F478495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 403 | 727 | 180 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2791355199|2793080827 |
| Length | 210 |
| Sequence | RILTFLVAIAALCGATSLAQAQGTASKGAKENAKDAAKSAPAPAAKQPAKPESAAAAAAGGAEPTLIGQYGTWGAYTATPNGRKVCFALAKPSSSKTNPPNRPRDPAYAFVSTRPAERVVNEVSIMMGYALKPGSESSLEVGGAAYAMYTQGDGLWIKNAAEEEQMVSAMRKSAEVTVKGISAKGTETTDIFSLKGLSQALDRLAQDCKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 3 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 4 | 2791355199 | |||
| 5 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 6 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 7 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 8 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 9 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 10 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 11 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 12 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 120 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 121 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 122 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 219 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 221 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 317 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 318 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 319 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 320 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 321 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 322 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 323 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 324 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 358 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 362 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 373 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 376 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 379 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 380 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 381 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 382 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 383 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 384 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 385 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 387 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 392 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 394 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 395 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 396 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.07 |
| Nodule | 1.49 |
| Rhizoplane | 6.22 |
| Rhizosphere | 79.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004407 | 3300000549 | Bacteria | 1836 |
| 2 | JGI24739J22299_10003081 | 3300001989 | Bacteria | 6366 |
| 3 | JGI24737J22298_10001562 | 3300001990 | Bacteria | 8149 |
| 4 | JGI25406J46586_10000084 | 3300003203 | Bacteria | 42873 |
| 5 | JGI25153J46596_10004214 | 3300003215 | Bacteria | 7794 |
| 6 | rootL2_10098350 | 3300003322 | Bacteria | 1156 |
| 7 | JGI25404J52841_10006328 | 3300003659 | Bacteria | 2474 |
| 8 | JGI25404J52841_10017978 | 3300003659 | Bacteria | 1532 |
| 9 | Ga0070658_10177258 | 3300005327 | Bacteria | 1793 |
| 10 | Ga0070683_100016037 | 3300005329 | Bacteria | 6594 |
| 11 | Ga0068869_100140325 | 3300005334 | Bacteria | 1865 |
| 12 | Ga0070680_100017817 | 3300005336 | Bacteria | 5603 |
| 13 | Ga0070680_100047058 | 3300005336 | Bacteria | 3511 |
| 14 | Ga0070680_100188278 | 3300005336 | Bacteria | 1739 |
| 15 | Ga0070682_100376895 | 3300005337 | Bacteria | 1066 |
| 16 | Ga0068868_100022449 | 3300005338 | Bacteria | 4762 |
| 17 | Ga0068868_100080304 | 3300005338 | Bacteria | 2614 |
| 18 | Ga0068868_100143537 | 3300005338 | Bacteria | 1962 |
| 19 | Ga0070660_100004126 | 3300005339 | Bacteria | 10025 |
| 20 | Ga0070660_100205647 | 3300005339 | Bacteria | 1597 |
| 21 | Ga0070689_100174326 | 3300005340 | Bacteria | 1744 |
| 22 | Ga0070661_100080664 | 3300005344 | Bacteria | 2401 |
| 23 | Ga0070661_100130039 | 3300005344 | Bacteria | 1890 |
| 24 | Ga0070661_100206410 | 3300005344 | Bacteria | 1503 |
| 25 | Ga0070692_10430735 | 3300005345 | Bacteria | 840 |
| 26 | Ga0070668_100024015 | 3300005347 | Bacteria | 4616 |
| 27 | Ga0070668_101030544 | 3300005347 | Bacteria | 740 |
| 28 | Ga0070675_100614301 | 3300005354 | Bacteria | 986 |
| 29 | Ga0070671_100130971 | 3300005355 | Bacteria | 2113 |
| 30 | Ga0070673_100109913 | 3300005364 | Bacteria | 2285 |
| 31 | Ga0070673_100404974 | 3300005364 | Bacteria | 1220 |
| 32 | Ga0070659_100223559 | 3300005366 | Bacteria | 1555 |
| 33 | Ga0070709_10001493 | 3300005434 | Bacteria | 12637 |
| 34 | Ga0070709_10021213 | 3300005434 | Bacteria | 3781 |
| 35 | Ga0070709_10469679 | 3300005434 | Bacteria | 951 |
| 36 | Ga0070714_100016089 | 3300005435 | Bacteria | 6030 |
| 37 | Ga0070714_100112792 | 3300005435 | Bacteria | 2410 |
| 38 | Ga0070713_100018419 | 3300005436 | Bacteria | 5306 |
| 39 | Ga0070713_100499101 | 3300005436 | Bacteria | 1148 |
| 40 | Ga0070710_10213368 | 3300005437 | Bacteria | 1224 |
| 41 | Ga0070711_100001085 | 3300005439 | Bacteria | 14533 |
| 42 | Ga0070711_100008899 | 3300005439 | Bacteria | 6161 |
| 43 | Ga0070705_100437775 | 3300005440 | Bacteria | 977 |
| 44 | Ga0070700_100158256 | 3300005441 | Bacteria | 1556 |
| 45 | Ga0070700_100307384 | 3300005441 | Bacteria | 1160 |
| 46 | Ga0070700_100445948 | 3300005441 | Bacteria | 984 |
| 47 | Ga0070700_100457295 | 3300005441 | Bacteria | 973 |
| 48 | Ga0070663_100015823 | 3300005455 | Bacteria | 4880 |
| 49 | Ga0070663_100045325 | 3300005455 | Bacteria | 3106 |
| 50 | Ga0070663_100097054 | 3300005455 | Bacteria | 2193 |
| 51 | Ga0070663_100129104 | 3300005455 | Bacteria | 1917 |
| 52 | Ga0070663_100166764 | 3300005455 | Bacteria | 1699 |
| 53 | Ga0070678_100482853 | 3300005456 | Bacteria | 1091 |
| 54 | Ga0070662_100033660 | 3300005457 | Bacteria | 3610 |
| 55 | Ga0070681_10001992 | 3300005458 | Bacteria | 18473 |
| 56 | Ga0070681_10074024 | 3300005458 | Bacteria | 3367 |
| 57 | Ga0070681_10276400 | 3300005458 | Bacteria | 1591 |
| 58 | Ga0070707_100567640 | 3300005468 | Bacteria | 1097 |
| 59 | Ga0070698_100204644 | 3300005471 | Bacteria | 1909 |
| 60 | Ga0070698_100330834 | 3300005471 | Bacteria | 1455 |
| 61 | Ga0070679_100011919 | 3300005530 | Bacteria | 8298 |
| 62 | Ga0070679_100736119 | 3300005530 | Bacteria | 929 |
| 63 | Ga0070679_100867617 | 3300005530 | Bacteria | 846 |
| 64 | Ga0070684_100010508 | 3300005535 | Bacteria | 7337 |
| 65 | Ga0070684_100011123 | 3300005535 | Bacteria | 7162 |
| 66 | Ga0070697_100199038 | 3300005536 | Bacteria | 1703 |
| 67 | Ga0068853_100001665 | 3300005539 | Bacteria | 16258 |
| 68 | Ga0068853_100097223 | 3300005539 | Bacteria | 2599 |
| 69 | Ga0068853_100197591 | 3300005539 | Bacteria | 1829 |
| 70 | Ga0068853_100669388 | 3300005539 | Bacteria | 989 |
| 71 | Ga0068853_100854860 | 3300005539 | Bacteria | 873 |
| 72 | Ga0070672_100066280 | 3300005543 | Bacteria | 2859 |
| 73 | Ga0070672_100542954 | 3300005543 | Bacteria | 1009 |
| 74 | Ga0070686_100575021 | 3300005544 | Bacteria | 884 |
| 75 | Ga0070693_100040877 | 3300005547 | Bacteria | 2606 |
| 76 | Ga0070665_100041983 | 3300005548 | Bacteria | 4598 |
| 77 | Ga0070665_100232811 | 3300005548 | Bacteria | 1842 |
| 78 | Ga0070665_100249049 | 3300005548 | Bacteria | 1777 |
| 79 | Ga0068855_100018783 | 3300005563 | Bacteria | 8311 |
| 80 | Ga0068855_100077134 | 3300005563 | Bacteria | 3866 |
| 81 | Ga0068855_100236381 | 3300005563 | Bacteria | 2043 |
| 82 | Ga0068855_100495226 | 3300005563 | Bacteria | 1329 |
| 83 | Ga0070664_100238571 | 3300005564 | Bacteria | 1631 |
| 84 | Ga0068857_100024046 | 3300005577 | Bacteria | 5363 |
| 85 | Ga0068857_100072529 | 3300005577 | Bacteria | 3068 |
| 86 | Ga0068854_100189213 | 3300005578 | Bacteria | 1612 |
| 87 | Ga0068856_100023911 | 3300005614 | Bacteria | 5942 |
| 88 | Ga0068856_100102708 | 3300005614 | Bacteria | 2852 |
| 89 | Ga0068856_100344821 | 3300005614 | Bacteria | 1508 |
| 90 | Ga0068856_100463424 | 3300005614 | Bacteria | 1288 |
| 91 | Ga0070702_100087640 | 3300005615 | Bacteria | 1880 |
| 92 | Ga0070702_100096312 | 3300005615 | Bacteria | 1806 |
| 93 | Ga0068852_100134708 | 3300005616 | Bacteria | 2280 |
| 94 | Ga0068852_100180915 | 3300005616 | Bacteria | 1982 |
| 95 | Ga0068852_100269226 | 3300005616 | Bacteria | 1639 |
| 96 | Ga0068852_100611579 | 3300005616 | Bacteria | 1095 |
| 97 | Ga0068852_100709052 | 3300005616 | Bacteria | 1017 |
| 98 | Ga0068859_100509805 | 3300005617 | Bacteria | 1298 |
| 99 | Ga0068864_100066634 | 3300005618 | Bacteria | 3125 |
| 100 | Ga0068864_100152522 | 3300005618 | Bacteria | 2094 |
| 101 | Ga0068864_100259304 | 3300005618 | Bacteria | 1616 |
| 102 | Ga0068866_10148146 | 3300005718 | Bacteria | 1356 |
| 103 | Ga0068866_10413109 | 3300005718 | Bacteria | 873 |
| 104 | Ga0068861_100085730 | 3300005719 | Bacteria | 2474 |
| 105 | Ga0068861_100146106 | 3300005719 | Bacteria | 1935 |
| 106 | Ga0068851_10048225 | 3300005834 | Bacteria | 2159 |
| 107 | Ga0068863_100210004 | 3300005841 | Bacteria | 1875 |
| 108 | Ga0068863_100395831 | 3300005841 | Bacteria | 1350 |
| 109 | Ga0068863_100411663 | 3300005841 | Bacteria | 1323 |
| 110 | Ga0068863_100536006 | 3300005841 | Bacteria | 1155 |
| 111 | Ga0068858_100062483 | 3300005842 | Bacteria | 3443 |
| 112 | Ga0068860_100221470 | 3300005843 | Bacteria | 1837 |
| 113 | Ga0068860_100222819 | 3300005843 | Bacteria | 1832 |
| 114 | Ga0068860_100224696 | 3300005843 | Bacteria | 1824 |
| 115 | Ga0068860_100251412 | 3300005843 | Bacteria | 1721 |
| 116 | Ga0068862_100145341 | 3300005844 | Bacteria | 2107 |
| 117 | Ga0068862_100588853 | 3300005844 | Bacteria | 1066 |
| 118 | Ga0068862_100607833 | 3300005844 | Bacteria | 1050 |
| 119 | Ga0081455_10016975 | 3300005937 | Bacteria | 6997 |
| 120 | Ga0081455_10028194 | 3300005937 | Bacteria | 5133 |
| 121 | Ga0081455_10051561 | 3300005937 | Bacteria | 3529 |
| 122 | Ga0081455_10161849 | 3300005937 | Bacteria | 1714 |
| 123 | Ga0081538_10052170 | 3300005981 | Bacteria | 2447 |
| 124 | Ga0081540_1001674 | 3300005983 | Bacteria | 18853 |
| 125 | Ga0081540_1002221 | 3300005983 | Bacteria | 16011 |
| 126 | Ga0081540_1006582 | 3300005983 | Bacteria | 8432 |
| 127 | Ga0081540_1018565 | 3300005983 | Bacteria | 4260 |
| 128 | Ga0081540_1037369 | 3300005983 | Bacteria | 2575 |
| 129 | Ga0081540_1041905 | 3300005983 | Bacteria | 2368 |
| 130 | Ga0081539_10000265 | 3300005985 | Bacteria | 120457 |
| 131 | Ga0070717_10082702 | 3300006028 | Bacteria | 2699 |
| 132 | Ga0075365_10002290 | 3300006038 | Bacteria | 9305 |
| 133 | Ga0075365_10052404 | 3300006038 | Bacteria | 2698 |
| 134 | Ga0075365_10054575 | 3300006038 | Bacteria | 2650 |
| 135 | Ga0075368_10021336 | 3300006042 | Bacteria | 2460 |
| 136 | Ga0075363_100072702 | 3300006048 | Bacteria | 1870 |
| 137 | Ga0075363_100302289 | 3300006048 | Bacteria | 929 |
| 138 | Ga0075364_10053334 | 3300006051 | Bacteria | 2644 |
| 139 | Ga0070715_10001806 | 3300006163 | Bacteria | 6379 |
| 140 | Ga0070716_100014088 | 3300006173 | Bacteria | 4090 |
| 141 | Ga0070716_100054078 | 3300006173 | Bacteria | 2292 |
| 142 | Ga0070716_100426178 | 3300006173 | Bacteria | 961 |
| 143 | Ga0070712_100012707 | 3300006175 | Bacteria | 5359 |
| 144 | Ga0070712_100035671 | 3300006175 | Bacteria | 3377 |
| 145 | Ga0070712_100869998 | 3300006175 | Bacteria | 776 |
