96 3300048905 Ga0496102_0156343 Ga0496102_0156343_941_1582 168
97 3300048907 Ga0496104_0035278 Ga0496104_0035278_897_1538 168
98 3300048908 Ga0496105_0152995 Ga0496105_0152995_556_1197 168
99 3300048909 Ga0496106_0050023 Ga0496106_0050023_2017_2658 168
100 3300048910 Ga0496107_0055526 Ga0496107_0055526_1925_2566 168
101 3300048911 Ga0496108_0236997 Ga0496108_0236997_120_761 168
102 3300048913 Ga0496110_0054316 Ga0496110_0054316_1973_2614 168
103 3300048914 Ga0496111_0114108 Ga0496111_0114108_725_1366 168
104 3300048915 Ga0496112_0242050 Ga0496112_0242050_246_887 168
105 3300048917 Ga0496114_0025578 Ga0496114_0025578_1110_1751 168
106 3300048918 Ga0496115_0104691 Ga0496115_0104691_687_1328 168
107 3300053077 Ga0495601_0044175 Ga0495601_0044175_2073_2696 168
108 3300053083 Ga0495655_0121695 Ga0495655_0121695_139_756 168
109 3300053158 Ga0500627_0118260 Ga0500627_0118260_231_854 168
110 3300005439 Ga0070711_100008899 Ga0070711_1000088995 169
111 3300005844 Ga0068862_100588853 Ga0068862_1005888532 169
112 3300006028 Ga0070717_10082702 Ga0070717_100827022 169
113 3300025972 Ga0207668_10600198 Ga0207668_106001981 169
114 3300031456 Ga0307513_10113448 Ga0307513_101134481 169
115 3300035172 Ga0373955_0270636 Ga0373955_0270636_376_942 169
116 3300036401 Ga0373937_0270653 Ga0373937_0270653_207_773 169
117 3300044706 Ga0466964_0034844 Ga0466964_0034844_504_1166 169
118 3300046507 Ga0495606_0207676 Ga0495606_0207676_26_661 169
119 3300046511 Ga0495608_0013574 Ga0495608_0013574_4288_4854 169
120 3300046533 Ga0495640_0358015 Ga0495640_0358015_147_761 169
121 3300047315 Ga0495581_0190372 Ga0495581_0190372_348_962 169
122 3300047321 Ga0495676_0242944 Ga0495676_0242944_82_726 169
123 3300047469 Ga0495673_0056055 Ga0495673_0056055_922_1530 169
124 3300048928 Ga0496125_0000516 Ga0496125_0000516_24703_25344 169
125 3300005336 Ga0070680_100017817 Ga0070680_1000178175 170
126 3300009177 Ga0105248_10560242 Ga0105248_105602421 170
127 3300009545 Ga0105237_10556846 Ga0105237_105568461 170
128 3300010159 Ga0099796_10116095 Ga0099796_101160951 170
129 3300010375 Ga0105239_10403686 Ga0105239_104036862 170
130 3300014325 Ga0163163_10052545 Ga0163163_100525452 170
131 3300014968 Ga0157379_10047548 Ga0157379_100475483 170
132 3300025986 Ga0207658_10147477 Ga0207658_101474772 170
133 3300035691 Ga0373931_0039790 Ga0373931_0039790_1730_2317 170
134 3300038443 Ga0395901_0078214 Ga0395901_0078214_847_1509 170
135 3300046455 Ga0495603_0041656 Ga0495603_0041656_1124_1720 170
136 3300047445 Ga0495677_0053716 Ga0495677_0053716_197_841 170
137 3300047446 Ga0495679_049955 Ga0495679_049955_480_1124 170
138 3300048905 Ga0496102_0185750 Ga0496102_0185750_1045_1632 170
139 3300048907 Ga0496104_0024983 Ga0496104_0024983_2105_2692 170
140 3300048908 Ga0496105_0089112 Ga0496105_0089112_1682_2269 170
141 3300048909 Ga0496106_0097281 Ga0496106_0097281_1621_2208 170
142 3300048911 Ga0496108_0191328 Ga0496108_0191328_672_1259 170
143 3300048912 Ga0496109_0273723 Ga0496109_0273723_400_987 170
144 3300048914 Ga0496111_0273228 Ga0496111_0273228_564_1151 170
145 3300048915 Ga0496112_0018177 Ga0496112_0018177_4583_5170 170
146 3300048916 Ga0496113_0055405 Ga0496113_0055405_1328_1915 170
147 3300048918 Ga0496115_0190455 Ga0496115_0190455_405_992 170
148 3300048921 Ga0496118_0114421 Ga0496118_0114421_96_740 170
149 3300048923 Ga0496120_0028338 Ga0496120_0028338_2067_2681 170
150 3300048929 Ga0496126_0009932 Ga0496126_0009932_7115_7759 170
151 3300053080 Ga0500635_0020934 Ga0500635_0020934_578_1174 170
152 3300053102 Ga0500554_098315 Ga0500554_098315_65_661 170
153 3300053150 Ga0500603_001229 Ga0500603_001229_865_1461 170
154 3300003215 JGI25153J46596_10004214 JGI25153J46596_100042144 171
155 3300005344 Ga0070661_100206410 Ga0070661_1002064102 171
156 3300005441 Ga0070700_100445948 Ga0070700_1004459481 171
157 3300005577 Ga0068857_100024046 Ga0068857_1000240465 171
158 3300005834 Ga0068851_10048225 Ga0068851_100482252 171
159 3300007788 Ga0099795_10042024 Ga0099795_100420242 171
160 3300009093 Ga0105240_10011557 Ga0105240_100115571 171
161 3300009177 Ga0105248_10085942 Ga0105248_100859422 171
162 3300009545 Ga0105237_10028299 Ga0105237_100282991 171
163 3300009545 Ga0105237_10093189 Ga0105237_100931892 171
164 3300009551 Ga0105238_10000767 Ga0105238_100007679 171
165 3300013104 Ga0157370_10011199 Ga0157370_100111998 171
166 3300013105 Ga0157369_10014719 Ga0157369_100147193 171
167 3300025297 Ga0209758_1005787 Ga0209758_10057876 171
168 3300025321 Ga0207656_10069669 Ga0207656_100696691 171
169 3300025909 Ga0207705_10136184 Ga0207705_101361841 171
170 3300025919 Ga0207657_10057982 Ga0207657_100579823 171
171 3300025919 Ga0207657_10180129 Ga0207657_101801292 171
172 3300025920 Ga0207649_10273327 Ga0207649_102733272 171
173 3300025932 Ga0207690_10315214 Ga0207690_103152141 171
174 3300025944 Ga0207661_10039324 Ga0207661_100393241 171
175 3300026142 Ga0207698_10419681 Ga0207698_104196812 171
176 3300035695 Ga0373927_0018902 Ga0373927_0018902_114_710 171
177 3300046689 Ga0495613_0281743 Ga0495613_0281743_12_608 171
178 3300048905 Ga0496102_0612127 Ga0496102_0612127_11_658 171