| 146 | Ga0075362_10031828 | 3300006177 | Bacteria | 2285 |
| 147 | Ga0075362_10124023 | 3300006177 | Bacteria | 1224 |
| 148 | Ga0075367_10145921 | 3300006178 | Bacteria | 1467 |
| 149 | Ga0075367_10146480 | 3300006178 | Bacteria | 1464 |
| 150 | Ga0075369_10031630 | 3300006186 | Bacteria | 2235 |
| 151 | Ga0075369_10103416 | 3300006186 | Bacteria | 1279 |
| 152 | Ga0075366_10047218 | 3300006195 | Bacteria | 2552 |
| 153 | Ga0075366_10192574 | 3300006195 | Bacteria | 1239 |
| 154 | Ga0075366_10583674 | 3300006195 | Bacteria | 693 |
| 155 | Ga0097621_100092247 | 3300006237 | Bacteria | 2536 |
| 156 | Ga0097621_100144016 | 3300006237 | Bacteria | 2039 |
| 157 | Ga0075370_10006907 | 3300006353 | Bacteria | 5746 |
| 158 | Ga0075370_10131120 | 3300006353 | Bacteria | 1462 |
| 159 | Ga0075370_10158511 | 3300006353 | Bacteria | 1327 |
| 160 | Ga0068871_100868655 | 3300006358 | Bacteria | 835 |
| 161 | Ga0075428_100326409 | 3300006844 | Bacteria | 1649 |
| 162 | Ga0075434_100058879 | 3300006871 | Bacteria | 3818 |
| 163 | Ga0075434_100675566 | 3300006871 | Bacteria | 1051 |
| 164 | Ga0097620_100509836 | 3300006931 | Bacteria | 1298 |
| 165 | Ga0099795_10042024 | 3300007788 | Bacteria | 1630 |
| 166 | Ga0099795_10121495 | 3300007788 | Bacteria | 1045 |
| 167 | Ga0105240_10004498 | 3300009093 | Bacteria | 21190 |
| 168 | Ga0105240_10011557 | 3300009093 | Bacteria | 12285 |
| 169 | Ga0105240_10153098 | 3300009093 | Bacteria | 2745 |
| 170 | Ga0105240_10199947 | 3300009093 | Bacteria | 2343 |
| 171 | Ga0105245_10117167 | 3300009098 | Bacteria | 2484 |
| 172 | Ga0105245_10169785 | 3300009098 | Bacteria | 2076 |
| 173 | Ga0105245_10448366 | 3300009098 | Bacteria | 1298 |
| 174 | Ga0105247_10200160 | 3300009101 | Bacteria | 1342 |
| 175 | Ga0114129_10415165 | 3300009147 | Bacteria | 1771 |
| 176 | Ga0105241_10323502 | 3300009174 | Bacteria | 1331 |
| 177 | Ga0105241_10797878 | 3300009174 | Bacteria | 870 |
| 178 | Ga0105242_10162896 | 3300009176 | Bacteria | 1954 |
| 179 | Ga0105248_10085942 | 3300009177 | Bacteria | 3539 |
| 180 | Ga0105248_10227154 | 3300009177 | Bacteria | 2101 |
| 181 | Ga0105248_10228366 | 3300009177 | Bacteria | 2095 |
| 182 | Ga0105248_10491871 | 3300009177 | Bacteria | 1383 |
| 183 | Ga0105248_10537052 | 3300009177 | Bacteria | 1319 |
| 184 | Ga0105248_10560242 | 3300009177 | Bacteria | 1289 |
| 185 | Ga0105248_10760976 | 3300009177 | Bacteria | 1093 |
| 186 | Ga0105237_10028299 | 3300009545 | Bacteria | 5710 |
| 187 | Ga0105237_10093189 | 3300009545 | Bacteria | 3002 |
| 188 | Ga0105237_10295718 | 3300009545 | Bacteria | 1622 |
| 189 | Ga0105237_10556846 | 3300009545 | Bacteria | 1153 |
| 190 | Ga0105238_10000767 | 3300009551 | Bacteria | 33436 |
| 191 | Ga0105238_10007795 | 3300009551 | Bacteria | 10711 |
| 192 | Ga0105238_10229005 | 3300009551 | Bacteria | 1835 |
| 193 | Ga0105249_10344301 | 3300009553 | Bacteria | 1508 |
| 194 | Ga0105249_10679457 | 3300009553 | Bacteria | 1089 |
| 195 | Ga0099796_10116095 | 3300010159 | Bacteria | 1024 |
| 196 | Ga0105239_10020968 | 3300010375 | Bacteria | 7211 |
| 197 | Ga0105239_10048539 | 3300010375 | Bacteria | 4655 |
| 198 | Ga0105239_10403051 | 3300010375 | Bacteria | 1548 |
| 199 | Ga0105239_10403686 | 3300010375 | Bacteria | 1547 |
| 200 | Ga0105239_10440587 | 3300010375 | Bacteria | 1477 |
| 201 | Ga0105239_10534742 | 3300010375 | Bacteria | 1334 |
| 202 | Ga0105239_10609964 | 3300010375 | Bacteria | 1245 |
| 203 | Ga0105239_10644279 | 3300010375 | Bacteria | 1210 |
| 204 | Ga0105239_10924799 | 3300010375 | Bacteria | 1001 |
| 205 | Ga0105246_10291370 | 3300011119 | Bacteria | 1313 |
| 206 | Ga0157371_10029771 | 3300013102 | Bacteria | 3944 |
| 207 | Ga0157370_10011199 | 3300013104 | Bacteria | 9404 |
| 208 | Ga0157370_10175523 | 3300013104 | Bacteria | 1992 |
| 209 | Ga0157370_10281542 | 3300013104 | Bacteria | 1536 |
| 210 | Ga0157369_10014719 | 3300013105 | Bacteria | 8826 |
| 211 | Ga0157369_10036939 | 3300013105 | Bacteria | 5351 |
| 212 | Ga0157369_10357788 | 3300013105 | Bacteria | 1516 |
| 213 | Ga0157369_10424549 | 3300013105 | Bacteria | 1378 |
| 214 | Ga0157374_10208313 | 3300013296 | Bacteria | 1916 |
| 215 | Ga0157374_10980821 | 3300013296 | Bacteria | 864 |
| 216 | Ga0157378_10083215 | 3300013297 | Bacteria | 2895 |
| 217 | Ga0157372_10335300 | 3300013307 | Bacteria | 1761 |
| 218 | Ga0157372_10464990 | 3300013307 | Bacteria | 1474 |
| 219 | Ga0157372_10629768 | 3300013307 | Bacteria | 1250 |
| 220 | Ga0163163_10052545 | 3300014325 | Bacteria | 4020 |
| 221 | Ga0163163_10194775 | 3300014325 | Bacteria | 2075 |
| 222 | Ga0157380_10573375 | 3300014326 | Bacteria | 1111 |
| 223 | Ga0157377_10201737 | 3300014745 | Bacteria | 1263 |
| 224 | Ga0157379_10047548 | 3300014968 | Bacteria | 3827 |
| 225 | Ga0157379_10111976 | 3300014968 | Bacteria | 2452 |
| 226 | Ga0157379_10745312 | 3300014968 | Bacteria | 922 |
| 227 | Ga0157376_10447832 | 3300014969 | Bacteria | 1259 |
| 228 | Ga0163161_10021791 | 3300017792 | Bacteria | 4506 |
| 229 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 230 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 231 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 232 | Ga0214543_1000043 | 3300021327 | Bacteria | 160517 |
| 233 | Ga0209758_1005787 | 3300025297 | Bacteria | 9270 |
| 234 | Ga0207656_10069669 | 3300025321 | Bacteria | 1560 |
| 235 | Ga0207682_10190194 | 3300025893 | Bacteria | 940 |
| 236 | Ga0207692_10006026 | 3300025898 | Bacteria | 4901 |
| 237 | Ga0207688_10023383 | 3300025901 | Bacteria | 3384 |
| 238 | Ga0207688_10486389 | 3300025901 | Bacteria | 772 |
| 239 | Ga0207647_10002312 | 3300025904 | Bacteria | 14514 |
| 240 | Ga0207647_10078653 | 3300025904 | Bacteria | 1981 |
| 241 | Ga0207647_10207626 | 3300025904 | Bacteria | 1132 |
| 242 | Ga0207647_10317888 | 3300025904 | Bacteria | 884 |
| 243 | Ga0207685_10014596 | 3300025905 | Bacteria | 2464 |
| 244 | Ga0207699_10018399 | 3300025906 | Bacteria | 3701 |
| 245 | Ga0207699_10494027 | 3300025906 | Bacteria | 883 |
| 246 | Ga0207645_10134097 | 3300025907 | Bacteria | 1612 |
| 247 | Ga0207705_10053520 | 3300025909 | Bacteria | 2908 |
| 248 | Ga0207705_10136184 | 3300025909 | Bacteria | 1831 |
| 249 | Ga0207654_10104095 | 3300025911 | Bacteria | 1754 |
| 250 | Ga0207707_10000445 | 3300025912 | Bacteria | 42982 |
| 251 | Ga0207707_10000990 | 3300025912 | Bacteria | 27321 |
| 252 | Ga0207707_10084648 | 3300025912 | Bacteria | 2769 |
| 253 | Ga0207707_10112081 | 3300025912 | Bacteria | 2385 |
| 254 | Ga0207695_10021945 | 3300025913 | Bacteria | 7266 |
| 255 | Ga0207695_10174609 | 3300025913 | Bacteria | 2072 |
| 256 | Ga0207671_10579235 | 3300025914 | Bacteria | 895 |
| 257 | Ga0207693_10001330 | 3300025915 | Bacteria | 21856 |
| 258 | Ga0207693_10017779 | 3300025915 | Bacteria | 5669 |
| 259 | Ga0207663_10001827 | 3300025916 | Bacteria | 10032 |
| 260 | Ga0207663_10026590 | 3300025916 | Bacteria | 3361 |
| 261 | Ga0207660_10007283 | 3300025917 | Bacteria | 7160 |
| 262 | Ga0207660_10161006 | 3300025917 | Bacteria | 1731 |
| 263 | Ga0207660_10246492 | 3300025917 | Bacteria | 1409 |
| 264 | Ga0207657_10057982 | 3300025919 | Bacteria | 3335 |
| 265 | Ga0207657_10180129 | 3300025919 | Bacteria | 1708 |
| 266 | Ga0207657_10328153 | 3300025919 | Bacteria | 1209 |
| 267 | Ga0207649_10273327 | 3300025920 | Bacteria | 1226 |
| 268 | Ga0207649_10686403 | 3300025920 | Bacteria | 793 |
| 269 | Ga0207652_10003759 | 3300025921 | Bacteria | 12435 |
| 270 | Ga0207652_10011887 | 3300025921 | Bacteria | 7023 |
| 271 | Ga0207681_10467722 | 3300025923 | Bacteria | 1028 |
| 272 | Ga0207694_10011956 | 3300025924 | Bacteria | 6545 |
| 273 | Ga0207694_10020073 | 3300025924 | Bacteria | 5054 |
| 274 | Ga0207694_10266493 | 3300025924 | Bacteria | 1404 |
| 275 | Ga0207694_10277251 | 3300025924 | Bacteria | 1376 |
| 276 | Ga0207659_10195990 | 3300025926 | Bacteria | 1610 |
| 277 | Ga0207687_10016378 | 3300025927 | Bacteria | 4869 |
| 278 | Ga0207687_10173374 | 3300025927 | Bacteria | 1665 |
| 279 | Ga0207700_10011006 | 3300025928 | Bacteria | 5747 |
| 280 | Ga0207700_10487564 | 3300025928 | Bacteria | 1090 |
| 281 | Ga0207664_10002909 | 3300025929 | Bacteria | 11376 |
| 282 | Ga0207664_10245040 | 3300025929 | Bacteria | 1562 |
| 283 | Ga0207664_10933610 | 3300025929 | Bacteria | 779 |
| 284 | Ga0207690_10315214 | 3300025932 | Bacteria | 1228 |
| 285 | Ga0207709_10029659 | 3300025935 | Bacteria | 3176 |
| 286 | Ga0207704_10181384 | 3300025938 | Bacteria | 1522 |
| 287 | Ga0207704_10780522 | 3300025938 | Bacteria | 797 |
| 288 | Ga0207665_10000843 | 3300025939 | Bacteria | 20718 |
| 289 | Ga0207665_10051404 | 3300025939 | Bacteria | 2774 |
| 290 | Ga0207665_10161046 | 3300025939 | Bacteria | 1614 |
| 291 | Ga0207691_10038499 | 3300025940 | Bacteria | 4426 |
| 292 | Ga0207691_10171660 | 3300025940 | Bacteria | 1899 |
| 293 | Ga0207711_10254616 | 3300025941 | Bacteria | 1613 |
| 294 | Ga0207689_10010002 | 3300025942 | Bacteria | 8177 |
| 295 | Ga0207689_10124484 | 3300025942 | Bacteria | 2121 |
| 296 | Ga0207689_10352424 | 3300025942 | Bacteria | 1224 |
| 297 | Ga0207661_10001081 | 3300025944 | Bacteria | 18103 |
| 298 | Ga0207661_10039324 | 3300025944 | Bacteria | 3712 |
| 299 | Ga0207661_10790502 | 3300025944 | Bacteria | 874 |
| 300 | Ga0207679_10104904 | 3300025945 | Bacteria | 2219 |
| 301 | Ga0207679_10830377 | 3300025945 | Bacteria | 843 |
| 302 | Ga0207667_10011487 | 3300025949 | Bacteria | 10286 |
| 303 | Ga0207667_10124632 | 3300025949 | Bacteria | 2654 |
| 304 | Ga0207667_10336237 | 3300025949 | Bacteria | 1542 |
| 305 | Ga0207712_10034760 | 3300025961 | Bacteria | 3418 |
| 306 | Ga0207668_10023936 | 3300025972 | Bacteria | 3934 |
| 307 | Ga0207668_10549444 | 3300025972 | Bacteria | 1000 |
| 308 | Ga0207668_10600198 | 3300025972 | Bacteria | 959 |
| 309 | Ga0207640_10016790 | 3300025981 | Bacteria | 4267 |
| 310 | Ga0207640_10217350 | 3300025981 | Bacteria | 1461 |
| 311 | Ga0207658_10147477 | 3300025986 | Bacteria | 1913 |
| 312 | Ga0207677_10167246 | 3300026023 | Bacteria | 1715 |
| 313 | Ga0207677_10310024 | 3300026023 | Bacteria | 1307 |
| 314 | Ga0207703_10185692 | 3300026035 | Bacteria | 1838 |
| 315 | Ga0207639_10003274 | 3300026041 | Bacteria | 10910 |
| 316 | Ga0207639_10382364 | 3300026041 | Bacteria | 1264 |
| 317 | Ga0207678_10011118 | 3300026067 | Bacteria | 7907 |
| 318 | Ga0207678_10043469 | 3300026067 | Bacteria | 3888 |
| 319 | Ga0207678_10088296 | 3300026067 | Bacteria | 2650 |
| 320 | Ga0207678_10129958 | 3300026067 | Bacteria | 2148 |
| 321 | Ga0207678_10277926 | 3300026067 | Bacteria | 1437 |
| 322 | Ga0207678_10903668 | 3300026067 | Bacteria | 781 |
| 323 | Ga0207678_11029127 | 3300026067 | Bacteria | 729 |
| 324 | Ga0207708_10227305 | 3300026075 | Bacteria | 1497 |
| 325 | Ga0207702_10060716 | 3300026078 | Bacteria | 3223 |
| 326 | Ga0207702_10748509 | 3300026078 | Bacteria | 965 |
| 327 | Ga0207641_10195997 | 3300026088 | Bacteria | 1859 |
| 328 | Ga0207641_10256679 | 3300026088 | Bacteria | 1635 |
| 329 | Ga0207641_10474214 | 3300026088 | Bacteria | 1212 |
| 330 | Ga0207648_10983761 | 3300026089 | Bacteria | 790 |
| 331 | Ga0207676_10053412 | 3300026095 | Bacteria | 3163 |
| 332 | Ga0207676_10694248 | 3300026095 | Bacteria | 985 |
| 333 | Ga0207674_10002936 | 3300026116 | Bacteria | 21181 |
| 334 | Ga0207674_10005387 | 3300026116 | Bacteria | 15226 |
| 335 | Ga0207674_10043166 | 3300026116 | Bacteria | 4651 |
| 336 | Ga0207674_10466219 | 3300026116 | Bacteria | 1221 |
| 337 | Ga0207675_100025514 | 3300026118 | Bacteria | 5500 |
| 338 | Ga0207675_100327350 | 3300026118 | Bacteria | 1497 |
| 339 | Ga0207683_10377637 | 3300026121 | Bacteria | 1302 |
| 340 | Ga0207683_10470225 | 3300026121 | Bacteria | 1160 |
| 341 | Ga0207698_10197105 | 3300026142 | Bacteria | 1800 |
| 342 | Ga0207698_10419681 | 3300026142 | Bacteria | 1283 |
| 343 | Ga0207698_10499776 | 3300026142 | Bacteria | 1183 |
| 344 | Ga0207698_10551643 | 3300026142 | Bacteria | 1130 |
| 345 | Ga0209813_10019215 | 3300027866 | Bacteria | 1897 |
| 346 | Ga0268266_10003674 | 3300028379 | Bacteria | 15150 |
| 347 | Ga0268266_10004060 | 3300028379 | Bacteria | 14149 |
| 348 | Ga0268266_10015017 | 3300028379 | Bacteria | 6647 |
| 349 | Ga0268266_10040844 | 3300028379 | Bacteria | 3955 |
| 350 | Ga0268266_10300988 | 3300028379 | Bacteria | 1496 |
| 351 | Ga0268266_10839131 | 3300028379 | Bacteria | 888 |
| 352 | Ga0268266_11166968 | 3300028379 | Bacteria | 745 |
| 353 | Ga0268265_10203958 | 3300028380 | Bacteria | 1717 |
| 354 | Ga0268265_10920568 | 3300028380 | Bacteria | 859 |
| 355 | Ga0268264_10181539 | 3300028381 | Bacteria | 1912 |
| 356 | Ga0268264_10206815 | 3300028381 | Bacteria | 1799 |
| 357 | Ga0268264_10275684 | 3300028381 | Bacteria | 1573 |
| 358 | Ga0265763_1018696 | 3300030763 | Bacteria | 712 |
| 359 | Ga0265332_10073435 | 3300031238 | Bacteria | 1455 |
| 360 | Ga0265332_10106507 | 3300031238 | Bacteria | 1182 |
| 361 | Ga0265332_10114411 | 3300031238 | Bacteria | 1135 |
| 362 | Ga0265339_10017310 | 3300031249 | Bacteria | 4272 |
| 363 | Ga0265331_10041531 | 3300031250 | Bacteria | 2235 |
| 364 | Ga0307513_10113448 | 3300031456 | Bacteria | 2698 |
| 365 | Ga0307408_100107661 | 3300031548 | Bacteria | 2135 |
| 366 | Ga0307508_10036258 | 3300031616 | Bacteria | 4441 |
| 367 | Ga0265314_10030517 | 3300031711 | Bacteria | 3988 |
| 368 | Ga0265314_10106031 | 3300031711 | Bacteria | 1796 |
| 369 | Ga0265314_10210176 | 3300031711 | Bacteria | 1143 |
| 370 | Ga0265342_10005300 | 3300031712 | Bacteria | 9883 |
| 371 | Ga0307516_10013268 | 3300031730 | Bacteria | 8793 |
| 372 | Ga0307405_10241089 | 3300031731 | Bacteria | 1339 |
| 373 | Ga0307406_10248410 | 3300031901 | Bacteria | 1339 |
| 374 | Ga0307406_10954488 | 3300031901 | Bacteria | 733 |
| 375 | Ga0307407_10334716 | 3300031903 | Bacteria | 1067 |
| 376 | Ga0307412_10866129 | 3300031911 | Bacteria | 789 |
| 377 | Ga0307416_100137467 | 3300032002 | Bacteria | 2214 |
| 378 | Ga0307416_100298320 | 3300032002 | Bacteria | 1600 |
| 379 | Ga0307416_100974368 | 3300032002 | Bacteria | 950 |
| 380 | Ga0307411_11209872 | 3300032005 | Bacteria | 685 |
| 381 | Ga0307415_100102777 | 3300032126 | Bacteria | 2101 |
| 382 | Ga0307415_100390794 | 3300032126 | Bacteria | 1184 |
| 383 | Ga0373930_0010827 | 3300034816 | Bacteria | 1637 |
| 384 | Ga0373948_0027421 | 3300034817 | Bacteria | 1128 |
| 385 | Ga0373959_0072765 | 3300034820 | Bacteria | 780 |
| 386 | Ga0373928_0033945 | 3300035084 | Bacteria | 1143 |
| 387 | Ga0373934_0071200 | 3300035086 | Bacteria | 1391 |
| 388 | Ga0373944_0016469 | 3300035089 | Bacteria | 2086 |
| 389 | Ga0373951_0047821 | 3300035091 | Bacteria | 1046 |
| 390 | Ga0373951_0079506 | 3300035091 | Bacteria | 847 |
| 391 | Ga0373952_0017696 | 3300035092 | Bacteria | 1465 |
| 392 | Ga0373932_0134792 | 3300035112 | Bacteria | 835 |
| 393 | Ga0373936_0006488 | 3300035113 | Bacteria | 4412 |
| 394 | Ga0373936_0036855 | 3300035113 | Bacteria | 1951 |
| 395 | Ga0373936_0133424 | 3300035113 | Bacteria | 1068 |
| 396 | Ga0373945_0009473 | 3300035116 | Bacteria | 3191 |
| 397 | Ga0373953_0003561 | 3300035117 | Bacteria | 4870 |
| 398 | Ga0373953_0052366 | 3300035117 | Bacteria | 1652 |
| 399 | Ga0373954_0005495 | 3300035118 | Bacteria | 5483 |
| 400 | Ga0373956_0012061 | 3300035119 | Bacteria | 3574 |
| 401 | Ga0373957_0006428 | 3300035120 | Bacteria | 3701 |
| 402 | Ga0373946_0001985 | 3300035171 | Bacteria | 7160 |
| 403 | Ga0373955_0006993 | 3300035172 | Bacteria | 5164 |
| 404 | Ga0373955_0270636 | 3300035172 | Bacteria | 1021 |
| 405 | Ga0373942_0012242 | 3300035207 | Bacteria | 2046 |
| 406 | Ga0373924_0008980 | 3300035410 | Bacteria | 3653 |
| 407 | Ga0373931_0039790 | 3300035691 | Bacteria | 2464 |
| 408 | Ga0373935_0000046 | 3300035692 | Bacteria | 48734 |
| 409 | Ga0373927_0000209 | 3300035695 | Bacteria | 46820 |
| 410 | Ga0373927_0018902 | 3300035695 | Bacteria | 4521 |
| 411 | Ga0373927_0056990 | 3300035695 | Bacteria | 2527 |
| 412 | Ga0373927_0326902 | 3300035695 | Bacteria | 1010 |
| 413 | Ga0373933_0344625 | 3300035724 | Bacteria | 967 |
| 414 | Ga0373947_0002390 | 3300035725 | Bacteria | 11333 |
| 415 | Ga0373947_0318240 | 3300035725 | Bacteria | 1040 |
| 416 | Ga0373937_0122269 | 3300036401 | Bacteria | 2426 |
| 417 | Ga0373937_0270653 | 3300036401 | Bacteria | 1603 |
| 418 | Ga0373925_0128019 | 3300037068 | Bacteria | 1977 |
| 419 | Ga0373925_0142028 | 3300037068 | Bacteria | 1880 |
| 420 | Ga0395899_0064309 | 3300037312 | Bacteria | 2697 |
| 421 | Ga0395900_0006715 | 3300037418 | Bacteria | 11947 |
| 422 | Ga0395900_0260653 | 3300037418 | Bacteria | 1732 |
| 423 | Ga0395900_0399889 | 3300037418 | Bacteria | 1338 |
| 424 | Ga0395898_0017586 | 3300037466 | Bacteria | 7296 |
| 425 | Ga0395898_0023802 | 3300037466 | Bacteria | 6184 |
| 426 | Ga0395898_0129003 | 3300037466 | Bacteria | 2422 |
| 427 | Ga0395898_0136817 | 3300037466 | Bacteria | 2346 |
| 428 | Ga0395898_0172868 | 3300037466 | Bacteria | 2065 |
| 429 | Ga0395905_0031610 | 3300037471 | Bacteria | 4983 |
| 430 | Ga0395905_1092588 | 3300037471 | Bacteria | 701 |
| 431 | Ga0395901_0055054 | 3300038443 | Bacteria | 4136 |
| 432 | Ga0395901_0078214 | 3300038443 | Bacteria | 3454 |
| 433 | Ga0395901_0258187 | 3300038443 | Bacteria | 1814 |
| 434 | Ga0395901_0270747 | 3300038443 | Bacteria | 1766 |
| 435 | Ga0436363_1457096 | 3300039450 | Bacteria | 840 |
| 436 | Ga0439465_0029497 | 3300041413 | Bacteria | 1743 |
| 437 | Ga0451793_0130578 | 3300041452 | Bacteria | 635 |
| 438 | Ga0451795_0972193 | 3300041456 | Bacteria | 855 |
| 439 | Ga0451806_270177 | 3300041462 | Bacteria | 772 |
| 440 | Ga0451843_1570788 | 3300041509 | Bacteria | 711 |
| 441 | Ga0450905_035059 | 3300042142 | Bacteria | 784 |
| 442 | Ga0466963_0005447 | 3300044694 | Bacteria | 7455 |
| 443 | Ga0466964_0034844 | 3300044706 | Bacteria | 2010 |
| 444 | Ga0466971_0209137 | 3300044719 | Bacteria | 922 |
| 445 | Ga0466968_0004513 | 3300044735 | Bacteria | 5207 |
| 446 | Ga0466959_0313446 | 3300045049 | Bacteria | 1073 |
| 447 | Ga0466967_0013380 | 3300045976 | Bacteria | 6337 |
| 448 | Ga0466967_0060474 | 3300045976 | Bacteria | 3357 |
| 449 | Ga0466967_0162440 | 3300045976 | Bacteria | 2097 |
| 450 | Ga0466967_0230370 | 3300045976 | Bacteria | 1764 |
| 451 | Ga0466967_0508706 | 3300045976 | Bacteria | 1183 |
| 452 | Ga0495617_030574 | 3300046452 | Bacteria | 1810 |
| 453 | Ga0495592_0008934 | 3300046454 | Bacteria | 7523 |
| 454 | Ga0495592_0051355 | 3300046454 | Bacteria | 3062 |
| 455 | Ga0495603_0000259 | 3300046455 | Bacteria | 27881 |
| 456 | Ga0495603_0008575 | 3300046455 | Bacteria | 6177 |
| 457 | Ga0495603_0041656 | 3300046455 | Bacteria | 2746 |
| 458 | Ga0495629_0002432 | 3300046459 | Bacteria | 14294 |
| 459 | Ga0495629_0437676 | 3300046459 | Bacteria | 886 |
| 460 | Ga0495641_0002618 | 3300046461 | Bacteria | 14079 |
| 461 | Ga0495651_0014811 | 3300046462 | Bacteria | 6030 |
| 462 | Ga0495653_0026125 | 3300046463 | Bacteria | 4686 |
| 463 | Ga0495653_0051592 | 3300046463 | Bacteria | 3157 |
| 464 | Ga0495650_0138376 | 3300046471 | Bacteria | 883 |
| 465 | Ga0495580_0003494 | 3300046472 | Bacteria | 13369 |
| 466 | Ga0495582_0000486 | 3300046473 | Bacteria | 21751 |
| 467 | Ga0495605_0068744 | 3300046474 | Bacteria | 1678 |
| 468 | Ga0495639_0000862 | 3300046475 | Bacteria | 13749 |
| 469 | Ga0495662_0001965 | 3300046476 | Bacteria | 10318 |
| 470 | Ga0495662_0125383 | 3300046476 | Bacteria | 1261 |
| 471 | Ga0495664_0012483 | 3300046477 | Bacteria | 4812 |
| 472 | Ga0495664_0029399 | 3300046477 | Bacteria | 3214 |
| 473 | Ga0495664_0337075 | 3300046477 | Bacteria | 909 |
| 474 | Ga0495594_0002058 | 3300046499 | Bacteria | 10471 |
| 475 | Ga0495594_0101589 | 3300046499 | Bacteria | 1618 |
| 476 | Ga0495606_0003660 | 3300046507 | Bacteria | 16112 |
| 477 | Ga0495606_0207676 | 3300046507 | Bacteria | 1111 |
| 478 | Ga0495608_0013574 | 3300046511 | Bacteria | 5650 |
| 479 | Ga0495628_0019320 | 3300046516 | Bacteria | 5634 |
| 480 | Ga0495630_0003436 | 3300046517 | Bacteria | 11013 |
| 481 | Ga0495630_0027345 | 3300046517 | Bacteria | 4231 |
| 482 | Ga0495648_0001251 | 3300046524 | Bacteria | 25398 |
| 483 | Ga0495663_0016702 | 3300046525 | Bacteria | 2076 |
| 484 | Ga0495666_0013538 | 3300046526 | Bacteria | 4066 |
| 485 | Ga0495652_0074294 | 3300046529 | Bacteria | 2827 |
| 486 | Ga0495665_0000311 | 3300046531 | Bacteria | 24696 |
| 487 | Ga0495640_0008655 | 3300046533 | Bacteria | 7976 |
| 488 | Ga0495640_0035491 | 3300046533 | Bacteria | 3529 |
| 489 | Ga0495640_0358015 | 3300046533 | Bacteria | 900 |
| 490 | Ga0495587_0011369 | 3300046536 | Bacteria | 5641 |
| 491 | Ga0495609_0161912 | 3300046538 | Bacteria | 948 |
| 492 | Ga0495621_0018370 | 3300046539 | Bacteria | 2270 |
| 493 | Ga0495645_0003153 | 3300046543 | Bacteria | 11175 |
| 494 | Ga0495622_0002639 | 3300046557 | Bacteria | 8628 |
| 495 | Ga0495622_0157255 | 3300046557 | Bacteria | 1026 |
| 496 | Ga0495633_0127781 | 3300046558 | Bacteria | 1176 |
| 497 | Ga0495633_0168142 | 3300046558 | Bacteria | 1011 |
| 498 | Ga0495667_0036954 | 3300046559 | Bacteria | 3256 |
| 499 | Ga0495667_0037997 | 3300046559 | Bacteria | 3207 |
| 500 | Ga0495668_0133751 | 3300046616 | Bacteria | 1357 |
| 501 | Ga0495668_0405584 | 3300046616 | Bacteria | 749 |
| 502 | Ga0495634_0001829 | 3300046642 | Bacteria | 18374 |
| 503 | Ga0495634_0103387 | 3300046642 | Bacteria | 1838 |
| 504 | Ga0495625_0249331 | 3300046660 | Bacteria | 1153 |
| 505 | Ga0495635_0002849 | 3300046663 | Bacteria | 11881 |
| 506 | Ga0495588_0213103 | 3300046674 | Bacteria | 1020 |
| 507 | Ga0495657_0015384 | 3300046675 | Bacteria | 5601 |
| 508 | Ga0495599_0004679 | 3300046678 | Bacteria | 8115 |
| 509 | Ga0495599_0044545 | 3300046678 | Bacteria | 2783 |
| 510 | Ga0495599_0059544 | 3300046678 | Bacteria | 2389 |
| 511 | Ga0495623_0011461 | 3300046679 | Bacteria | 5738 |
| 512 | Ga0495623_0201202 | 3300046679 | Bacteria | 1145 |
| 513 | Ga0495646_0027225 | 3300046680 | Bacteria | 3587 |
| 514 | Ga0495646_0089061 | 3300046680 | Bacteria | 1786 |
| 515 | Ga0495647_0000389 | 3300046681 | Bacteria | 12524 |
| 516 | Ga0495658_0273016 | 3300046683 | Bacteria | 1066 |
| 517 | Ga0495669_0036562 | 3300046684 | Bacteria | 2171 |
| 518 | Ga0495669_0337178 | 3300046684 | Bacteria | 728 |
| 519 | Ga0495613_0009884 | 3300046689 | Bacteria | 7092 |
| 520 | Ga0495613_0272797 | 3300046689 | Bacteria | 1176 |
| 521 | Ga0495613_0281743 | 3300046689 | Bacteria | 1154 |
| 522 | Ga0495624_0000622 | 3300046690 | Bacteria | 27706 |
| 523 | Ga0495670_0215813 | 3300046691 | Bacteria | 1018 |
| 524 | Ga0495589_0084979 | 3300046794 | Bacteria | 1538 |
| 525 | Ga0495600_0010405 | 3300046809 | Bacteria | 5776 |
| 526 | Ga0495600_0308079 | 3300046809 | Bacteria | 998 |
| 527 | Ga0495581_0003143 | 3300047315 | Bacteria | 9446 |
| 528 | Ga0495581_0048593 | 3300047315 | Bacteria | 2450 |
| 529 | Ga0495581_0071475 | 3300047315 | Bacteria | 2008 |
| 530 | Ga0495581_0190372 | 3300047315 | Bacteria | 1200 |
| 531 | Ga0495604_0057212 | 3300047317 | Bacteria | 2998 |