179 3300048907 Ga0496104_0206984 Ga0496104_0206984_222_869 171
180 3300048915 Ga0496112_0116195 Ga0496112_0116195_1816_2463 171
181 3300048916 Ga0496113_0256439 Ga0496113_0256439_536_1183 171
182 3300048924 Ga0496121_0359293 Ga0496121_0359293_278_931 171
183 3300048929 Ga0496126_0435123 Ga0496126_0435123_110_763 171
184 3300050493 nmdc:mga0k408_306478_c1 nmdc:mga0k408_306478_c1_189_857 171
185 3300050493 nmdc:mga0k408_48368_c1 nmdc:mga0k408_48368_c1_1713_2360 171
186 3300050494 nmdc:mga06z11_78524_c1 nmdc:mga06z11_78524_c1_328_975 171
187 3300050512 nmdc:mga0n895_109171_c1 nmdc:mga0n895_109171_c1_1515_2162 171
188 3300050516 nmdc:mga0sz30_134437_c1 nmdc:mga0sz30_134437_c1_224_871 171
189 3300005468 Ga0070707_100567640 Ga0070707_1005676401 172
190 3300005618 Ga0068864_100152522 Ga0068864_1001525222 172
191 3300005718 Ga0068866_10148146 Ga0068866_101481461 172
192 3300005843 Ga0068860_100251412 Ga0068860_1002514121 172
193 3300009098 Ga0105245_10117167 Ga0105245_101171672 172
194 3300009101 Ga0105247_10200160 Ga0105247_102001601 172
195 3300009174 Ga0105241_10797878 Ga0105241_107978781 172
196 3300009551 Ga0105238_10229005 Ga0105238_102290052 172
197 3300009553 Ga0105249_10344301 Ga0105249_103443012 172
198 3300010375 Ga0105239_10440587 Ga0105239_104405872 172
199 3300010375 Ga0105239_10609964 Ga0105239_106099642 172
200 3300014969 Ga0157376_10447832 Ga0157376_104478321 172
201 3300025942 Ga0207689_10124484 Ga0207689_101244844 172
202 3300026116 Ga0207674_10466219 Ga0207674_104662192 172
203 3300028380 Ga0268265_10203958 Ga0268265_102039582 172
204 3300028381 Ga0268264_10206815 Ga0268264_102068151 172
205 3300031901 Ga0307406_10954488 Ga0307406_109544881 172
206 3300035695 Ga0373927_0056990 Ga0373927_0056990_626_1249 172
207 3300041413 Ga0439465_0029497 Ga0439465_0029497_712_1356 172
208 3300046616 Ga0495668_0405584 Ga0495668_0405584_63_692 172
209 3300046674 Ga0495588_0213103 Ga0495588_0213103_127_783 172
210 3300048912 Ga0496109_0024467 Ga0496109_0024467_4407_5054 172
211 3300048919 Ga0496116_0272092 Ga0496116_0272092_53_682 172
212 3300048928 Ga0496125_0067862 Ga0496125_0067862_384_1037 172
213 3300001989 JGI24739J22299_10003081 JGI24739J22299_100030815 173
214 3300001990 JGI24737J22298_10001562 JGI24737J22298_100015626 173
215 3300005334 Ga0068869_100140325 Ga0068869_1001403251 173
216 3300005339 Ga0070660_100205647 Ga0070660_1002056472 173
217 3300005577 Ga0068857_100072529 Ga0068857_1000725293 173
218 3300005615 Ga0070702_100087640 Ga0070702_1000876402 173
219 3300005616 Ga0068852_100269226 Ga0068852_1002692262 173
220 3300005618 Ga0068864_100259304 Ga0068864_1002593041 173
221 3300005937 Ga0081455_10161849 Ga0081455_101618491 173
222 3300006038 Ga0075365_10052404 Ga0075365_100524043 173
223 3300006048 Ga0075363_100302289 Ga0075363_1003022892 173
224 3300006175 Ga0070712_100012707 Ga0070712_1000127072 173
225 3300006177 Ga0075362_10031828 Ga0075362_100318283 173
226 3300006178 Ga0075367_10146480 Ga0075367_101464802 173
227 3300006195 Ga0075366_10192574 Ga0075366_101925742 173
228 3300006353 Ga0075370_10131120 Ga0075370_101311202 173
229 3300006871 Ga0075434_100058879 Ga0075434_1000588794 173
230 3300010375 Ga0105239_10534742 Ga0105239_105347422 173
231 3300025901 Ga0207688_10023383 Ga0207688_100233832 173
232 3300025906 Ga0207699_10018399 Ga0207699_100183993 173
233 3300025912 Ga0207707_10084648 Ga0207707_100846482 173
234 3300025915 Ga0207693_10017779 Ga0207693_100177795 173
235 3300025938 Ga0207704_10780522 Ga0207704_107805221 173
236 3300025939 Ga0207665_10161046 Ga0207665_101610461 173
237 3300025940 Ga0207691_10171660 Ga0207691_101716602 173
238 3300025942 Ga0207689_10010002 Ga0207689_100100025 173
239 3300026067 Ga0207678_10129958 Ga0207678_101299582 173
240 3300026095 Ga0207676_10694248 Ga0207676_106942481 173
241 3300026116 Ga0207674_10043166 Ga0207674_100431663 173
242 3300026118 Ga0207675_100327350 Ga0207675_1003273502 173
243 3300026121 Ga0207683_10470225 Ga0207683_104702252 173
244 3300027866 Ga0209813_10019215 Ga0209813_100192151 173
245 3300028379 Ga0268266_11166968 Ga0268266_111669681 173
246 3300031250 Ga0265331_10041531 Ga0265331_100415311 173
247 3300031711 Ga0265314_10210176 Ga0265314_102101761 173
248 3300031731 Ga0307405_10241089 Ga0307405_102410892 173
249 3300031901 Ga0307406_10248410 Ga0307406_102484102 173
250 3300031903 Ga0307407_10334716 Ga0307407_103347162 173
251 3300032002 Ga0307416_100974368 Ga0307416_1009743682 173
252 3300044735 Ga0466968_0004513 Ga0466968_0004513_3401_4045 173
253 3300046477 Ga0495664_0337075 Ga0495664_0337075_271_852 173
254 3300048927 Ga0496124_0233967 Ga0496124_0233967_640_1281 173
255 3300048929 Ga0496126_0057284 Ga0496126_0057284_1892_2473 173
256 3300050489 nmdc:mga03683_188437_c1 nmdc:mga03683_188437_c1_29_682 173
257 3300050513 nmdc:mga0rr50_272004_c1 nmdc:mga0rr50_272004_c1_186_839 173
258 3300053096 Ga0500641_0002974 Ga0500641_0002974_4600_5256 173
259 3300053118 Ga0500594_0137635 Ga0500594_0137635_15_671 173
260 3300053147 Ga0500589_058991 Ga0500589_058991_388_1044 173
261 3300053151 Ga0500604_0011901 Ga0500604_0011901_1383_2045 173
262 iso_pu_bacteria 2889033259 2889035386 173
263 3300003659 JGI25404J52841_10006328 JGI25404J52841_100063282 174
264 3300003659 JGI25404J52841_10017978 JGI25404J52841_100179781 174
265 3300005338 Ga0068868_100022449 Ga0068868_1000224492 174
266 3300005344 Ga0070661_100130039 Ga0070661_1001300392 174
267 3300005347 Ga0070668_100024015 Ga0070668_1000240154 174
268 3300005347 Ga0070668_101030544 Ga0070668_1010305441 174
269 3300005355 Ga0070671_100130971 Ga0070671_1001309712 174
270 3300005364 Ga0070673_100109913 Ga0070673_1001099132 174
271 3300005366 Ga0070659_100223559 Ga0070659_1002235591 174
272 3300005441 Ga0070700_100307384 Ga0070700_1003073842 174
273 3300005455 Ga0070663_100129104 Ga0070663_1001291042 174
274 3300005456 Ga0070678_100482853 Ga0070678_1004828531 174
275 3300005471 Ga0070698_100330834 Ga0070698_1003308342 174
276 3300005543 Ga0070672_100066280 Ga0070672_1000662802 174
277 3300005547 Ga0070693_100040877 Ga0070693_1000408772 174
278 3300005548 Ga0070665_100232811 Ga0070665_1002328112 174
279 3300005564 Ga0070664_100238571 Ga0070664_1002385712 174
280 3300005614 Ga0068856_100023911 Ga0068856_1000239113 174
281 3300005841 Ga0068863_100395831 Ga0068863_1003958312 174
282 3300005842 Ga0068858_100062483 Ga0068858_1000624834 174
283 3300005843 Ga0068860_100224696 Ga0068860_1002246961 174
284 3300005983 Ga0081540_1001674 Ga0081540_100167412 174
285 3300005983 Ga0081540_1002221 Ga0081540_100222112 174
286 3300006353 Ga0075370_10158511 Ga0075370_101585111 174
287 3300009147 Ga0114129_10415165 Ga0114129_104151652 174
288 3300011119 Ga0105246_10291370 Ga0105246_102913702 174
289 3300014326 Ga0157380_10573375 Ga0157380_105733752 174
290 3300025893 Ga0207682_10190194 Ga0207682_101901941 174
291 3300025911 Ga0207654_10104095 Ga0207654_101040951 174
292 3300025914 Ga0207671_10579235 Ga0207671_105792351 174
293 3300025923 Ga0207681_10467722 Ga0207681_104677222 174
294 3300025924 Ga0207694_10266493 Ga0207694_102664932 174
295 3300025927 Ga0207687_10016378 Ga0207687_100163782 174
296 3300025945 Ga0207679_10830377 Ga0207679_108303771 174
297 3300025981 Ga0207640_10016790 Ga0207640_100167905 174
298 3300026067 Ga0207678_10088296 Ga0207678_100882962 174
299 3300026075 Ga0207708_10227305 Ga0207708_102273052 174
300 3300026078 Ga0207702_10060716 Ga0207702_100607163 174
301 3300026088 Ga0207641_10195997 Ga0207641_101959971 174
302 3300028379 Ga0268266_10015017 Ga0268266_100150174 174
303 3300028380 Ga0268265_10920568 Ga0268265_109205681 174
304 3300028381 Ga0268264_10275684 Ga0268264_102756842 174
305 3300032126 Ga0307415_100390794 Ga0307415_1003907942 174
306 3300035724 Ga0373933_0344625 Ga0373933_0344625_288_869 174
307 3300044719 Ga0466971_0209137 Ga0466971_0209137_150_770 174
308 3300045049 Ga0466959_0313446 Ga0466959_0313446_427_1047 174
309 3300046455 Ga0495603_0008575 Ga0495603_0008575_2926_3582 174
310 3300046517 Ga0495630_0027345 Ga0495630_0027345_2067_2648 174
311 3300046525 Ga0495663_0016702 Ga0495663_0016702_1257_1886 174
312 3300046680 Ga0495646_0089061 Ga0495646_0089061_922_1503 174
313 3300047315 Ga0495581_0071475 Ga0495581_0071475_1062_1691 174
314 3300047470 Ga0495681_0168542 Ga0495681_0168542_56_685 174
315 3300048903 Ga0496100_0791650 Ga0496100_0791650_36_671 174
316 3300048905 Ga0496102_0323693 Ga0496102_0323693_609_1244 174
317 3300049568 Ga0501031_0064221 Ga0501031_0064221_181_804 174
318 3300049570 Ga0501033_0021023 Ga0501033_0021023_2520_3143 174
319 3300049573 Ga0501037_0299472 Ga0501037_0299472_169_792 174
320 3300049581 Ga0501047_0153240 Ga0501047_0153240_124_747 174
321 3300049586 Ga0501070_0050622 Ga0501070_0050622_2571_3194 174
322 3300049823 Ga0501044_0035648 Ga0501044_0035648_2120_2743 174
323 3300050489 nmdc:mga03683_780_c1 nmdc:mga03683_780_c1_619_1272 174
324 3300050491 nmdc:mga00v17_566533_c1 nmdc:mga00v17_566533_c1_25_654 174
325 3300050492 nmdc:mga0yw44_899_c1 nmdc:mga0yw44_899_c1_9671_10324 174
326 3300050493 nmdc:mga0k408_61833_c1 nmdc:mga0k408_61833_c1_493_1146 174
327 3300050494 nmdc:mga06z11_150109_c1 nmdc:mga06z11_150109_c1_386_1039 174
328 3300050507 nmdc:mga05p37_249646_c1 nmdc:mga05p37_249646_c1_703_1356 174
329 3300050507 nmdc:mga05p37_764282_c1 nmdc:mga05p37_764282_c1_311_970 174
330 3300050508 nmdc:mga09592_636951_c1 nmdc:mga09592_636951_c1_203_856 174
331 3300050516 nmdc:mga0sz30_3901_c1 nmdc:mga0sz30_3901_c1_906_1559 174
332 3300053723 Ga0500567_119427 Ga0500567_119427_313_927 174
333 3300005329 Ga0070683_100016037 Ga0070683_1000160373 175
334 3300005336 Ga0070680_100188278 Ga0070680_1001882782 175
335 3300005340 Ga0070689_100174326 Ga0070689_1001743262 175
336 3300005436 Ga0070713_100499101 Ga0070713_1004991012 175
337 3300005441 Ga0070700_100457295 Ga0070700_1004572951 175
338 3300005458 Ga0070681_10074024 Ga0070681_100740243 175
339 3300005471 Ga0070698_100204644 Ga0070698_1002046442 175
340 3300005535 Ga0070684_100011123 Ga0070684_1000111235 175
341 3300005536 Ga0070697_100199038 Ga0070697_1001990382 175
342 3300005544 Ga0070686_100575021 Ga0070686_1005750211 175
343 3300005614 Ga0068856_100463424 Ga0068856_1004634242 175
344 3300005617 Ga0068859_100509805 Ga0068859_1005098052 175
345 3300005618 Ga0068864_100066634 Ga0068864_1000666344 175