| 532 | Ga0495674_0001665 | 3300047319 | Bacteria | 21844 |
| 533 | Ga0495674_0036515 | 3300047319 | Bacteria | 4422 |
| 534 | Ga0495672_0015332 | 3300047320 | Bacteria | 5208 |
| 535 | Ga0495676_0242944 | 3300047321 | Bacteria | 1232 |
| 536 | Ga0495680_0018556 | 3300047322 | Bacteria | 5898 |
| 537 | Ga0495680_0071033 | 3300047322 | Bacteria | 2652 |
| 538 | Ga0495677_0053716 | 3300047445 | Bacteria | 1486 |
| 539 | Ga0495679_049955 | 3300047446 | Bacteria | 1260 |
| 540 | Ga0495685_114342 | 3300047447 | Bacteria | 887 |
| 541 | Ga0495673_0056055 | 3300047469 | Bacteria | 1707 |
| 542 | Ga0495681_0168542 | 3300047470 | Bacteria | 907 |
| 543 | Ga0495684_0019406 | 3300047471 | Bacteria | 5234 |
| 544 | Ga0495684_0024969 | 3300047471 | Bacteria | 4596 |
| 545 | Ga0495686_0267660 | 3300047472 | Bacteria | 954 |
| 546 | Ga0495593_0000007 | 3300047673 | Bacteria | 87657 |
| 547 | Ga0495602_0044685 | 3300048088 | Bacteria | 4015 |
| 548 | Ga0495614_0012905 | 3300048089 | Bacteria | 3663 |
| 549 | Ga0496100_0791650 | 3300048903 | Bacteria | 743 |
| 550 | Ga0496100_0828050 | 3300048903 | Bacteria | 725 |
| 551 | Ga0496101_0134723 | 3300048904 | Bacteria | 1878 |
| 552 | Ga0496102_0156343 | 3300048905 | Bacteria | 2143 |
| 553 | Ga0496102_0185750 | 3300048905 | Bacteria | 1959 |
| 554 | Ga0496102_0323693 | 3300048905 | Bacteria | 1452 |
| 555 | Ga0496102_0612127 | 3300048905 | Bacteria | 1012 |
| 556 | Ga0496102_0966195 | 3300048905 | Bacteria | 773 |
| 557 | Ga0496104_0024983 | 3300048907 | Bacteria | 5504 |
| 558 | Ga0496104_0035278 | 3300048907 | Bacteria | 4670 |
| 559 | Ga0496104_0074642 | 3300048907 | Bacteria | 3228 |
| 560 | Ga0496104_0206984 | 3300048907 | Bacteria | 1874 |
| 561 | Ga0496105_0089112 | 3300048908 | Bacteria | 2549 |
| 562 | Ga0496105_0097528 | 3300048908 | Bacteria | 2428 |
| 563 | Ga0496105_0152995 | 3300048908 | Bacteria | 1895 |
| 564 | Ga0496106_0050023 | 3300048909 | Bacteria | 3149 |
| 565 | Ga0496106_0059255 | 3300048909 | Bacteria | 2900 |
| 566 | Ga0496106_0097281 | 3300048909 | Bacteria | 2279 |
| 567 | Ga0496106_0607019 | 3300048909 | Bacteria | 876 |
| 568 | Ga0496107_0055526 | 3300048910 | Bacteria | 2860 |
| 569 | Ga0496108_0191328 | 3300048911 | Bacteria | 1773 |
| 570 | Ga0496108_0236997 | 3300048911 | Bacteria | 1587 |
| 571 | Ga0496108_0240436 | 3300048911 | Bacteria | 1575 |
| 572 | Ga0496109_0024467 | 3300048912 | Bacteria | 5369 |
| 573 | Ga0496109_0273723 | 3300048912 | Bacteria | 1591 |
| 574 | Ga0496110_0054316 | 3300048913 | Bacteria | 3523 |
| 575 | Ga0496110_0247840 | 3300048913 | Bacteria | 1621 |
| 576 | Ga0496111_0114108 | 3300048914 | Bacteria | 1991 |
| 577 | Ga0496111_0273228 | 3300048914 | Bacteria | 1254 |
| 578 | Ga0496112_0000035 | 3300048915 | Bacteria | 106983 |
| 579 | Ga0496112_0018177 | 3300048915 | Bacteria | 6616 |
| 580 | Ga0496112_0063564 | 3300048915 | Bacteria | 3641 |
| 581 | Ga0496112_0116195 | 3300048915 | Bacteria | 2646 |
| 582 | Ga0496112_0242050 | 3300048915 | Bacteria | 1756 |
| 583 | Ga0496113_0055405 | 3300048916 | Bacteria | 2972 |
| 584 | Ga0496113_0220280 | 3300048916 | Bacteria | 1512 |
| 585 | Ga0496113_0256439 | 3300048916 | Bacteria | 1397 |
| 586 | Ga0496113_0506112 | 3300048916 | Bacteria | 970 |
| 587 | Ga0496114_0025578 | 3300048917 | Bacteria | 4825 |
| 588 | Ga0496114_0130553 | 3300048917 | Bacteria | 2169 |
| 589 | Ga0496115_0052603 | 3300048918 | Bacteria | 3268 |
| 590 | Ga0496115_0104691 | 3300048918 | Bacteria | 2322 |
| 591 | Ga0496115_0190455 | 3300048918 | Bacteria | 1695 |
| 592 | Ga0496116_0272092 | 3300048919 | Bacteria | 827 |
| 593 | Ga0496118_0094094 | 3300048921 | Bacteria | 2050 |
| 594 | Ga0496118_0114421 | 3300048921 | Bacteria | 1779 |
| 595 | Ga0496119_0110145 | 3300048922 | Bacteria | 1530 |
| 596 | Ga0496119_0132290 | 3300048922 | Bacteria | 1358 |
| 597 | Ga0496120_0028338 | 3300048923 | Bacteria | 3433 |
| 598 | Ga0496121_0023544 | 3300048924 | Bacteria | 5925 |
| 599 | Ga0496121_0117259 | 3300048924 | Bacteria | 2017 |
| 600 | Ga0496121_0359293 | 3300048924 | Bacteria | 967 |
| 601 | Ga0496124_0233967 | 3300048927 | Bacteria | 1371 |
| 602 | Ga0496125_0000516 | 3300048928 | Bacteria | 67232 |
| 603 | Ga0496125_0067862 | 3300048928 | Bacteria | 2808 |
| 604 | Ga0496126_0009932 | 3300048929 | Bacteria | 10048 |
| 605 | Ga0496126_0013584 | 3300048929 | Bacteria | 8269 |
| 606 | Ga0496126_0057284 | 3300048929 | Bacteria | 3519 |
| 607 | Ga0496126_0435123 | 3300048929 | Bacteria | 1058 |
| 608 | Ga0501031_0000248 | 3300049568 | Bacteria | 30285 |
| 609 | Ga0501031_0064221 | 3300049568 | Bacteria | 2391 |
| 610 | Ga0501032_0000387 | 3300049569 | Bacteria | 36261 |
| 611 | Ga0501032_0356671 | 3300049569 | Bacteria | 942 |
| 612 | Ga0501033_0000110 | 3300049570 | Bacteria | 78954 |
| 613 | Ga0501033_0021023 | 3300049570 | Bacteria | 4926 |
| 614 | Ga0501033_0554813 | 3300049570 | Bacteria | 791 |
| 615 | Ga0501034_0000198 | 3300049571 | Bacteria | 113672 |
| 616 | Ga0501034_0404884 | 3300049571 | Bacteria | 1287 |
| 617 | Ga0501034_0791798 | 3300049571 | Bacteria | 841 |
| 618 | Ga0501036_0000047 | 3300049572 | Bacteria | 75675 |
| 619 | Ga0501036_0193246 | 3300049572 | Bacteria | 1712 |
| 620 | Ga0501036_0237956 | 3300049572 | Bacteria | 1527 |
| 621 | Ga0501037_0000050 | 3300049573 | Bacteria | 112824 |
| 622 | Ga0501037_0299472 | 3300049573 | Bacteria | 1117 |
| 623 | Ga0501038_0000463 | 3300049574 | Bacteria | 35636 |
| 624 | Ga0501038_0485578 | 3300049574 | Bacteria | 946 |
| 625 | Ga0501039_0000260 | 3300049575 | Bacteria | 38731 |
| 626 | Ga0501041_0183242 | 3300049577 | Bacteria | 1311 |
| 627 | Ga0501042_0021886 | 3300049578 | Bacteria | 4462 |
| 628 | Ga0501042_0673143 | 3300049578 | Bacteria | 752 |
| 629 | Ga0501043_0000153 | 3300049579 | Bacteria | 64297 |
| 630 | Ga0501043_0069478 | 3300049579 | Bacteria | 2766 |
| 631 | Ga0501043_0437613 | 3300049579 | Bacteria | 984 |
| 632 | Ga0501043_0709070 | 3300049579 | Bacteria | 734 |
| 633 | Ga0501043_0717479 | 3300049579 | Bacteria | 729 |
| 634 | Ga0501046_0000678 | 3300049580 | Bacteria | 33047 |
| 635 | Ga0501047_0003334 | 3300049581 | Bacteria | 15216 |
| 636 | Ga0501047_0153240 | 3300049581 | Bacteria | 2179 |
| 637 | Ga0501047_0399387 | 3300049581 | Bacteria | 1207 |
| 638 | Ga0501047_0887080 | 3300049581 | Bacteria | 705 |
| 639 | Ga0501048_0000323 | 3300049582 | Bacteria | 32874 |
| 640 | Ga0501067_0000101 | 3300049583 | Bacteria | 49019 |
| 641 | Ga0501067_0335551 | 3300049583 | Bacteria | 842 |
| 642 | Ga0501068_0001632 | 3300049584 | Bacteria | 11969 |
| 643 | Ga0501070_0008034 | 3300049586 | Bacteria | 8933 |
| 644 | Ga0501070_0050622 | 3300049586 | Bacteria | 3448 |
| 645 | Ga0501071_0070981 | 3300049587 | Bacteria | 2538 |
| 646 | Ga0501072_0000168 | 3300049588 | Bacteria | 47553 |
| 647 | Ga0501074_0010655 | 3300049590 | Bacteria | 6673 |
| 648 | Ga0501075_0204613 | 3300049591 | Bacteria | 1506 |
| 649 | Ga0501076_0521497 | 3300049592 | Bacteria | 979 |
| 650 | Ga0501079_0000308 | 3300049741 | Bacteria | 30498 |
| 651 | Ga0501079_0348167 | 3300049741 | Bacteria | 1161 |
| 652 | Ga0501080_0000093 | 3300049742 | Bacteria | 60276 |
| 653 | Ga0501080_0420392 | 3300049742 | Bacteria | 1201 |
| 654 | Ga0501083_0001922 | 3300049744 | Bacteria | 14285 |
| 655 | Ga0501035_0005530 | 3300049822 | Bacteria | 11940 |
| 656 | Ga0501044_0000100 | 3300049823 | Bacteria | 106729 |
| 657 | Ga0501044_0035648 | 3300049823 | Bacteria | 5209 |
| 658 | Ga0501044_0084898 | 3300049823 | Bacteria | 3199 |
| 659 | Ga0501044_0166646 | 3300049823 | Bacteria | 2177 |
| 660 | Ga0501044_0176093 | 3300049823 | Bacteria | 2108 |
| 661 | Ga0501044_0276769 | 3300049823 | Bacteria | 1613 |
| 662 | Ga0501045_0032228 | 3300049824 | Bacteria | 3797 |
| 663 | nmdc:mga03683_188437_c1 | 3300050489 | Bacteria | 943 |
| 664 | nmdc:mga03683_780_c1 | 3300050489 | Bacteria | 9142 |
| 665 | nmdc:mga00v17_566533_c1 | 3300050491 | Bacteria | 734 |
| 666 | nmdc:mga0yw44_29389_c1 | 3300050492 | Bacteria | 3173 |
| 667 | nmdc:mga0yw44_899_c1 | 3300050492 | Bacteria | 11227 |
| 668 | nmdc:mga0yw44_97098_c1 | 3300050492 | Bacteria | 1871 |
| 669 | nmdc:mga0k408_306478_c1 | 3300050493 | Bacteria | 948 |
| 670 | nmdc:mga0k408_48368_c1 | 3300050493 | Bacteria | 2460 |
| 671 | nmdc:mga0k408_61833_c1 | 3300050493 | Bacteria | 2177 |
| 672 | nmdc:mga06z11_150109_c1 | 3300050494 | Bacteria | 1324 |
| 673 | nmdc:mga06z11_19223_c1 | 3300050494 | Bacteria | 3136 |
| 674 | nmdc:mga06z11_78524_c1 | 3300050494 | Bacteria | 1765 |
| 675 | nmdc:mga04h51_127207_c1 | 3300050495 | Bacteria | 955 |
| 676 | nmdc:mga07m45_3481_c1 | 3300050496 | Bacteria | 7589 |
| 677 | nmdc:mga05p37_249646_c1 | 3300050507 | Bacteria | 2129 |
| 678 | nmdc:mga05p37_764282_c1 | 3300050507 | Bacteria | 1063 |
| 679 | nmdc:mga09592_636951_c1 | 3300050508 | Bacteria | 911 |
| 680 | nmdc:mga08y16_469826_c1 | 3300050511 | Bacteria | 1281 |
| 681 | nmdc:mga0n895_109171_c1 | 3300050512 | Bacteria | 2782 |
| 682 | nmdc:mga0rr50_272004_c1 | 3300050513 | Bacteria | 1412 |
| 683 | nmdc:mga0sz30_134437_c1 | 3300050516 | Bacteria | 1091 |
| 684 | nmdc:mga0sz30_223154_c1 | 3300050516 | Bacteria | 838 |
| 685 | nmdc:mga0sz30_3901_c1 | 3300050516 | Bacteria | 3185 |
| 686 | Ga0495601_0044175 | 3300053077 | Bacteria | 2801 |
| 687 | Ga0495601_0052014 | 3300053077 | Bacteria | 2585 |
| 688 | Ga0495612_0017966 | 3300053078 | Bacteria | 2830 |
| 689 | Ga0495612_0024077 | 3300053078 | Bacteria | 2445 |
| 690 | Ga0495612_0307461 | 3300053078 | Bacteria | 712 |
| 691 | Ga0500635_0020934 | 3300053080 | Bacteria | 2009 |
| 692 | Ga0495655_0121695 | 3300053083 | Bacteria | 795 |
| 693 | Ga0495619_0067243 | 3300053085 | Bacteria | 2392 |
| 694 | Ga0495619_0225404 | 3300053085 | Bacteria | 1298 |
| 695 | Ga0495619_0494250 | 3300053085 | Bacteria | 842 |
| 696 | Ga0495619_0617963 | 3300053085 | Bacteria | 741 |
| 697 | Ga0500646_0027972 | 3300053090 | Bacteria | 1537 |
| 698 | Ga0500583_0061412 | 3300053092 | Bacteria | 1774 |
| 699 | Ga0500566_0001201 | 3300053094 | Bacteria | 15142 |
| 700 | Ga0500641_0002974 | 3300053096 | Bacteria | 6001 |
| 701 | Ga0500554_098315 | 3300053102 | Bacteria | 977 |
| 702 | Ga0500572_004757 | 3300053111 | Bacteria | 3078 |
| 703 | Ga0500591_042842 | 3300053115 | Bacteria | 2147 |
| 704 | Ga0500594_0137635 | 3300053118 | Bacteria | 777 |
| 705 | Ga0500607_124196 | 3300053121 | Bacteria | 1243 |
| 706 | Ga0500642_0305205 | 3300053130 | Bacteria | 717 |
| 707 | Ga0500559_0042679 | 3300053136 | Bacteria | 1979 |
| 708 | Ga0500559_0133287 | 3300053136 | Bacteria | 1161 |
| 709 | Ga0500589_058991 | 3300053147 | Bacteria | 1762 |
| 710 | Ga0500603_001229 | 3300053150 | Bacteria | 5949 |
| 711 | Ga0500603_003328 | 3300053150 | Bacteria | 3456 |
| 712 | Ga0500604_0011901 | 3300053151 | Bacteria | 2344 |
| 713 | Ga0500627_0118260 | 3300053158 | Bacteria | 1195 |
| 714 | Ga0500630_047435 | 3300053159 | Bacteria | 2082 |
| 715 | Ga0500634_0099595 | 3300053161 | Bacteria | 1457 |
| 716 | Ga0500638_056238 | 3300053162 | Bacteria | 1895 |
| 717 | Ga0500639_002913 | 3300053163 | Bacteria | 8623 |
| 718 | Ga0500637_0048370 | 3300053178 | Bacteria | 2418 |
| 719 | Ga0500567_119427 | 3300053723 | Bacteria | 1055 |
| 720 | Ga0500611_065472 | 3300053727 | Bacteria | 872 |
| 721 | Ga0500645_015436 | 3300053730 | Bacteria | 2419 |
| 722 | Ga0500596_003108 | 3300053735 | Bacteria | 3192 |
| 723 | Ga0500601_001657 | 3300053737 | Bacteria | 2403 |