346 3300005841 Ga0068863_100536006 Ga0068863_1005360062 175
347 3300005937 Ga0081455_10028194 Ga0081455_100281945 175
348 3300006177 Ga0075362_10124023 Ga0075362_101240232 175
349 3300006186 Ga0075369_10103416 Ga0075369_101034161 175
350 3300006931 Ga0097620_100509836 Ga0097620_1005098362 175
351 3300009177 Ga0105248_10228366 Ga0105248_102283662 175
352 3300009177 Ga0105248_10537052 Ga0105248_105370522 175
353 3300014325 Ga0163163_10194775 Ga0163163_101947752 175
354 3300014968 Ga0157379_10111976 Ga0157379_101119762 175
355 3300014968 Ga0157379_10745312 Ga0157379_107453121 175
356 3300025906 Ga0207699_10494027 Ga0207699_104940271 175
357 3300025919 Ga0207657_10328153 Ga0207657_103281532 175
358 3300025929 Ga0207664_10933610 Ga0207664_109336101 175
359 3300025941 Ga0207711_10254616 Ga0207711_102546162 175
360 3300025944 Ga0207661_10001081 Ga0207661_100010816 175
361 3300026088 Ga0207641_10474214 Ga0207641_104742142 175
362 3300026095 Ga0207676_10053412 Ga0207676_100534122 175
363 3300032002 Ga0307416_100137467 Ga0307416_1001374672 175
364 3300032126 Ga0307415_100102777 Ga0307415_1001027773 175
365 3300035086 Ga0373934_0071200 Ga0373934_0071200_369_1010 175
366 3300035695 Ga0373927_0326902 Ga0373927_0326902_41_670 175
367 3300037418 Ga0395900_0399889 Ga0395900_0399889_674_1279 175
368 3300037466 Ga0395898_0136817 Ga0395898_0136817_555_1160 175
369 3300038443 Ga0395901_0055054 Ga0395901_0055054_2994_3599 175
370 3300045976 Ga0466967_0230370 Ga0466967_0230370_892_1527 175
371 3300046539 Ga0495621_0018370 Ga0495621_0018370_1228_1857 175
372 3300046691 Ga0495670_0215813 Ga0495670_0215813_310_939 175
373 3300048905 Ga0496102_0966195 Ga0496102_0966195_102_698 175
374 3300048907 Ga0496104_0074642 Ga0496104_0074642_1543_2172 175
375 3300048908 Ga0496105_0097528 Ga0496105_0097528_911_1540 175
376 3300048909 Ga0496106_0059255 Ga0496106_0059255_1171_1800 175
377 3300048909 Ga0496106_0607019 Ga0496106_0607019_55_651 175
378 3300048913 Ga0496110_0247840 Ga0496110_0247840_223_819 175
379 3300048915 Ga0496112_0063564 Ga0496112_0063564_1764_2360 175
380 3300048921 Ga0496118_0094094 Ga0496118_0094094_665_1318 175
381 3300048929 Ga0496126_0013584 Ga0496126_0013584_4037_4648 175
382 3300050492 nmdc:mga0yw44_97098_c1 nmdc:mga0yw44_97098_c1_913_1542 175
383 3300050494 nmdc:mga06z11_19223_c1 nmdc:mga06z11_19223_c1_891_1520 175
384 3300050495 nmdc:mga04h51_127207_c1 nmdc:mga04h51_127207_c1_300_929 175
385 3300050496 nmdc:mga07m45_3481_c1 nmdc:mga07m45_3481_c1_6236_6865 175
386 3300050516 nmdc:mga0sz30_223154_c1 nmdc:mga0sz30_223154_c1_106_735 175
387 iso_pu_bacteria 2524023210 2524466971 175
388 iso_pu_bacteria 2728368998 2728755111 175
389 iso_pu_bacteria 2791355199 2793080827 175
390 iso_pu_bacteria 2857524615 2857527720 175
391 iso_pu_bacteria 2874604998 2874607966 175
392 iso_pu_bacteria 2919073203 2919073581 175
393 3300005327 Ga0070658_10177258 Ga0070658_101772581 176
394 3300005336 Ga0070680_100047058 Ga0070680_1000470581 176
395 3300005339 Ga0070660_100004126 Ga0070660_1000041269 176
396 3300005458 Ga0070681_10276400 Ga0070681_102764002 176
397 3300005530 Ga0070679_100011919 Ga0070679_1000119195 176
398 3300005530 Ga0070679_100736119 Ga0070679_1007361191 176
399 3300005535 Ga0070684_100010508 Ga0070684_1000105083 176
400 3300005539 Ga0068853_100001665 Ga0068853_1000016652 176
401 3300005539 Ga0068853_100669388 Ga0068853_1006693882 176
402 3300005563 Ga0068855_100077134 Ga0068855_1000771343 176
403 3300005563 Ga0068855_100495226 Ga0068855_1004952262 176
404 3300005614 Ga0068856_100344821 Ga0068856_1003448212 176
405 3300005616 Ga0068852_100611579 Ga0068852_1006115791 176
406 3300005841 Ga0068863_100210004 Ga0068863_1002100042 176
407 3300005844 Ga0068862_100607833 Ga0068862_1006078331 176
408 3300005937 Ga0081455_10016975 Ga0081455_100169756 176
409 3300005983 Ga0081540_1037369 Ga0081540_10373693 176
410 3300005983 Ga0081540_1041905 Ga0081540_10419052 176
411 3300006038 Ga0075365_10054575 Ga0075365_100545753 176
412 3300006186 Ga0075369_10031630 Ga0075369_100316302 176
413 3300006195 Ga0075366_10047218 Ga0075366_100472182 176
414 3300006237 Ga0097621_100144016 Ga0097621_1001440162 176
415 3300006844 Ga0075428_100326409 Ga0075428_1003264092 176
416 3300009098 Ga0105245_10448366 Ga0105245_104483662 176
417 3300009553 Ga0105249_10679457 Ga0105249_106794572 176
418 3300010375 Ga0105239_10403051 Ga0105239_104030511 176
419 3300010375 Ga0105239_10644279 Ga0105239_106442792 176
420 3300013105 Ga0157369_10424549 Ga0157369_104245492 176
421 3300013296 Ga0157374_10208313 Ga0157374_102083132 176
422 3300013297 Ga0157378_10083215 Ga0157378_100832152 176
423 3300013307 Ga0157372_10335300 Ga0157372_103353002 176
424 3300025912 Ga0207707_10000990 Ga0207707_1000099018 176
425 3300025912 Ga0207707_10112081 Ga0207707_101120812 176
426 3300025917 Ga0207660_10007283 Ga0207660_100072835 176
427 3300025921 Ga0207652_10003759 Ga0207652_100037598 176
428 3300025924 Ga0207694_10020073 Ga0207694_100200733 176
429 3300025924 Ga0207694_10277251 Ga0207694_102772512 176
430 3300025949 Ga0207667_10011487 Ga0207667_100114875 176
431 3300026041 Ga0207639_10003274 Ga0207639_100032743 176