| 724 | Ga0501084_0018047 | 3300054114 | Bacteria | 5877 |
| 725 | Ga0501084_0347375 | 3300054114 | Bacteria | 1253 |
| 726 | Ga0501082_0011433 | 3300060353 | Bacteria | 7637 |
| 727 | Ga0466962_0036868 | 3300061719 | Bacteria | 2341 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2513237098 | 2513675042 | 152 |
| 2 | 3300025904 | Ga0207647_10317888 | Ga0207647_103178881 | 157 |
| 3 | 3300037312 | Ga0395899_0064309 | Ga0395899_0064309_1327_1899 | 157 |
| 4 | 3300037466 | Ga0395898_0129003 | Ga0395898_0129003_974_1546 | 157 |
| 5 | 3300038443 | Ga0395901_0270747 | Ga0395901_0270747_938_1510 | 157 |
| 6 | 3300049570 | Ga0501033_0554813 | Ga0501033_0554813_47_619 | 157 |
| 7 | 3300049579 | Ga0501043_0717479 | Ga0501043_0717479_135_707 | 157 |
| 8 | 3300049823 | Ga0501044_0276769 | Ga0501044_0276769_694_1266 | 157 |
| 9 | iso_pu_bacteria | 8056681323 | 8056687176 | 157 |
| 10 | 3300025981 | Ga0207640_10217350 | Ga0207640_102173502 | 159 |
| 11 | 3300026142 | Ga0207698_10551643 | Ga0207698_105516431 | 159 |
| 12 | 3300035113 | Ga0373936_0006488 | Ga0373936_0006488_2345_2917 | 159 |
| 13 | 3300035116 | Ga0373945_0009473 | Ga0373945_0009473_2482_3054 | 159 |
| 14 | 3300035117 | Ga0373953_0052366 | Ga0373953_0052366_896_1468 | 159 |
| 15 | 3300035171 | Ga0373946_0001985 | Ga0373946_0001985_4125_4697 | 159 |
| 16 | 3300035692 | Ga0373935_0000046 | Ga0373935_0000046_39292_39864 | 159 |
| 17 | 3300035695 | Ga0373927_0000209 | Ga0373927_0000209_27140_27712 | 159 |
| 18 | 3300035725 | Ga0373947_0002390 | Ga0373947_0002390_10405_10977 | 159 |
| 19 | 3300037068 | Ga0373925_0128019 | Ga0373925_0128019_163_735 | 159 |
| 20 | 3300046454 | Ga0495592_0051355 | Ga0495592_0051355_1252_1824 | 159 |
| 21 | 3300046455 | Ga0495603_0000259 | Ga0495603_0000259_8332_8904 | 159 |
| 22 | 3300046459 | Ga0495629_0002432 | Ga0495629_0002432_2710_3282 | 159 |
| 23 | 3300046461 | Ga0495641_0002618 | Ga0495641_0002618_11561_12133 | 159 |
| 24 | 3300046463 | Ga0495653_0026125 | Ga0495653_0026125_1002_1574 | 159 |
| 25 | 3300046472 | Ga0495580_0003494 | Ga0495580_0003494_1390_1962 | 159 |
| 26 | 3300046473 | Ga0495582_0000486 | Ga0495582_0000486_295_867 | 159 |
| 27 | 3300046475 | Ga0495639_0000862 | Ga0495639_0000862_10076_10648 | 159 |
| 28 | 3300046476 | Ga0495662_0001965 | Ga0495662_0001965_3909_4481 | 159 |
| 29 | 3300046477 | Ga0495664_0029399 | Ga0495664_0029399_1819_2391 | 159 |
| 30 | 3300046499 | Ga0495594_0002058 | Ga0495594_0002058_6892_7464 | 159 |
| 31 | 3300046517 | Ga0495630_0003436 | Ga0495630_0003436_10197_10769 | 159 |
| 32 | 3300046526 | Ga0495666_0013538 | Ga0495666_0013538_297_869 | 159 |
| 33 | 3300046531 | Ga0495665_0000311 | Ga0495665_0000311_9750_10322 | 159 |
| 34 | 3300046533 | Ga0495640_0035491 | Ga0495640_0035491_985_1557 | 159 |
| 35 | 3300046557 | Ga0495622_0002639 | Ga0495622_0002639_3254_3826 | 159 |
| 36 | 3300046559 | Ga0495667_0037997 | Ga0495667_0037997_2248_2820 | 159 |
| 37 | 3300046642 | Ga0495634_0001829 | Ga0495634_0001829_3234_3806 | 159 |
| 38 | 3300046663 | Ga0495635_0002849 | Ga0495635_0002849_5749_6321 | 159 |
| 39 | 3300046678 | Ga0495599_0059544 | Ga0495599_0059544_871_1443 | 159 |
| 40 | 3300046679 | Ga0495623_0201202 | Ga0495623_0201202_388_960 | 159 |
| 41 | 3300046680 | Ga0495646_0027225 | Ga0495646_0027225_1801_2373 | 159 |
| 42 | 3300046681 | Ga0495647_0000389 | Ga0495647_0000389_11005_11577 | 159 |
| 43 | 3300046689 | Ga0495613_0009884 | Ga0495613_0009884_3590_4162 | 159 |
| 44 | 3300046690 | Ga0495624_0000622 | Ga0495624_0000622_18395_18967 | 159 |
| 45 | 3300046809 | Ga0495600_0308079 | Ga0495600_0308079_184_756 | 159 |
| 46 | 3300047315 | Ga0495581_0003143 | Ga0495581_0003143_2931_3503 | 159 |
| 47 | 3300047319 | Ga0495674_0001665 | Ga0495674_0001665_2794_3366 | 159 |
| 48 | 3300047322 | Ga0495680_0071033 | Ga0495680_0071033_2006_2578 | 159 |
| 49 | 3300047471 | Ga0495684_0024969 | Ga0495684_0024969_3993_4565 | 159 |
| 50 | 3300047673 | Ga0495593_0000007 | Ga0495593_0000007_67974_68546 | 159 |
| 51 | 3300048089 | Ga0495614_0012905 | Ga0495614_0012905_573_1145 | 159 |
| 52 | 3300053078 | Ga0495612_0307461 | Ga0495612_0307461_36_608 | 159 |
| 53 | 3300053085 | Ga0495619_0067243 | Ga0495619_0067243_507_1079 | 159 |
| 54 | 3300041452 | Ga0451793_0130578 | Ga0451793_0130578_26_619 | 160 |
| 55 | iso_pu_bacteria | 2904690495 | 2904691091 | 160 |
| 56 | iso_pu_bacteria | 2908756301 | 2908756485 | 160 |
| 57 | 3300009177 | Ga0105248_10491871 | Ga0105248_104918712 | 161 |
| 58 | 3300013296 | Ga0157374_10980821 | Ga0157374_109808211 | 161 |
| 59 | 3300048922 | Ga0496119_0132290 | Ga0496119_0132290_319_891 | 161 |
| 60 | iso_pu_bacteria | 2824773399 | 2824779787 | 162 |
| 61 | 3300005548 | Ga0070665_100249049 | Ga0070665_1002490492 | 163 |
| 62 | 3300005844 | Ga0068862_100145341 | Ga0068862_1001453412 | 163 |
| 63 | 3300026023 | Ga0207677_10167246 | Ga0207677_101672461 | 163 |
| 64 | 3300028381 | Ga0268264_10181539 | Ga0268264_101815392 | 163 |
| 65 | 3300046678 | Ga0495599_0044545 | Ga0495599_0044545_355_1029 | 163 |
| 66 | 3300053078 | Ga0495612_0024077 | Ga0495612_0024077_1135_1779 | 163 |
| 67 | 3300049581 | Ga0501047_0887080 | Ga0501047_0887080_35_568 | 164 |
| 68 | 3300049741 | Ga0501079_0348167 | Ga0501079_0348167_266_853 | 164 |
| 69 | 3300053121 | Ga0500607_124196 | Ga0500607_124196_383_952 | 164 |
| 70 | 3300053178 | Ga0500637_0048370 | Ga0500637_0048370_1734_2384 | 164 |
| 71 | 3300006173 | Ga0070716_100426178 | Ga0070716_1004261781 | 165 |
| 72 | 3300025917 | Ga0207660_10161006 | Ga0207660_101610061 | 165 |
| 73 | 3300035089 | Ga0373944_0016469 | Ga0373944_0016469_1005_1640 | 165 |
| 74 | 3300047320 | Ga0495672_0015332 | Ga0495672_0015332_3613_4188 | 165 |
| 75 | 3300048903 | Ga0496100_0828050 | Ga0496100_0828050_32_640 | 165 |
| 76 | 3300046660 | Ga0495625_0249331 | Ga0495625_0249331_160_810 | 166 |
| 77 | 3300035091 | Ga0373951_0079506 | Ga0373951_0079506_14_607 | 167 |
| 78 | 3300048916 | Ga0496113_0220280 | Ga0496113_0220280_591_1232 | 167 |
| 79 | 3300009174 | Ga0105241_10323502 | Ga0105241_103235022 | 168 |
| 80 | 3300009177 | Ga0105248_10227154 | Ga0105248_102271542 | 168 |
| 81 | 3300010375 | Ga0105239_10048539 | Ga0105239_100485392 | 168 |
| 82 | 3300021320 | Ga0214544_1000016 | Ga0214544_100001672 | 168 |
| 83 | 3300021321 | Ga0214542_1000016 | Ga0214542_1000016130 | 168 |
| 84 | 3300021324 | Ga0214545_1000008 | Ga0214545_1000008136 | 168 |
| 85 | 3300021327 | Ga0214543_1000043 | Ga0214543_100004386 | 168 |
| 86 | 3300030763 | Ga0265763_1018696 | Ga0265763_10186961 | 168 |
| 87 | 3300034816 | Ga0373930_0010827 | Ga0373930_0010827_705_1346 | 168 |
| 88 | 3300034817 | Ga0373948_0027421 | Ga0373948_0027421_382_1023 | 168 |
| 89 | 3300034820 | Ga0373959_0072765 | Ga0373959_0072765_38_679 | 168 |
| 90 | 3300035084 | Ga0373928_0033945 | Ga0373928_0033945_203_844 | 168 |
| 91 | 3300035091 | Ga0373951_0047821 | Ga0373951_0047821_80_721 | 168 |
| 92 | 3300035092 | Ga0373952_0017696 | Ga0373952_0017696_163_804 | 168 |
| 93 | 3300035112 | Ga0373932_0134792 | Ga0373932_0134792_155_796 | 168 |
| 94 | 3300035207 | Ga0373942_0012242 | Ga0373942_0012242_893_1534 | 168 |
| 95 | 3300048904 | Ga0496101_0134723 | Ga0496101_0134723_957_1598 | 168 |
| 96 | 3300048905 | Ga0496102_0156343 | Ga0496102_0156343_941_1582 | 168 |
| 97 | 3300048907 | Ga0496104_0035278 | Ga0496104_0035278_897_1538 | 168 |
| 98 | 3300048908 | Ga0496105_0152995 | Ga0496105_0152995_556_1197 | 168 |
| 99 | 3300048909 | Ga0496106_0050023 | Ga0496106_0050023_2017_2658 | 168 |
| 100 | 3300048910 | Ga0496107_0055526 | Ga0496107_0055526_1925_2566 | 168 |
| 101 | 3300048911 | Ga0496108_0236997 | Ga0496108_0236997_120_761 | 168 |
| 102 | 3300048913 | Ga0496110_0054316 | Ga0496110_0054316_1973_2614 | 168 |
| 103 | 3300048914 | Ga0496111_0114108 | Ga0496111_0114108_725_1366 | 168 |
| 104 | 3300048915 | Ga0496112_0242050 | Ga0496112_0242050_246_887 | 168 |
| 105 | 3300048917 | Ga0496114_0025578 | Ga0496114_0025578_1110_1751 | 168 |
| 106 | 3300048918 | Ga0496115_0104691 | Ga0496115_0104691_687_1328 | 168 |
| 107 | 3300053077 | Ga0495601_0044175 | Ga0495601_0044175_2073_2696 | 168 |
| 108 | 3300053083 | Ga0495655_0121695 | Ga0495655_0121695_139_756 | 168 |
| 109 | 3300053158 | Ga0500627_0118260 | Ga0500627_0118260_231_854 | 168 |
| 110 | 3300005439 | Ga0070711_100008899 | Ga0070711_1000088995 | 169 |
| 111 | 3300005844 | Ga0068862_100588853 | Ga0068862_1005888532 | 169 |
| 112 | 3300006028 | Ga0070717_10082702 | Ga0070717_100827022 | 169 |
| 113 | 3300025972 | Ga0207668_10600198 | Ga0207668_106001981 | 169 |
| 114 | 3300031456 | Ga0307513_10113448 | Ga0307513_101134481 | 169 |
| 115 | 3300035172 | Ga0373955_0270636 | Ga0373955_0270636_376_942 | 169 |
| 116 | 3300036401 | Ga0373937_0270653 | Ga0373937_0270653_207_773 | 169 |
| 117 | 3300044706 | Ga0466964_0034844 | Ga0466964_0034844_504_1166 | 169 |
| 118 | 3300046507 | Ga0495606_0207676 | Ga0495606_0207676_26_661 | 169 |
| 119 | 3300046511 | Ga0495608_0013574 | Ga0495608_0013574_4288_4854 | 169 |
| 120 | 3300046533 | Ga0495640_0358015 | Ga0495640_0358015_147_761 | 169 |
| 121 | 3300047315 | Ga0495581_0190372 | Ga0495581_0190372_348_962 | 169 |
| 122 | 3300047321 | Ga0495676_0242944 | Ga0495676_0242944_82_726 | 169 |
| 123 | 3300047469 | Ga0495673_0056055 | Ga0495673_0056055_922_1530 | 169 |
| 124 | 3300048928 | Ga0496125_0000516 | Ga0496125_0000516_24703_25344 | 169 |
| 125 | 3300005336 | Ga0070680_100017817 | Ga0070680_1000178175 | 170 |
| 126 | 3300009177 | Ga0105248_10560242 | Ga0105248_105602421 | 170 |
| 127 | 3300009545 | Ga0105237_10556846 | Ga0105237_105568461 | 170 |
| 128 | 3300010159 | Ga0099796_10116095 | Ga0099796_101160951 | 170 |
| 129 | 3300010375 | Ga0105239_10403686 | Ga0105239_104036862 | 170 |
| 130 | 3300014325 | Ga0163163_10052545 | Ga0163163_100525452 | 170 |
| 131 | 3300014968 | Ga0157379_10047548 | Ga0157379_100475483 | 170 |
| 132 | 3300025986 | Ga0207658_10147477 | Ga0207658_101474772 | 170 |
| 133 | 3300035691 | Ga0373931_0039790 | Ga0373931_0039790_1730_2317 | 170 |
| 134 | 3300038443 | Ga0395901_0078214 | Ga0395901_0078214_847_1509 | 170 |
| 135 | 3300046455 | Ga0495603_0041656 | Ga0495603_0041656_1124_1720 | 170 |
| 136 | 3300047445 | Ga0495677_0053716 | Ga0495677_0053716_197_841 | 170 |
| 137 | 3300047446 | Ga0495679_049955 | Ga0495679_049955_480_1124 | 170 |
| 138 | 3300048905 | Ga0496102_0185750 | Ga0496102_0185750_1045_1632 | 170 |
| 139 | 3300048907 | Ga0496104_0024983 | Ga0496104_0024983_2105_2692 | 170 |
| 140 | 3300048908 | Ga0496105_0089112 | Ga0496105_0089112_1682_2269 | 170 |
| 141 | 3300048909 | Ga0496106_0097281 | Ga0496106_0097281_1621_2208 | 170 |
| 142 | 3300048911 | Ga0496108_0191328 | Ga0496108_0191328_672_1259 | 170 |
| 143 | 3300048912 | Ga0496109_0273723 | Ga0496109_0273723_400_987 | 170 |
| 144 | 3300048914 | Ga0496111_0273228 | Ga0496111_0273228_564_1151 | 170 |
| 145 | 3300048915 | Ga0496112_0018177 | Ga0496112_0018177_4583_5170 | 170 |
| 146 | 3300048916 | Ga0496113_0055405 | Ga0496113_0055405_1328_1915 | 170 |
| 147 | 3300048918 | Ga0496115_0190455 | Ga0496115_0190455_405_992 | 170 |
| 148 | 3300048921 | Ga0496118_0114421 | Ga0496118_0114421_96_740 | 170 |
| 149 | 3300048923 | Ga0496120_0028338 | Ga0496120_0028338_2067_2681 | 170 |
| 150 | 3300048929 | Ga0496126_0009932 | Ga0496126_0009932_7115_7759 | 170 |
| 151 | 3300053080 | Ga0500635_0020934 | Ga0500635_0020934_578_1174 | 170 |
| 152 | 3300053102 | Ga0500554_098315 | Ga0500554_098315_65_661 | 170 |
| 153 | 3300053150 | Ga0500603_001229 | Ga0500603_001229_865_1461 | 170 |
| 154 | 3300003215 | JGI25153J46596_10004214 | JGI25153J46596_100042144 | 171 |
| 155 | 3300005344 | Ga0070661_100206410 | Ga0070661_1002064102 | 171 |
| 156 | 3300005441 | Ga0070700_100445948 | Ga0070700_1004459481 | 171 |
| 157 | 3300005577 | Ga0068857_100024046 | Ga0068857_1000240465 | 171 |
| 158 | 3300005834 | Ga0068851_10048225 | Ga0068851_100482252 | 171 |
| 159 | 3300007788 | Ga0099795_10042024 | Ga0099795_100420242 | 171 |
| 160 | 3300009093 | Ga0105240_10011557 | Ga0105240_100115571 | 171 |
| 161 | 3300009177 | Ga0105248_10085942 | Ga0105248_100859422 | 171 |
| 162 | 3300009545 | Ga0105237_10028299 | Ga0105237_100282991 | 171 |
| 163 | 3300009545 | Ga0105237_10093189 | Ga0105237_100931892 | 171 |
| 164 | 3300009551 | Ga0105238_10000767 | Ga0105238_100007679 | 171 |
| 165 | 3300013104 | Ga0157370_10011199 | Ga0157370_100111998 | 171 |
| 166 | 3300013105 | Ga0157369_10014719 | Ga0157369_100147193 | 171 |
| 167 | 3300025297 | Ga0209758_1005787 | Ga0209758_10057876 | 171 |
| 168 | 3300025321 | Ga0207656_10069669 | Ga0207656_100696691 | 171 |
| 169 | 3300025909 | Ga0207705_10136184 | Ga0207705_101361841 | 171 |
| 170 | 3300025919 | Ga0207657_10057982 | Ga0207657_100579823 | 171 |
| 171 | 3300025919 | Ga0207657_10180129 | Ga0207657_101801292 | 171 |
| 172 | 3300025920 | Ga0207649_10273327 | Ga0207649_102733272 | 171 |
| 173 | 3300025932 | Ga0207690_10315214 | Ga0207690_103152141 | 171 |
| 174 | 3300025944 | Ga0207661_10039324 | Ga0207661_100393241 | 171 |
| 175 | 3300026142 | Ga0207698_10419681 | Ga0207698_104196812 | 171 |
| 176 | 3300035695 | Ga0373927_0018902 | Ga0373927_0018902_114_710 | 171 |
| 177 | 3300046689 | Ga0495613_0281743 | Ga0495613_0281743_12_608 | 171 |
| 178 | 3300048905 | Ga0496102_0612127 | Ga0496102_0612127_11_658 | 171 |
| 179 | 3300048907 | Ga0496104_0206984 | Ga0496104_0206984_222_869 | 171 |
| 180 | 3300048915 | Ga0496112_0116195 | Ga0496112_0116195_1816_2463 | 171 |
| 181 | 3300048916 | Ga0496113_0256439 | Ga0496113_0256439_536_1183 | 171 |
| 182 | 3300048924 | Ga0496121_0359293 | Ga0496121_0359293_278_931 | 171 |
| 183 | 3300048929 | Ga0496126_0435123 | Ga0496126_0435123_110_763 | 171 |
| 184 | 3300050493 | nmdc:mga0k408_306478_c1 | nmdc:mga0k408_306478_c1_189_857 | 171 |
| 185 | 3300050493 | nmdc:mga0k408_48368_c1 | nmdc:mga0k408_48368_c1_1713_2360 | 171 |
| 186 | 3300050494 | nmdc:mga06z11_78524_c1 | nmdc:mga06z11_78524_c1_328_975 | 171 |
| 187 | 3300050512 | nmdc:mga0n895_109171_c1 | nmdc:mga0n895_109171_c1_1515_2162 | 171 |
| 188 | 3300050516 | nmdc:mga0sz30_134437_c1 | nmdc:mga0sz30_134437_c1_224_871 | 171 |
| 189 | 3300005468 | Ga0070707_100567640 | Ga0070707_1005676401 | 172 |
| 190 | 3300005618 | Ga0068864_100152522 | Ga0068864_1001525222 | 172 |
| 191 | 3300005718 | Ga0068866_10148146 | Ga0068866_101481461 | 172 |
| 192 | 3300005843 | Ga0068860_100251412 | Ga0068860_1002514121 | 172 |
| 193 | 3300009098 | Ga0105245_10117167 | Ga0105245_101171672 | 172 |
| 194 | 3300009101 | Ga0105247_10200160 | Ga0105247_102001601 | 172 |
| 195 | 3300009174 | Ga0105241_10797878 | Ga0105241_107978781 | 172 |
| 196 | 3300009551 | Ga0105238_10229005 | Ga0105238_102290052 | 172 |
| 197 | 3300009553 | Ga0105249_10344301 | Ga0105249_103443012 | 172 |
| 198 | 3300010375 | Ga0105239_10440587 | Ga0105239_104405872 | 172 |
| 199 | 3300010375 | Ga0105239_10609964 | Ga0105239_106099642 | 172 |
| 200 | 3300014969 | Ga0157376_10447832 | Ga0157376_104478321 | 172 |
| 201 | 3300025942 | Ga0207689_10124484 | Ga0207689_101244844 | 172 |
| 202 | 3300026116 | Ga0207674_10466219 | Ga0207674_104662192 | 172 |
| 203 | 3300028380 | Ga0268265_10203958 | Ga0268265_102039582 | 172 |
| 204 | 3300028381 | Ga0268264_10206815 | Ga0268264_102068151 | 172 |
| 205 | 3300031901 | Ga0307406_10954488 | Ga0307406_109544881 | 172 |
| 206 | 3300035695 | Ga0373927_0056990 | Ga0373927_0056990_626_1249 | 172 |
| 207 | 3300041413 | Ga0439465_0029497 | Ga0439465_0029497_712_1356 | 172 |
| 208 | 3300046616 | Ga0495668_0405584 | Ga0495668_0405584_63_692 | 172 |
| 209 | 3300046674 | Ga0495588_0213103 | Ga0495588_0213103_127_783 | 172 |
| 210 | 3300048912 | Ga0496109_0024467 | Ga0496109_0024467_4407_5054 | 172 |
| 211 | 3300048919 | Ga0496116_0272092 | Ga0496116_0272092_53_682 | 172 |
| 212 | 3300048928 | Ga0496125_0067862 | Ga0496125_0067862_384_1037 | 172 |
| 213 | 3300001989 | JGI24739J22299_10003081 | JGI24739J22299_100030815 | 173 |
| 214 | 3300001990 | JGI24737J22298_10001562 | JGI24737J22298_100015626 | 173 |
| 215 | 3300005334 | Ga0068869_100140325 | Ga0068869_1001403251 | 173 |
| 216 | 3300005339 | Ga0070660_100205647 | Ga0070660_1002056472 | 173 |
| 217 | 3300005577 | Ga0068857_100072529 | Ga0068857_1000725293 | 173 |
| 218 | 3300005615 | Ga0070702_100087640 | Ga0070702_1000876402 | 173 |
| 219 | 3300005616 | Ga0068852_100269226 | Ga0068852_1002692262 | 173 |
| 220 | 3300005618 | Ga0068864_100259304 | Ga0068864_1002593041 | 173 |
| 221 | 3300005937 | Ga0081455_10161849 | Ga0081455_101618491 | 173 |
| 222 | 3300006038 | Ga0075365_10052404 | Ga0075365_100524043 | 173 |
| 223 | 3300006048 | Ga0075363_100302289 | Ga0075363_1003022892 | 173 |
| 224 | 3300006175 | Ga0070712_100012707 | Ga0070712_1000127072 | 173 |
| 225 | 3300006177 | Ga0075362_10031828 | Ga0075362_100318283 | 173 |
| 226 | 3300006178 | Ga0075367_10146480 | Ga0075367_101464802 | 173 |
| 227 | 3300006195 | Ga0075366_10192574 | Ga0075366_101925742 | 173 |
| 228 | 3300006353 | Ga0075370_10131120 | Ga0075370_101311202 | 173 |
| 229 | 3300006871 | Ga0075434_100058879 | Ga0075434_1000588794 | 173 |
| 230 | 3300010375 | Ga0105239_10534742 | Ga0105239_105347422 | 173 |
| 231 | 3300025901 | Ga0207688_10023383 | Ga0207688_100233832 | 173 |
| 232 | 3300025906 | Ga0207699_10018399 | Ga0207699_100183993 | 173 |
| 233 | 3300025912 | Ga0207707_10084648 | Ga0207707_100846482 | 173 |
| 234 | 3300025915 | Ga0207693_10017779 | Ga0207693_100177795 | 173 |
| 235 | 3300025938 | Ga0207704_10780522 | Ga0207704_107805221 | 173 |
| 236 | 3300025939 | Ga0207665_10161046 | Ga0207665_101610461 | 173 |
| 237 | 3300025940 | Ga0207691_10171660 | Ga0207691_101716602 | 173 |
| 238 | 3300025942 | Ga0207689_10010002 | Ga0207689_100100025 | 173 |
| 239 | 3300026067 | Ga0207678_10129958 | Ga0207678_101299582 | 173 |
| 240 | 3300026095 | Ga0207676_10694248 | Ga0207676_106942481 | 173 |
| 241 | 3300026116 | Ga0207674_10043166 | Ga0207674_100431663 | 173 |
| 242 | 3300026118 | Ga0207675_100327350 | Ga0207675_1003273502 | 173 |
| 243 | 3300026121 | Ga0207683_10470225 | Ga0207683_104702252 | 173 |
| 244 | 3300027866 | Ga0209813_10019215 | Ga0209813_100192151 | 173 |
| 245 | 3300028379 | Ga0268266_11166968 | Ga0268266_111669681 | 173 |
| 246 | 3300031250 | Ga0265331_10041531 | Ga0265331_100415311 | 173 |
| 247 | 3300031711 | Ga0265314_10210176 | Ga0265314_102101761 | 173 |
| 248 | 3300031731 | Ga0307405_10241089 | Ga0307405_102410892 | 173 |
| 249 | 3300031901 | Ga0307406_10248410 | Ga0307406_102484102 | 173 |
| 250 | 3300031903 | Ga0307407_10334716 | Ga0307407_103347162 | 173 |
| 251 | 3300032002 | Ga0307416_100974368 | Ga0307416_1009743682 | 173 |
| 252 | 3300044735 | Ga0466968_0004513 | Ga0466968_0004513_3401_4045 | 173 |
| 253 | 3300046477 | Ga0495664_0337075 | Ga0495664_0337075_271_852 | 173 |
| 254 | 3300048927 | Ga0496124_0233967 | Ga0496124_0233967_640_1281 | 173 |
| 255 | 3300048929 | Ga0496126_0057284 | Ga0496126_0057284_1892_2473 | 173 |
| 256 | 3300050489 | nmdc:mga03683_188437_c1 | nmdc:mga03683_188437_c1_29_682 | 173 |
| 257 | 3300050513 | nmdc:mga0rr50_272004_c1 | nmdc:mga0rr50_272004_c1_186_839 | 173 |
| 258 | 3300053096 | Ga0500641_0002974 | Ga0500641_0002974_4600_5256 | 173 |
| 259 | 3300053118 | Ga0500594_0137635 | Ga0500594_0137635_15_671 | 173 |
| 260 | 3300053147 | Ga0500589_058991 | Ga0500589_058991_388_1044 | 173 |
| 261 | 3300053151 | Ga0500604_0011901 | Ga0500604_0011901_1383_2045 | 173 |
| 262 | iso_pu_bacteria | 2889033259 | 2889035386 | 173 |
| 263 | 3300003659 | JGI25404J52841_10006328 | JGI25404J52841_100063282 | 174 |
| 264 | 3300003659 | JGI25404J52841_10017978 | JGI25404J52841_100179781 | 174 |
| 265 | 3300005338 | Ga0068868_100022449 | Ga0068868_1000224492 | 174 |
| 266 | 3300005344 | Ga0070661_100130039 | Ga0070661_1001300392 | 174 |
| 267 | 3300005347 | Ga0070668_100024015 | Ga0070668_1000240154 | 174 |
| 268 | 3300005347 | Ga0070668_101030544 | Ga0070668_1010305441 | 174 |
| 269 | 3300005355 | Ga0070671_100130971 | Ga0070671_1001309712 | 174 |
| 270 | 3300005364 | Ga0070673_100109913 | Ga0070673_1001099132 | 174 |
| 271 | 3300005366 | Ga0070659_100223559 | Ga0070659_1002235591 | 174 |
| 272 | 3300005441 | Ga0070700_100307384 | Ga0070700_1003073842 | 174 |
| 273 | 3300005455 | Ga0070663_100129104 | Ga0070663_1001291042 | 174 |
| 274 | 3300005456 | Ga0070678_100482853 | Ga0070678_1004828531 | 174 |
| 275 | 3300005471 | Ga0070698_100330834 | Ga0070698_1003308342 | 174 |
| 276 | 3300005543 | Ga0070672_100066280 | Ga0070672_1000662802 | 174 |
| 277 | 3300005547 | Ga0070693_100040877 | Ga0070693_1000408772 | 174 |
| 278 | 3300005548 | Ga0070665_100232811 | Ga0070665_1002328112 | 174 |
| 279 | 3300005564 | Ga0070664_100238571 | Ga0070664_1002385712 | 174 |
| 280 | 3300005614 | Ga0068856_100023911 | Ga0068856_1000239113 | 174 |
| 281 | 3300005841 | Ga0068863_100395831 | Ga0068863_1003958312 | 174 |
| 282 | 3300005842 | Ga0068858_100062483 | Ga0068858_1000624834 | 174 |
| 283 | 3300005843 | Ga0068860_100224696 | Ga0068860_1002246961 | 174 |
| 284 | 3300005983 | Ga0081540_1001674 | Ga0081540_100167412 | 174 |
| 285 | 3300005983 | Ga0081540_1002221 | Ga0081540_100222112 | 174 |
| 286 | 3300006353 | Ga0075370_10158511 | Ga0075370_101585111 | 174 |
| 287 | 3300009147 | Ga0114129_10415165 | Ga0114129_104151652 | 174 |
| 288 | 3300011119 | Ga0105246_10291370 | Ga0105246_102913702 | 174 |
| 289 | 3300014326 | Ga0157380_10573375 | Ga0157380_105733752 | 174 |
| 290 | 3300025893 | Ga0207682_10190194 | Ga0207682_101901941 | 174 |
| 291 | 3300025911 | Ga0207654_10104095 | Ga0207654_101040951 | 174 |
| 292 | 3300025914 | Ga0207671_10579235 | Ga0207671_105792351 | 174 |
| 293 | 3300025923 | Ga0207681_10467722 | Ga0207681_104677222 | 174 |
| 294 | 3300025924 | Ga0207694_10266493 | Ga0207694_102664932 | 174 |
| 295 | 3300025927 | Ga0207687_10016378 | Ga0207687_100163782 | 174 |
| 296 | 3300025945 | Ga0207679_10830377 | Ga0207679_108303771 | 174 |
| 297 | 3300025981 | Ga0207640_10016790 | Ga0207640_100167905 | 174 |
| 298 | 3300026067 | Ga0207678_10088296 | Ga0207678_100882962 | 174 |
| 299 | 3300026075 | Ga0207708_10227305 | Ga0207708_102273052 | 174 |
| 300 | 3300026078 | Ga0207702_10060716 | Ga0207702_100607163 | 174 |
| 301 | 3300026088 | Ga0207641_10195997 | Ga0207641_101959971 | 174 |
| 302 | 3300028379 | Ga0268266_10015017 | Ga0268266_100150174 | 174 |
| 303 | 3300028380 | Ga0268265_10920568 | Ga0268265_109205681 | 174 |
| 304 | 3300028381 | Ga0268264_10275684 | Ga0268264_102756842 | 174 |
| 305 | 3300032126 | Ga0307415_100390794 | Ga0307415_1003907942 | 174 |
| 306 | 3300035724 | Ga0373933_0344625 | Ga0373933_0344625_288_869 | 174 |
| 307 | 3300044719 | Ga0466971_0209137 | Ga0466971_0209137_150_770 | 174 |
| 308 | 3300045049 | Ga0466959_0313446 | Ga0466959_0313446_427_1047 | 174 |
| 309 | 3300046455 | Ga0495603_0008575 | Ga0495603_0008575_2926_3582 | 174 |
| 310 | 3300046517 | Ga0495630_0027345 | Ga0495630_0027345_2067_2648 | 174 |
| 311 | 3300046525 | Ga0495663_0016702 | Ga0495663_0016702_1257_1886 | 174 |