432 3300026078 Ga0207702_10748509 Ga0207702_107485092 176
433 3300026088 Ga0207641_10256679 Ga0207641_102566792 176
434 3300026118 Ga0207675_100025514 Ga0207675_1000255145 176
435 3300028379 Ga0268266_10003674 Ga0268266_1000367412 176
436 3300035113 Ga0373936_0036855 Ga0373936_0036855_651_1298 176
437 3300035113 Ga0373936_0133424 Ga0373936_0133424_176_817 176
438 3300035725 Ga0373947_0318240 Ga0373947_0318240_367_996 176
439 3300039450 Ga0436363_1457096 Ga0436363_1457096_150_764 176
440 3300042142 Ga0450905_035059 Ga0450905_035059_22_675 176
441 3300045976 Ga0466967_0060474 Ga0466967_0060474_1736_2350 176
442 3300046471 Ga0495650_0138376 Ga0495650_0138376_148_786 176
443 3300046474 Ga0495605_0068744 Ga0495605_0068744_997_1647 176
444 3300046557 Ga0495622_0157255 Ga0495622_0157255_29_658 176
445 3300046558 Ga0495633_0168142 Ga0495633_0168142_288_938 176
446 3300046684 Ga0495669_0337178 Ga0495669_0337178_56_697 176
447 3300047447 Ga0495685_114342 Ga0495685_114342_217_867 176
448 3300048911 Ga0496108_0240436 Ga0496108_0240436_845_1489 176
449 3300048916 Ga0496113_0506112 Ga0496113_0506112_21_665 176
450 3300048917 Ga0496114_0130553 Ga0496114_0130553_449_1099 176
451 3300048924 Ga0496121_0023544 Ga0496121_0023544_1171_1803 176
452 3300049568 Ga0501031_0000248 Ga0501031_0000248_21926_22525 176
453 3300049569 Ga0501032_0000387 Ga0501032_0000387_4488_5087 176
454 3300049570 Ga0501033_0000110 Ga0501033_0000110_63362_63961 176
455 3300049571 Ga0501034_0000198 Ga0501034_0000198_57767_58366 176
456 3300049572 Ga0501036_0000047 Ga0501036_0000047_4695_5294 176
457 3300049572 Ga0501036_0237956 Ga0501036_0237956_645_1298 176
458 3300049573 Ga0501037_0000050 Ga0501037_0000050_59284_59883 176
459 3300049574 Ga0501038_0000463 Ga0501038_0000463_13633_14232 176
460 3300049575 Ga0501039_0000260 Ga0501039_0000260_30253_30852 176
461 3300049577 Ga0501041_0183242 Ga0501041_0183242_564_1217 176
462 3300049578 Ga0501042_0021886 Ga0501042_0021886_1391_1990 176
463 3300049579 Ga0501043_0000153 Ga0501043_0000153_47847_48446 176
464 3300049580 Ga0501046_0000678 Ga0501046_0000678_2973_3572 176
465 3300049581 Ga0501047_0003334 Ga0501047_0003334_7450_8049 176
466 3300049582 Ga0501048_0000323 Ga0501048_0000323_18486_19085 176
467 3300049583 Ga0501067_0000101 Ga0501067_0000101_38397_38996 176
468 3300049584 Ga0501068_0001632 Ga0501068_0001632_1629_2228 176
469 3300049586 Ga0501070_0008034 Ga0501070_0008034_7153_7752 176
470 3300049587 Ga0501071_0070981 Ga0501071_0070981_905_1504 176
471 3300049588 Ga0501072_0000168 Ga0501072_0000168_3404_4003 176
472 3300049590 Ga0501074_0010655 Ga0501074_0010655_2309_2908 176
473 3300049591 Ga0501075_0204613 Ga0501075_0204613_320_973 176
474 3300049592 Ga0501076_0521497 Ga0501076_0521497_74_673 176
475 3300049741 Ga0501079_0000308 Ga0501079_0000308_17200_17799 176
476 3300049742 Ga0501080_0000093 Ga0501080_0000093_35235_35834 176
477 3300049742 Ga0501080_0420392 Ga0501080_0420392_369_1022 176
478 3300049744 Ga0501083_0001922 Ga0501083_0001922_10586_11185 176
479 3300049822 Ga0501035_0005530 Ga0501035_0005530_8641_9240 176
480 3300049823 Ga0501044_0000100 Ga0501044_0000100_25841_26440 176
481 3300049824 Ga0501045_0032228 Ga0501045_0032228_1043_1642 176
482 3300050492 nmdc:mga0yw44_29389_c1 nmdc:mga0yw44_29389_c1_1200_1853 176
483 3300050511 nmdc:mga08y16_469826_c1 nmdc:mga08y16_469826_c1_119_769 176
484 3300054114 Ga0501084_0018047 Ga0501084_0018047_1914_2513 176
485 3300054114 Ga0501084_0347375 Ga0501084_0347375_439_1092 176
486 3300060353 Ga0501082_0011433 Ga0501082_0011433_4673_5272 176
487 3300003322 rootL2_10098350 rootL2_100983502 177
488 3300005337 Ga0070682_100376895 Ga0070682_1003768951 177
489 3300005434 Ga0070709_10021213 Ga0070709_100212133 177
490 3300005435 Ga0070714_100112792 Ga0070714_1001127921 177
491 3300005439 Ga0070711_100001085 Ga0070711_10000108514 177
492 3300005440 Ga0070705_100437775 Ga0070705_1004377751 177
493 3300005455 Ga0070663_100015823 Ga0070663_1000158233 177
494 3300005539 Ga0068853_100097223 Ga0068853_1000972232 177
495 3300005539 Ga0068853_100854860 Ga0068853_1008548602 177
496 3300005616 Ga0068852_100134708 Ga0068852_1001347082 177
497 3300005616 Ga0068852_100180915 Ga0068852_1001809152 177
498 3300005937 Ga0081455_10051561 Ga0081455_100515612 177
499 3300006038 Ga0075365_10002290 Ga0075365_100022903 177
500 3300006042 Ga0075368_10021336 Ga0075368_100213363 177
501 3300006048 Ga0075363_100072702 Ga0075363_1000727022 177
502 3300006051 Ga0075364_10053334 Ga0075364_100533342 177
503 3300006178 Ga0075367_10145921 Ga0075367_101459211 177
504 3300006353 Ga0075370_10006907 Ga0075370_100069074 177
505 3300009093 Ga0105240_10153098 Ga0105240_101530982 177
506 3300009093 Ga0105240_10199947 Ga0105240_101999473 177
507 3300009176 Ga0105242_10162896 Ga0105242_101628962 177
508 3300009545 Ga0105237_10295718 Ga0105237_102957182 177
509 3300010375 Ga0105239_10924799 Ga0105239_109247991 177
510 3300013104 Ga0157370_10281542 Ga0157370_102815422 177
511 3300013105 Ga0157369_10036939 Ga0157369_100369392 177
512 3300013307 Ga0157372_10464990 Ga0157372_104649902 177
513 3300013307 Ga0157372_10629768 Ga0157372_106297682 177