| 312 | 3300046680 | Ga0495646_0089061 | Ga0495646_0089061_922_1503 | 174 |
| 313 | 3300047315 | Ga0495581_0071475 | Ga0495581_0071475_1062_1691 | 174 |
| 314 | 3300047470 | Ga0495681_0168542 | Ga0495681_0168542_56_685 | 174 |
| 315 | 3300048903 | Ga0496100_0791650 | Ga0496100_0791650_36_671 | 174 |
| 316 | 3300048905 | Ga0496102_0323693 | Ga0496102_0323693_609_1244 | 174 |
| 317 | 3300049568 | Ga0501031_0064221 | Ga0501031_0064221_181_804 | 174 |
| 318 | 3300049570 | Ga0501033_0021023 | Ga0501033_0021023_2520_3143 | 174 |
| 319 | 3300049573 | Ga0501037_0299472 | Ga0501037_0299472_169_792 | 174 |
| 320 | 3300049581 | Ga0501047_0153240 | Ga0501047_0153240_124_747 | 174 |
| 321 | 3300049586 | Ga0501070_0050622 | Ga0501070_0050622_2571_3194 | 174 |
| 322 | 3300049823 | Ga0501044_0035648 | Ga0501044_0035648_2120_2743 | 174 |
| 323 | 3300050489 | nmdc:mga03683_780_c1 | nmdc:mga03683_780_c1_619_1272 | 174 |
| 324 | 3300050491 | nmdc:mga00v17_566533_c1 | nmdc:mga00v17_566533_c1_25_654 | 174 |
| 325 | 3300050492 | nmdc:mga0yw44_899_c1 | nmdc:mga0yw44_899_c1_9671_10324 | 174 |
| 326 | 3300050493 | nmdc:mga0k408_61833_c1 | nmdc:mga0k408_61833_c1_493_1146 | 174 |
| 327 | 3300050494 | nmdc:mga06z11_150109_c1 | nmdc:mga06z11_150109_c1_386_1039 | 174 |
| 328 | 3300050507 | nmdc:mga05p37_249646_c1 | nmdc:mga05p37_249646_c1_703_1356 | 174 |
| 329 | 3300050507 | nmdc:mga05p37_764282_c1 | nmdc:mga05p37_764282_c1_311_970 | 174 |
| 330 | 3300050508 | nmdc:mga09592_636951_c1 | nmdc:mga09592_636951_c1_203_856 | 174 |
| 331 | 3300050516 | nmdc:mga0sz30_3901_c1 | nmdc:mga0sz30_3901_c1_906_1559 | 174 |
| 332 | 3300053723 | Ga0500567_119427 | Ga0500567_119427_313_927 | 174 |
| 333 | 3300005329 | Ga0070683_100016037 | Ga0070683_1000160373 | 175 |
| 334 | 3300005336 | Ga0070680_100188278 | Ga0070680_1001882782 | 175 |
| 335 | 3300005340 | Ga0070689_100174326 | Ga0070689_1001743262 | 175 |
| 336 | 3300005436 | Ga0070713_100499101 | Ga0070713_1004991012 | 175 |
| 337 | 3300005441 | Ga0070700_100457295 | Ga0070700_1004572951 | 175 |
| 338 | 3300005458 | Ga0070681_10074024 | Ga0070681_100740243 | 175 |
| 339 | 3300005471 | Ga0070698_100204644 | Ga0070698_1002046442 | 175 |
| 340 | 3300005535 | Ga0070684_100011123 | Ga0070684_1000111235 | 175 |
| 341 | 3300005536 | Ga0070697_100199038 | Ga0070697_1001990382 | 175 |
| 342 | 3300005544 | Ga0070686_100575021 | Ga0070686_1005750211 | 175 |
| 343 | 3300005614 | Ga0068856_100463424 | Ga0068856_1004634242 | 175 |
| 344 | 3300005617 | Ga0068859_100509805 | Ga0068859_1005098052 | 175 |
| 345 | 3300005618 | Ga0068864_100066634 | Ga0068864_1000666344 | 175 |
| 346 | 3300005841 | Ga0068863_100536006 | Ga0068863_1005360062 | 175 |
| 347 | 3300005937 | Ga0081455_10028194 | Ga0081455_100281945 | 175 |
| 348 | 3300006177 | Ga0075362_10124023 | Ga0075362_101240232 | 175 |
| 349 | 3300006186 | Ga0075369_10103416 | Ga0075369_101034161 | 175 |
| 350 | 3300006931 | Ga0097620_100509836 | Ga0097620_1005098362 | 175 |
| 351 | 3300009177 | Ga0105248_10228366 | Ga0105248_102283662 | 175 |
| 352 | 3300009177 | Ga0105248_10537052 | Ga0105248_105370522 | 175 |
| 353 | 3300014325 | Ga0163163_10194775 | Ga0163163_101947752 | 175 |
| 354 | 3300014968 | Ga0157379_10111976 | Ga0157379_101119762 | 175 |
| 355 | 3300014968 | Ga0157379_10745312 | Ga0157379_107453121 | 175 |
| 356 | 3300025906 | Ga0207699_10494027 | Ga0207699_104940271 | 175 |
| 357 | 3300025919 | Ga0207657_10328153 | Ga0207657_103281532 | 175 |
| 358 | 3300025929 | Ga0207664_10933610 | Ga0207664_109336101 | 175 |
| 359 | 3300025941 | Ga0207711_10254616 | Ga0207711_102546162 | 175 |
| 360 | 3300025944 | Ga0207661_10001081 | Ga0207661_100010816 | 175 |
| 361 | 3300026088 | Ga0207641_10474214 | Ga0207641_104742142 | 175 |
| 362 | 3300026095 | Ga0207676_10053412 | Ga0207676_100534122 | 175 |
| 363 | 3300032002 | Ga0307416_100137467 | Ga0307416_1001374672 | 175 |
| 364 | 3300032126 | Ga0307415_100102777 | Ga0307415_1001027773 | 175 |
| 365 | 3300035086 | Ga0373934_0071200 | Ga0373934_0071200_369_1010 | 175 |
| 366 | 3300035695 | Ga0373927_0326902 | Ga0373927_0326902_41_670 | 175 |
| 367 | 3300037418 | Ga0395900_0399889 | Ga0395900_0399889_674_1279 | 175 |
| 368 | 3300037466 | Ga0395898_0136817 | Ga0395898_0136817_555_1160 | 175 |
| 369 | 3300038443 | Ga0395901_0055054 | Ga0395901_0055054_2994_3599 | 175 |
| 370 | 3300045976 | Ga0466967_0230370 | Ga0466967_0230370_892_1527 | 175 |
| 371 | 3300046539 | Ga0495621_0018370 | Ga0495621_0018370_1228_1857 | 175 |
| 372 | 3300046691 | Ga0495670_0215813 | Ga0495670_0215813_310_939 | 175 |
| 373 | 3300048905 | Ga0496102_0966195 | Ga0496102_0966195_102_698 | 175 |
| 374 | 3300048907 | Ga0496104_0074642 | Ga0496104_0074642_1543_2172 | 175 |
| 375 | 3300048908 | Ga0496105_0097528 | Ga0496105_0097528_911_1540 | 175 |
| 376 | 3300048909 | Ga0496106_0059255 | Ga0496106_0059255_1171_1800 | 175 |
| 377 | 3300048909 | Ga0496106_0607019 | Ga0496106_0607019_55_651 | 175 |
| 378 | 3300048913 | Ga0496110_0247840 | Ga0496110_0247840_223_819 | 175 |
| 379 | 3300048915 | Ga0496112_0063564 | Ga0496112_0063564_1764_2360 | 175 |
| 380 | 3300048921 | Ga0496118_0094094 | Ga0496118_0094094_665_1318 | 175 |
| 381 | 3300048929 | Ga0496126_0013584 | Ga0496126_0013584_4037_4648 | 175 |
| 382 | 3300050492 | nmdc:mga0yw44_97098_c1 | nmdc:mga0yw44_97098_c1_913_1542 | 175 |
| 383 | 3300050494 | nmdc:mga06z11_19223_c1 | nmdc:mga06z11_19223_c1_891_1520 | 175 |
| 384 | 3300050495 | nmdc:mga04h51_127207_c1 | nmdc:mga04h51_127207_c1_300_929 | 175 |
| 385 | 3300050496 | nmdc:mga07m45_3481_c1 | nmdc:mga07m45_3481_c1_6236_6865 | 175 |
| 386 | 3300050516 | nmdc:mga0sz30_223154_c1 | nmdc:mga0sz30_223154_c1_106_735 | 175 |
| 387 | iso_pu_bacteria | 2524023210 | 2524466971 | 175 |
| 388 | iso_pu_bacteria | 2728368998 | 2728755111 | 175 |
| 389 | iso_pu_bacteria | 2791355199 | 2793080827 | 175 |
| 390 | iso_pu_bacteria | 2857524615 | 2857527720 | 175 |
| 391 | iso_pu_bacteria | 2874604998 | 2874607966 | 175 |
| 392 | iso_pu_bacteria | 2919073203 | 2919073581 | 175 |
| 393 | 3300005327 | Ga0070658_10177258 | Ga0070658_101772581 | 176 |
| 394 | 3300005336 | Ga0070680_100047058 | Ga0070680_1000470581 | 176 |
| 395 | 3300005339 | Ga0070660_100004126 | Ga0070660_1000041269 | 176 |
| 396 | 3300005458 | Ga0070681_10276400 | Ga0070681_102764002 | 176 |
| 397 | 3300005530 | Ga0070679_100011919 | Ga0070679_1000119195 | 176 |
| 398 | 3300005530 | Ga0070679_100736119 | Ga0070679_1007361191 | 176 |
| 399 | 3300005535 | Ga0070684_100010508 | Ga0070684_1000105083 | 176 |
| 400 | 3300005539 | Ga0068853_100001665 | Ga0068853_1000016652 | 176 |
| 401 | 3300005539 | Ga0068853_100669388 | Ga0068853_1006693882 | 176 |
| 402 | 3300005563 | Ga0068855_100077134 | Ga0068855_1000771343 | 176 |
| 403 | 3300005563 | Ga0068855_100495226 | Ga0068855_1004952262 | 176 |
| 404 | 3300005614 | Ga0068856_100344821 | Ga0068856_1003448212 | 176 |
| 405 | 3300005616 | Ga0068852_100611579 | Ga0068852_1006115791 | 176 |
| 406 | 3300005841 | Ga0068863_100210004 | Ga0068863_1002100042 | 176 |
| 407 | 3300005844 | Ga0068862_100607833 | Ga0068862_1006078331 | 176 |
| 408 | 3300005937 | Ga0081455_10016975 | Ga0081455_100169756 | 176 |
| 409 | 3300005983 | Ga0081540_1037369 | Ga0081540_10373693 | 176 |
| 410 | 3300005983 | Ga0081540_1041905 | Ga0081540_10419052 | 176 |
| 411 | 3300006038 | Ga0075365_10054575 | Ga0075365_100545753 | 176 |
| 412 | 3300006186 | Ga0075369_10031630 | Ga0075369_100316302 | 176 |
| 413 | 3300006195 | Ga0075366_10047218 | Ga0075366_100472182 | 176 |
| 414 | 3300006237 | Ga0097621_100144016 | Ga0097621_1001440162 | 176 |
| 415 | 3300006844 | Ga0075428_100326409 | Ga0075428_1003264092 | 176 |
| 416 | 3300009098 | Ga0105245_10448366 | Ga0105245_104483662 | 176 |
| 417 | 3300009553 | Ga0105249_10679457 | Ga0105249_106794572 | 176 |
| 418 | 3300010375 | Ga0105239_10403051 | Ga0105239_104030511 | 176 |
| 419 | 3300010375 | Ga0105239_10644279 | Ga0105239_106442792 | 176 |
| 420 | 3300013105 | Ga0157369_10424549 | Ga0157369_104245492 | 176 |
| 421 | 3300013296 | Ga0157374_10208313 | Ga0157374_102083132 | 176 |
| 422 | 3300013297 | Ga0157378_10083215 | Ga0157378_100832152 | 176 |
| 423 | 3300013307 | Ga0157372_10335300 | Ga0157372_103353002 | 176 |
| 424 | 3300025912 | Ga0207707_10000990 | Ga0207707_1000099018 | 176 |
| 425 | 3300025912 | Ga0207707_10112081 | Ga0207707_101120812 | 176 |
| 426 | 3300025917 | Ga0207660_10007283 | Ga0207660_100072835 | 176 |
| 427 | 3300025921 | Ga0207652_10003759 | Ga0207652_100037598 | 176 |
| 428 | 3300025924 | Ga0207694_10020073 | Ga0207694_100200733 | 176 |
| 429 | 3300025924 | Ga0207694_10277251 | Ga0207694_102772512 | 176 |
| 430 | 3300025949 | Ga0207667_10011487 | Ga0207667_100114875 | 176 |
| 431 | 3300026041 | Ga0207639_10003274 | Ga0207639_100032743 | 176 |
| 432 | 3300026078 | Ga0207702_10748509 | Ga0207702_107485092 | 176 |
| 433 | 3300026088 | Ga0207641_10256679 | Ga0207641_102566792 | 176 |
| 434 | 3300026118 | Ga0207675_100025514 | Ga0207675_1000255145 | 176 |
| 435 | 3300028379 | Ga0268266_10003674 | Ga0268266_1000367412 | 176 |
| 436 | 3300035113 | Ga0373936_0036855 | Ga0373936_0036855_651_1298 | 176 |
| 437 | 3300035113 | Ga0373936_0133424 | Ga0373936_0133424_176_817 | 176 |
| 438 | 3300035725 | Ga0373947_0318240 | Ga0373947_0318240_367_996 | 176 |
| 439 | 3300039450 | Ga0436363_1457096 | Ga0436363_1457096_150_764 | 176 |
| 440 | 3300042142 | Ga0450905_035059 | Ga0450905_035059_22_675 | 176 |
| 441 | 3300045976 | Ga0466967_0060474 | Ga0466967_0060474_1736_2350 | 176 |
| 442 | 3300046471 | Ga0495650_0138376 | Ga0495650_0138376_148_786 | 176 |
| 443 | 3300046474 | Ga0495605_0068744 | Ga0495605_0068744_997_1647 | 176 |
| 444 | 3300046557 | Ga0495622_0157255 | Ga0495622_0157255_29_658 | 176 |
| 445 | 3300046558 | Ga0495633_0168142 | Ga0495633_0168142_288_938 | 176 |
| 446 | 3300046684 | Ga0495669_0337178 | Ga0495669_0337178_56_697 | 176 |
| 447 | 3300047447 | Ga0495685_114342 | Ga0495685_114342_217_867 | 176 |
| 448 | 3300048911 | Ga0496108_0240436 | Ga0496108_0240436_845_1489 | 176 |
| 449 | 3300048916 | Ga0496113_0506112 | Ga0496113_0506112_21_665 | 176 |
| 450 | 3300048917 | Ga0496114_0130553 | Ga0496114_0130553_449_1099 | 176 |
| 451 | 3300048924 | Ga0496121_0023544 | Ga0496121_0023544_1171_1803 | 176 |
| 452 | 3300049568 | Ga0501031_0000248 | Ga0501031_0000248_21926_22525 | 176 |
| 453 | 3300049569 | Ga0501032_0000387 | Ga0501032_0000387_4488_5087 | 176 |
| 454 | 3300049570 | Ga0501033_0000110 | Ga0501033_0000110_63362_63961 | 176 |
| 455 | 3300049571 | Ga0501034_0000198 | Ga0501034_0000198_57767_58366 | 176 |
| 456 | 3300049572 | Ga0501036_0000047 | Ga0501036_0000047_4695_5294 | 176 |
| 457 | 3300049572 | Ga0501036_0237956 | Ga0501036_0237956_645_1298 | 176 |
| 458 | 3300049573 | Ga0501037_0000050 | Ga0501037_0000050_59284_59883 | 176 |
| 459 | 3300049574 | Ga0501038_0000463 | Ga0501038_0000463_13633_14232 | 176 |
| 460 | 3300049575 | Ga0501039_0000260 | Ga0501039_0000260_30253_30852 | 176 |
| 461 | 3300049577 | Ga0501041_0183242 | Ga0501041_0183242_564_1217 | 176 |
| 462 | 3300049578 | Ga0501042_0021886 | Ga0501042_0021886_1391_1990 | 176 |
| 463 | 3300049579 | Ga0501043_0000153 | Ga0501043_0000153_47847_48446 | 176 |
| 464 | 3300049580 | Ga0501046_0000678 | Ga0501046_0000678_2973_3572 | 176 |
| 465 | 3300049581 | Ga0501047_0003334 | Ga0501047_0003334_7450_8049 | 176 |
| 466 | 3300049582 | Ga0501048_0000323 | Ga0501048_0000323_18486_19085 | 176 |
| 467 | 3300049583 | Ga0501067_0000101 | Ga0501067_0000101_38397_38996 | 176 |