514 3300014745 Ga0157377_10201737 Ga0157377_102017372 177
515 3300025904 Ga0207647_10207626 Ga0207647_102076261 177
516 3300025912 Ga0207707_10000445 Ga0207707_100004459 177
517 3300025913 Ga0207695_10174609 Ga0207695_101746092 177
518 3300025928 Ga0207700_10011006 Ga0207700_100110062 177
519 3300025939 Ga0207665_10051404 Ga0207665_100514043 177
520 3300025945 Ga0207679_10104904 Ga0207679_101049041 177
521 3300026067 Ga0207678_10011118 Ga0207678_100111184 177
522 3300026142 Ga0207698_10197105 Ga0207698_101971052 177
523 3300028379 Ga0268266_10004060 Ga0268266_1000406012 177
524 3300028379 Ga0268266_10300988 Ga0268266_103009882 177
525 3300031548 Ga0307408_100107661 Ga0307408_1001076612 177
526 3300031616 Ga0307508_10036258 Ga0307508_100362583 177
527 3300031711 Ga0265314_10106031 Ga0265314_101060312 177
528 3300037068 Ga0373925_0142028 Ga0373925_0142028_16_654 177
529 3300037418 Ga0395900_0006715 Ga0395900_0006715_8358_8975 177
530 3300037466 Ga0395898_0023802 Ga0395898_0023802_2658_3275 177
531 3300037471 Ga0395905_1092588 Ga0395905_1092588_42_668 177
532 3300044694 Ga0466963_0005447 Ga0466963_0005447_5373_6017 177
533 3300045976 Ga0466967_0013380 Ga0466967_0013380_1366_2010 177
534 3300045976 Ga0466967_0162440 Ga0466967_0162440_1128_1751 177
535 3300046452 Ga0495617_030574 Ga0495617_030574_1115_1771 177
536 3300046459 Ga0495629_0437676 Ga0495629_0437676_201_845 177
537 3300046616 Ga0495668_0133751 Ga0495668_0133751_667_1287 177
538 3300047472 Ga0495686_0267660 Ga0495686_0267660_11_652 177
539 3300048915 Ga0496112_0000035 Ga0496112_0000035_15117_15743 177
540 3300048922 Ga0496119_0110145 Ga0496119_0110145_521_1180 177
541 3300048924 Ga0496121_0117259 Ga0496121_0117259_238_897 177
542 3300049569 Ga0501032_0356671 Ga0501032_0356671_154_726 177
543 3300049571 Ga0501034_0791798 Ga0501034_0791798_284_829 177
544 3300049572 Ga0501036_0193246 Ga0501036_0193246_1100_1645 177
545 3300049574 Ga0501038_0485578 Ga0501038_0485578_311_856 177
546 3300049578 Ga0501042_0673143 Ga0501042_0673143_105_650 177
547 3300049579 Ga0501043_0069478 Ga0501043_0069478_350_895 177
548 3300049579 Ga0501043_0709070 Ga0501043_0709070_96_671 177
549 3300049581 Ga0501047_0399387 Ga0501047_0399387_472_1017 177
550 3300049583 Ga0501067_0335551 Ga0501067_0335551_97_720 177
551 3300049823 Ga0501044_0084898 Ga0501044_0084898_1871_2416 177
552 3300049823 Ga0501044_0166646 Ga0501044_0166646_1066_1641 177
553 3300053085 Ga0495619_0494250 Ga0495619_0494250_123_761 177
554 3300053090 Ga0500646_0027972 Ga0500646_0027972_558_1214 177
555 3300053092 Ga0500583_0061412 Ga0500583_0061412_211_867 177
556 3300053130 Ga0500642_0305205 Ga0500642_0305205_15_671 177
557 3300053136 Ga0500559_0133287 Ga0500559_0133287_227_862 177
558 3300053161 Ga0500634_0099595 Ga0500634_0099595_79_735 177
559 3300053727 Ga0500611_065472 Ga0500611_065472_82_738 177
560 3300053730 Ga0500645_015436 Ga0500645_015436_1498_2142 177
561 3300061719 Ga0466962_0036868 Ga0466962_0036868_1556_2200 177
562 3300003203 JGI25406J46586_10000084 JGI25406J46586_1000008437 178
563 3300005338 Ga0068868_100143537 Ga0068868_1001435372 178
564 3300005344 Ga0070661_100080664 Ga0070661_1000806642 178
565 3300005345 Ga0070692_10430735 Ga0070692_104307351 178
566 3300005354 Ga0070675_100614301 Ga0070675_1006143011 178
567 3300005364 Ga0070673_100404974 Ga0070673_1004049742 178
568 3300005434 Ga0070709_10469679 Ga0070709_104696791 178
569 3300005441 Ga0070700_100158256 Ga0070700_1001582561 178
570 3300005455 Ga0070663_100045325 Ga0070663_1000453253 178
571 3300005455 Ga0070663_100166764 Ga0070663_1001667641 178
572 3300005457 Ga0070662_100033660 Ga0070662_1000336601 178
573 3300005530 Ga0070679_100867617 Ga0070679_1008676171 178
574 3300005539 Ga0068853_100197591 Ga0068853_1001975912 178
575 3300005543 Ga0070672_100542954 Ga0070672_1005429542 178
576 3300005563 Ga0068855_100018783 Ga0068855_1000187838 178
577 3300005578 Ga0068854_100189213 Ga0068854_1001892132 178
578 3300005614 Ga0068856_100102708 Ga0068856_1001027082 178
579 3300005615 Ga0070702_100096312 Ga0070702_1000963122 178
580 3300005616 Ga0068852_100709052 Ga0068852_1007090521 178
581 3300005718 Ga0068866_10413109 Ga0068866_104131091 178
582 3300005719 Ga0068861_100085730 Ga0068861_1000857303 178
583 3300005841 Ga0068863_100411663 Ga0068863_1004116631 178
584 3300005843 Ga0068860_100221470 Ga0068860_1002214702 178
585 3300005843 Ga0068860_100222819 Ga0068860_1002228192 178
586 3300005985 Ga0081539_10000265 Ga0081539_1000026541 178
587 3300006358 Ga0068871_100868655 Ga0068871_1008686551 178
588 3300009093 Ga0105240_10004498 Ga0105240_1000449814 178
589 3300009177 Ga0105248_10760976 Ga0105248_107609761 178
590 3300009551 Ga0105238_10007795 Ga0105238_100077956 178
591 3300010375 Ga0105239_10020968 Ga0105239_100209682 178
592 3300013102 Ga0157371_10029771 Ga0157371_100297712 178
593 3300013104 Ga0157370_10175523 Ga0157370_101755232 178
594 3300013105 Ga0157369_10357788 Ga0157369_103577882 178
595 3300025904 Ga0207647_10002312 Ga0207647_100023129 178
596 3300025907 Ga0207645_10134097 Ga0207645_101340972 178
597 3300025909 Ga0207705_10053520 Ga0207705_100535202 178
598 3300025913 Ga0207695_10021945 Ga0207695_100219455 178
599 3300025920 Ga0207649_10686403 Ga0207649_106864031 178
600 3300025924 Ga0207694_10011956 Ga0207694_100119563 178
601 3300025926 Ga0207659_10195990 Ga0207659_101959902 178
602 3300025928 Ga0207700_10487564 Ga0207700_104875642 178
603 3300025935 Ga0207709_10029659 Ga0207709_100296593 178
604 3300025944 Ga0207661_10790502 Ga0207661_107905021 178
605 3300025949 Ga0207667_10124632 Ga0207667_101246322 178
606 3300025961 Ga0207712_10034760 Ga0207712_100347602 178
607 3300025972 Ga0207668_10023936 Ga0207668_100239362 178
608 3300026041 Ga0207639_10382364 Ga0207639_103823641 178
609 3300026067 Ga0207678_10043469 Ga0207678_100434692 178
610 3300026067 Ga0207678_10903668 Ga0207678_109036681 178
611 3300026067 Ga0207678_11029127 Ga0207678_110291271 178
612 3300026089 Ga0207648_10983761 Ga0207648_109837611 178
613 3300026116 Ga0207674_10005387 Ga0207674_1000538714 178
614 3300026142 Ga0207698_10499776 Ga0207698_104997762 178
615 3300028379 Ga0268266_10839131 Ga0268266_108391311 178
616 3300031238 Ga0265332_10106507 Ga0265332_101065072 178
617 3300031249 Ga0265339_10017310 Ga0265339_100173103 178
618 3300031711 Ga0265314_10030517 Ga0265314_100305172 178
619 3300031712 Ga0265342_10005300 Ga0265342_100053003 178
620 3300041456 Ga0451795_0972193 Ga0451795_0972193_60_722 178
621 3300041462 Ga0451806_270177 Ga0451806_270177_24_686 178
622 3300045976 Ga0466967_0508706 Ga0466967_0508706_406_1011 178
623 3300046507 Ga0495606_0003660 Ga0495606_0003660_1722_2345 178
624 3300046524 Ga0495648_0001251 Ga0495648_0001251_21660_22280 178
625 3300049571 Ga0501034_0404884 Ga0501034_0404884_337_933 178
626 3300049579 Ga0501043_0437613 Ga0501043_0437613_39_662 178
627 3300049823 Ga0501044_0176093 Ga0501044_0176093_698_1294 178
628 3300053085 Ga0495619_0617963 Ga0495619_0617963_62_670 178
629 3300005338 Ga0068868_100080304 Ga0068868_1000803043 179
630 3300005434 Ga0070709_10001493 Ga0070709_1000149310 179
631 3300005435 Ga0070714_100016089 Ga0070714_1000160894 179
632 3300005436 Ga0070713_100018419 Ga0070713_1000184195 179
633 3300005437 Ga0070710_10213368 Ga0070710_102133681 179
634 3300005455 Ga0070663_100097054 Ga0070663_1000970542 179
635 3300005458 Ga0070681_10001992 Ga0070681_100019928 179
636 3300005548 Ga0070665_100041983 Ga0070665_1000419834 179
637 3300005563 Ga0068855_100236381 Ga0068855_1002363812 179
638 3300005719 Ga0068861_100146106 Ga0068861_1001461062 179
639 3300005983 Ga0081540_1018565 Ga0081540_10185652 179
640 3300006163 Ga0070715_10001806 Ga0070715_100018067 179
641 3300006173 Ga0070716_100014088 Ga0070716_1000140883 179
642 3300006173 Ga0070716_100054078 Ga0070716_1000540782 179
643 3300006175 Ga0070712_100035671 Ga0070712_1000356712 179
644 3300006175 Ga0070712_100869998 Ga0070712_1008699981 179
645 3300006195 Ga0075366_10583674 Ga0075366_105836741 179
646 3300006237 Ga0097621_100092247 Ga0097621_1000922473 179
647 3300006871 Ga0075434_100675566 Ga0075434_1006755661 179
648 3300007788 Ga0099795_10121495 Ga0099795_101214951 179
649 3300017792 Ga0163161_10021791 Ga0163161_100217914 179
650 3300025898 Ga0207692_10006026 Ga0207692_100060261 179
651 3300025901 Ga0207688_10486389 Ga0207688_104863891 179
652 3300025904 Ga0207647_10078653 Ga0207647_100786532 179
653 3300025905 Ga0207685_10014596 Ga0207685_100145962 179
654 3300025915 Ga0207693_10001330 Ga0207693_100013307 179
655 3300025916 Ga0207663_10001827 Ga0207663_100018276 179
656 3300025916 Ga0207663_10026590 Ga0207663_100265903 179
657 3300025917 Ga0207660_10246492 Ga0207660_102464922 179
658 3300025921 Ga0207652_10011887 Ga0207652_100118876 179
659 3300025927 Ga0207687_10173374 Ga0207687_101733742 179
660 3300025929 Ga0207664_10002909 Ga0207664_100029093 179
661 3300025929 Ga0207664_10245040 Ga0207664_102450401 179
662 3300025938 Ga0207704_10181384 Ga0207704_101813841 179
663 3300025939 Ga0207665_10000843 Ga0207665_100008437 179
664 3300025940 Ga0207691_10038499 Ga0207691_100384994 179
665 3300025942 Ga0207689_10352424 Ga0207689_103524242 179
666 3300025949 Ga0207667_10336237 Ga0207667_103362371 179
667 3300025972 Ga0207668_10549444 Ga0207668_105494441 179
668 3300026023 Ga0207677_10310024 Ga0207677_103100242 179
669 3300026035 Ga0207703_10185692 Ga0207703_101856922 179
670 3300026067 Ga0207678_10277926 Ga0207678_102779262 179
671 3300026116 Ga0207674_10002936 Ga0207674_1000293616 179
672 3300026121 Ga0207683_10377637 Ga0207683_103776372 179
673 3300028379 Ga0268266_10040844 Ga0268266_100408442 179
674 3300031238 Ga0265332_10073435 Ga0265332_100734352 179
675 3300031238 Ga0265332_10114411 Ga0265332_101144112 179
676 3300031730 Ga0307516_10013268 Ga0307516_100132684 179
677 3300031911 Ga0307412_10866129 Ga0307412_108661291 179
678 3300032002 Ga0307416_100298320 Ga0307416_1002983201 179
679 3300032005 Ga0307411_11209872 Ga0307411_112098721 179
680 3300035117 Ga0373953_0003561 Ga0373953_0003561_684_1280 179
681 3300035118 Ga0373954_0005495 Ga0373954_0005495_4032_4628 179
682 3300035119 Ga0373956_0012061 Ga0373956_0012061_1880_2476 179
683 3300035120 Ga0373957_0006428 Ga0373957_0006428_1215_1811 179
684 3300035172 Ga0373955_0006993 Ga0373955_0006993_1059_1655 179
685 3300035410 Ga0373924_0008980 Ga0373924_0008980_1345_1941 179
686 3300036401 Ga0373937_0122269 Ga0373937_0122269_549_1145 179
687 3300037418 Ga0395900_0260653 Ga0395900_0260653_814_1422 179
688 3300037466 Ga0395898_0017586 Ga0395898_0017586_4816_5424 179
689 3300037466 Ga0395898_0172868 Ga0395898_0172868_711_1367 179
690 3300037471 Ga0395905_0031610 Ga0395905_0031610_2315_2971 179
691 3300038443 Ga0395901_0258187 Ga0395901_0258187_516_1172 179
692 3300041509 Ga0451843_1570788 Ga0451843_1570788_79_696 179
693 3300046454 Ga0495592_0008934 Ga0495592_0008934_4125_4721 179
694 3300046462 Ga0495651_0014811 Ga0495651_0014811_3477_4073 179
695 3300046463 Ga0495653_0051592 Ga0495653_0051592_1395_1991 179
696 3300046476 Ga0495662_0125383 Ga0495662_0125383_306_902 179
697 3300046477 Ga0495664_0012483 Ga0495664_0012483_308_904 179
698 3300046499 Ga0495594_0101589 Ga0495594_0101589_396_1004 179
699 3300046516 Ga0495628_0019320 Ga0495628_0019320_4115_4711 179
700 3300046529 Ga0495652_0074294 Ga0495652_0074294_901_1497 179
701 3300046533 Ga0495640_0008655 Ga0495640_0008655_6180_6776 179
702 3300046536 Ga0495587_0011369 Ga0495587_0011369_3195_3791 179
703 3300046538 Ga0495609_0161912 Ga0495609_0161912_14_673 179
704 3300046543 Ga0495645_0003153 Ga0495645_0003153_6526_7122 179
705 3300046558 Ga0495633_0127781 Ga0495633_0127781_19_669 179
706 3300046559 Ga0495667_0036954 Ga0495667_0036954_839_1435 179
707 3300046642 Ga0495634_0103387 Ga0495634_0103387_970_1566 179
708 3300046675 Ga0495657_0015384 Ga0495657_0015384_1884_2480 179
709 3300046678 Ga0495599_0004679 Ga0495599_0004679_2006_2602 179
710 3300046679 Ga0495623_0011461 Ga0495623_0011461_4256_4852 179
711 3300046683 Ga0495658_0273016 Ga0495658_0273016_387_983 179
712 3300046684 Ga0495669_0036562 Ga0495669_0036562_230_892 179
713 3300046689 Ga0495613_0272797 Ga0495613_0272797_203_799 179
714 3300046794 Ga0495589_0084979 Ga0495589_0084979_756_1415 179
715 3300046809 Ga0495600_0010405 Ga0495600_0010405_1594_2190 179
716 3300047315 Ga0495581_0048593 Ga0495581_0048593_1302_1910 179
717 3300047317 Ga0495604_0057212 Ga0495604_0057212_271_867 179
718 3300047319 Ga0495674_0036515 Ga0495674_0036515_441_1037 179
719 3300047322 Ga0495680_0018556 Ga0495680_0018556_2336_2932 179
720 3300047471 Ga0495684_0019406 Ga0495684_0019406_2010_2606 179
721 3300048088 Ga0495602_0044685 Ga0495602_0044685_2966_3562 179
722 3300048918 Ga0496115_0052603 Ga0496115_0052603_1212_1805 179
723 3300053077 Ga0495601_0052014 Ga0495601_0052014_1409_2005 179
724 3300053078 Ga0495612_0017966 Ga0495612_0017966_1271_1867 179
725 3300053085 Ga0495619_0225404 Ga0495619_0225404_262_858 179
726 3300053094 Ga0500566_0001201 Ga0500566_0001201_9393_9995 179
727 3300053111 Ga0500572_004757 Ga0500572_004757_1667_2269 179
728 3300053115 Ga0500591_042842 Ga0500591_042842_1085_1687 179
729 3300053136 Ga0500559_0042679 Ga0500559_0042679_948_1550 179
730 3300053150 Ga0500603_003328 Ga0500603_003328_2089_2691 179
731 3300053159 Ga0500630_047435 Ga0500630_047435_534_1136 179
732 3300053162 Ga0500638_056238 Ga0500638_056238_564_1166 179
733 3300053163 Ga0500639_002913 Ga0500639_002913_2887_3489 179
734 3300053735 Ga0500596_003108 Ga0500596_003108_2028_2630 179
735 3300053737 Ga0500601_001657 Ga0500601_001657_763_1365 179
736 3300009098 Ga0105245_10169785 Ga0105245_101697852 180
737 3300000549 LJQas_1004407 LJQas_10044072 181
738 3300005981 Ga0081538_10052170 Ga0081538_100521702 181
739 3300005983 Ga0081540_1006582 Ga0081540_10065826 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06776

IalB

Invasion associated locus B (IalB) protein

73

205

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e0w-assembly1.cif.gz_A t391a precursor mutant protein of gamma-glutamyltranspeptidase from escherichia coli 0.69 146 167
3dtd-assembly1.cif.gz_C-2 crystal structure of invasion associated protein b from bartonella henselae 0.6858 39 180
3dtd-assembly1.cif.gz_C-2 crystal structure of invasion associated protein b from bartonella henselae 0.6577 39 180
7jqz-assembly1.cif.gz_I crystal structure of cfl2 wild-type from burkholderia cenocepacia 0.6236 35 67
5cen-assembly1.cif.gz_A crystal structure of dlk (kinase domain) 0.6155 34 63
ID Description Score Start End Superfamily
af_Q18976_2_330_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8056 36 62 1.10.510.10
af_Q54TA1_482_569_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7872 36 65 3.30.200.20
af_Q4D3P7_9_124_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7728 37 65 3.30.200.20
af_Q5AP97_783_1043_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.7655 35 62 1.10.510.10
af_I1LRP0_2_307_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.76 37 62 1.10.510.10
ID Description Score Start End GO Terms
AF-A0A327JMX6-F1-model_v4 deleted 0.9551 35 179
AF-A0A4P5T7K9-F1-model_v4 Uncharacterized protein 0.9322 35 179 GO:0016020
AF-A0A2E2CY58-F1-model_v4 Uncharacterized protein 0.9282 38 180
AF-A0A327JMX6-F1-model_v4 deleted 0.9243 35 179
AF-A0A2E6W1X7-F1-model_v4 Uncharacterized protein 0.9211 57 180

Feature Viewer

pLDDT pTM Quality
77.62 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map