| 468 | 3300049584 | Ga0501068_0001632 | Ga0501068_0001632_1629_2228 | 176 |
| 469 | 3300049586 | Ga0501070_0008034 | Ga0501070_0008034_7153_7752 | 176 |
| 470 | 3300049587 | Ga0501071_0070981 | Ga0501071_0070981_905_1504 | 176 |
| 471 | 3300049588 | Ga0501072_0000168 | Ga0501072_0000168_3404_4003 | 176 |
| 472 | 3300049590 | Ga0501074_0010655 | Ga0501074_0010655_2309_2908 | 176 |
| 473 | 3300049591 | Ga0501075_0204613 | Ga0501075_0204613_320_973 | 176 |
| 474 | 3300049592 | Ga0501076_0521497 | Ga0501076_0521497_74_673 | 176 |
| 475 | 3300049741 | Ga0501079_0000308 | Ga0501079_0000308_17200_17799 | 176 |
| 476 | 3300049742 | Ga0501080_0000093 | Ga0501080_0000093_35235_35834 | 176 |
| 477 | 3300049742 | Ga0501080_0420392 | Ga0501080_0420392_369_1022 | 176 |
| 478 | 3300049744 | Ga0501083_0001922 | Ga0501083_0001922_10586_11185 | 176 |
| 479 | 3300049822 | Ga0501035_0005530 | Ga0501035_0005530_8641_9240 | 176 |
| 480 | 3300049823 | Ga0501044_0000100 | Ga0501044_0000100_25841_26440 | 176 |
| 481 | 3300049824 | Ga0501045_0032228 | Ga0501045_0032228_1043_1642 | 176 |
| 482 | 3300050492 | nmdc:mga0yw44_29389_c1 | nmdc:mga0yw44_29389_c1_1200_1853 | 176 |
| 483 | 3300050511 | nmdc:mga08y16_469826_c1 | nmdc:mga08y16_469826_c1_119_769 | 176 |
| 484 | 3300054114 | Ga0501084_0018047 | Ga0501084_0018047_1914_2513 | 176 |
| 485 | 3300054114 | Ga0501084_0347375 | Ga0501084_0347375_439_1092 | 176 |
| 486 | 3300060353 | Ga0501082_0011433 | Ga0501082_0011433_4673_5272 | 176 |
| 487 | 3300003322 | rootL2_10098350 | rootL2_100983502 | 177 |
| 488 | 3300005337 | Ga0070682_100376895 | Ga0070682_1003768951 | 177 |
| 489 | 3300005434 | Ga0070709_10021213 | Ga0070709_100212133 | 177 |
| 490 | 3300005435 | Ga0070714_100112792 | Ga0070714_1001127921 | 177 |
| 491 | 3300005439 | Ga0070711_100001085 | Ga0070711_10000108514 | 177 |
| 492 | 3300005440 | Ga0070705_100437775 | Ga0070705_1004377751 | 177 |
| 493 | 3300005455 | Ga0070663_100015823 | Ga0070663_1000158233 | 177 |
| 494 | 3300005539 | Ga0068853_100097223 | Ga0068853_1000972232 | 177 |
| 495 | 3300005539 | Ga0068853_100854860 | Ga0068853_1008548602 | 177 |
| 496 | 3300005616 | Ga0068852_100134708 | Ga0068852_1001347082 | 177 |
| 497 | 3300005616 | Ga0068852_100180915 | Ga0068852_1001809152 | 177 |
| 498 | 3300005937 | Ga0081455_10051561 | Ga0081455_100515612 | 177 |
| 499 | 3300006038 | Ga0075365_10002290 | Ga0075365_100022903 | 177 |
| 500 | 3300006042 | Ga0075368_10021336 | Ga0075368_100213363 | 177 |
| 501 | 3300006048 | Ga0075363_100072702 | Ga0075363_1000727022 | 177 |
| 502 | 3300006051 | Ga0075364_10053334 | Ga0075364_100533342 | 177 |
| 503 | 3300006178 | Ga0075367_10145921 | Ga0075367_101459211 | 177 |
| 504 | 3300006353 | Ga0075370_10006907 | Ga0075370_100069074 | 177 |
| 505 | 3300009093 | Ga0105240_10153098 | Ga0105240_101530982 | 177 |
| 506 | 3300009093 | Ga0105240_10199947 | Ga0105240_101999473 | 177 |
| 507 | 3300009176 | Ga0105242_10162896 | Ga0105242_101628962 | 177 |
| 508 | 3300009545 | Ga0105237_10295718 | Ga0105237_102957182 | 177 |
| 509 | 3300010375 | Ga0105239_10924799 | Ga0105239_109247991 | 177 |
| 510 | 3300013104 | Ga0157370_10281542 | Ga0157370_102815422 | 177 |
| 511 | 3300013105 | Ga0157369_10036939 | Ga0157369_100369392 | 177 |
| 512 | 3300013307 | Ga0157372_10464990 | Ga0157372_104649902 | 177 |
| 513 | 3300013307 | Ga0157372_10629768 | Ga0157372_106297682 | 177 |
| 514 | 3300014745 | Ga0157377_10201737 | Ga0157377_102017372 | 177 |
| 515 | 3300025904 | Ga0207647_10207626 | Ga0207647_102076261 | 177 |
| 516 | 3300025912 | Ga0207707_10000445 | Ga0207707_100004459 | 177 |
| 517 | 3300025913 | Ga0207695_10174609 | Ga0207695_101746092 | 177 |
| 518 | 3300025928 | Ga0207700_10011006 | Ga0207700_100110062 | 177 |
| 519 | 3300025939 | Ga0207665_10051404 | Ga0207665_100514043 | 177 |
| 520 | 3300025945 | Ga0207679_10104904 | Ga0207679_101049041 | 177 |
| 521 | 3300026067 | Ga0207678_10011118 | Ga0207678_100111184 | 177 |
| 522 | 3300026142 | Ga0207698_10197105 | Ga0207698_101971052 | 177 |
| 523 | 3300028379 | Ga0268266_10004060 | Ga0268266_1000406012 | 177 |
| 524 | 3300028379 | Ga0268266_10300988 | Ga0268266_103009882 | 177 |
| 525 | 3300031548 | Ga0307408_100107661 | Ga0307408_1001076612 | 177 |
| 526 | 3300031616 | Ga0307508_10036258 | Ga0307508_100362583 | 177 |
| 527 | 3300031711 | Ga0265314_10106031 | Ga0265314_101060312 | 177 |
| 528 | 3300037068 | Ga0373925_0142028 | Ga0373925_0142028_16_654 | 177 |
| 529 | 3300037418 | Ga0395900_0006715 | Ga0395900_0006715_8358_8975 | 177 |
| 530 | 3300037466 | Ga0395898_0023802 | Ga0395898_0023802_2658_3275 | 177 |
| 531 | 3300037471 | Ga0395905_1092588 | Ga0395905_1092588_42_668 | 177 |
| 532 | 3300044694 | Ga0466963_0005447 | Ga0466963_0005447_5373_6017 | 177 |
| 533 | 3300045976 | Ga0466967_0013380 | Ga0466967_0013380_1366_2010 | 177 |
| 534 | 3300045976 | Ga0466967_0162440 | Ga0466967_0162440_1128_1751 | 177 |
| 535 | 3300046452 | Ga0495617_030574 | Ga0495617_030574_1115_1771 | 177 |
| 536 | 3300046459 | Ga0495629_0437676 | Ga0495629_0437676_201_845 | 177 |
| 537 | 3300046616 | Ga0495668_0133751 | Ga0495668_0133751_667_1287 | 177 |
| 538 | 3300047472 | Ga0495686_0267660 | Ga0495686_0267660_11_652 | 177 |
| 539 | 3300048915 | Ga0496112_0000035 | Ga0496112_0000035_15117_15743 | 177 |
| 540 | 3300048922 | Ga0496119_0110145 | Ga0496119_0110145_521_1180 | 177 |
| 541 | 3300048924 | Ga0496121_0117259 | Ga0496121_0117259_238_897 | 177 |
| 542 | 3300049569 | Ga0501032_0356671 | Ga0501032_0356671_154_726 | 177 |
| 543 | 3300049571 | Ga0501034_0791798 | Ga0501034_0791798_284_829 | 177 |
| 544 | 3300049572 | Ga0501036_0193246 | Ga0501036_0193246_1100_1645 | 177 |
| 545 | 3300049574 | Ga0501038_0485578 | Ga0501038_0485578_311_856 | 177 |
| 546 | 3300049578 | Ga0501042_0673143 | Ga0501042_0673143_105_650 | 177 |
| 547 | 3300049579 | Ga0501043_0069478 | Ga0501043_0069478_350_895 | 177 |
| 548 | 3300049579 | Ga0501043_0709070 | Ga0501043_0709070_96_671 | 177 |
| 549 | 3300049581 | Ga0501047_0399387 | Ga0501047_0399387_472_1017 | 177 |
| 550 | 3300049583 | Ga0501067_0335551 | Ga0501067_0335551_97_720 | 177 |
| 551 | 3300049823 | Ga0501044_0084898 | Ga0501044_0084898_1871_2416 | 177 |
| 552 | 3300049823 | Ga0501044_0166646 | Ga0501044_0166646_1066_1641 | 177 |
| 553 | 3300053085 | Ga0495619_0494250 | Ga0495619_0494250_123_761 | 177 |
| 554 | 3300053090 | Ga0500646_0027972 | Ga0500646_0027972_558_1214 | 177 |
| 555 | 3300053092 | Ga0500583_0061412 | Ga0500583_0061412_211_867 | 177 |
| 556 | 3300053130 | Ga0500642_0305205 | Ga0500642_0305205_15_671 | 177 |
| 557 | 3300053136 | Ga0500559_0133287 | Ga0500559_0133287_227_862 | 177 |
| 558 | 3300053161 | Ga0500634_0099595 | Ga0500634_0099595_79_735 | 177 |
| 559 | 3300053727 | Ga0500611_065472 | Ga0500611_065472_82_738 | 177 |
| 560 | 3300053730 | Ga0500645_015436 | Ga0500645_015436_1498_2142 | 177 |
| 561 | 3300061719 | Ga0466962_0036868 | Ga0466962_0036868_1556_2200 | 177 |
| 562 | 3300003203 | JGI25406J46586_10000084 | JGI25406J46586_1000008437 | 178 |
| 563 | 3300005338 | Ga0068868_100143537 | Ga0068868_1001435372 | 178 |
| 564 | 3300005344 | Ga0070661_100080664 | Ga0070661_1000806642 | 178 |
| 565 | 3300005345 | Ga0070692_10430735 | Ga0070692_104307351 | 178 |
| 566 | 3300005354 | Ga0070675_100614301 | Ga0070675_1006143011 | 178 |
| 567 | 3300005364 | Ga0070673_100404974 | Ga0070673_1004049742 | 178 |
| 568 | 3300005434 | Ga0070709_10469679 | Ga0070709_104696791 | 178 |
| 569 | 3300005441 | Ga0070700_100158256 | Ga0070700_1001582561 | 178 |
| 570 | 3300005455 | Ga0070663_100045325 | Ga0070663_1000453253 | 178 |
| 571 | 3300005455 | Ga0070663_100166764 | Ga0070663_1001667641 | 178 |
| 572 | 3300005457 | Ga0070662_100033660 | Ga0070662_1000336601 | 178 |
| 573 | 3300005530 | Ga0070679_100867617 | Ga0070679_1008676171 | 178 |
| 574 | 3300005539 | Ga0068853_100197591 | Ga0068853_1001975912 | 178 |
| 575 | 3300005543 | Ga0070672_100542954 | Ga0070672_1005429542 | 178 |
| 576 | 3300005563 | Ga0068855_100018783 | Ga0068855_1000187838 | 178 |
| 577 | 3300005578 | Ga0068854_100189213 | Ga0068854_1001892132 | 178 |
| 578 | 3300005614 | Ga0068856_100102708 | Ga0068856_1001027082 | 178 |
| 579 | 3300005615 | Ga0070702_100096312 | Ga0070702_1000963122 | 178 |
| 580 | 3300005616 | Ga0068852_100709052 | Ga0068852_1007090521 | 178 |
| 581 | 3300005718 | Ga0068866_10413109 | Ga0068866_104131091 | 178 |
| 582 | 3300005719 | Ga0068861_100085730 | Ga0068861_1000857303 | 178 |
| 583 | 3300005841 | Ga0068863_100411663 | Ga0068863_1004116631 | 178 |
| 584 | 3300005843 | Ga0068860_100221470 | Ga0068860_1002214702 | 178 |
| 585 | 3300005843 | Ga0068860_100222819 | Ga0068860_1002228192 | 178 |
| 586 | 3300005985 | Ga0081539_10000265 | Ga0081539_1000026541 | 178 |
| 587 | 3300006358 | Ga0068871_100868655 | Ga0068871_1008686551 | 178 |
| 588 | 3300009093 | Ga0105240_10004498 | Ga0105240_1000449814 | 178 |
| 589 | 3300009177 | Ga0105248_10760976 | Ga0105248_107609761 | 178 |
| 590 | 3300009551 | Ga0105238_10007795 | Ga0105238_100077956 | 178 |
| 591 | 3300010375 | Ga0105239_10020968 | Ga0105239_100209682 | 178 |
| 592 | 3300013102 | Ga0157371_10029771 | Ga0157371_100297712 | 178 |
| 593 | 3300013104 | Ga0157370_10175523 | Ga0157370_101755232 | 178 |
| 594 | 3300013105 | Ga0157369_10357788 | Ga0157369_103577882 | 178 |
| 595 | 3300025904 | Ga0207647_10002312 | Ga0207647_100023129 | 178 |
| 596 | 3300025907 | Ga0207645_10134097 | Ga0207645_101340972 | 178 |
| 597 | 3300025909 | Ga0207705_10053520 | Ga0207705_100535202 | 178 |
| 598 | 3300025913 | Ga0207695_10021945 | Ga0207695_100219455 | 178 |
| 599 | 3300025920 | Ga0207649_10686403 | Ga0207649_106864031 | 178 |
| 600 | 3300025924 | Ga0207694_10011956 | Ga0207694_100119563 | 178 |
| 601 | 3300025926 | Ga0207659_10195990 | Ga0207659_101959902 | 178 |
| 602 | 3300025928 | Ga0207700_10487564 | Ga0207700_104875642 | 178 |
| 603 | 3300025935 | Ga0207709_10029659 | Ga0207709_100296593 | 178 |
| 604 | 3300025944 | Ga0207661_10790502 | Ga0207661_107905021 | 178 |
| 605 | 3300025949 | Ga0207667_10124632 | Ga0207667_101246322 | 178 |
| 606 | 3300025961 | Ga0207712_10034760 | Ga0207712_100347602 | 178 |
| 607 | 3300025972 | Ga0207668_10023936 | Ga0207668_100239362 | 178 |
| 608 | 3300026041 | Ga0207639_10382364 | Ga0207639_103823641 | 178 |
| 609 | 3300026067 | Ga0207678_10043469 | Ga0207678_100434692 | 178 |
| 610 | 3300026067 | Ga0207678_10903668 | Ga0207678_109036681 | 178 |
| 611 | 3300026067 | Ga0207678_11029127 | Ga0207678_110291271 | 178 |
| 612 | 3300026089 | Ga0207648_10983761 | Ga0207648_109837611 | 178 |
| 613 | 3300026116 | Ga0207674_10005387 | Ga0207674_1000538714 | 178 |
| 614 | 3300026142 | Ga0207698_10499776 | Ga0207698_104997762 | 178 |
| 615 | 3300028379 | Ga0268266_10839131 | Ga0268266_108391311 | 178 |
| 616 | 3300031238 | Ga0265332_10106507 | Ga0265332_101065072 | 178 |
| 617 | 3300031249 | Ga0265339_10017310 | Ga0265339_100173103 | 178 |
| 618 | 3300031711 | Ga0265314_10030517 | Ga0265314_100305172 | 178 |
| 619 | 3300031712 | Ga0265342_10005300 | Ga0265342_100053003 | 178 |
| 620 | 3300041456 | Ga0451795_0972193 | Ga0451795_0972193_60_722 | 178 |
| 621 | 3300041462 | Ga0451806_270177 | Ga0451806_270177_24_686 | 178 |
| 622 | 3300045976 | Ga0466967_0508706 | Ga0466967_0508706_406_1011 | 178 |
| 623 | 3300046507 | Ga0495606_0003660 | Ga0495606_0003660_1722_2345 | 178 |
| 624 | 3300046524 | Ga0495648_0001251 | Ga0495648_0001251_21660_22280 | 178 |
| 625 | 3300049571 | Ga0501034_0404884 | Ga0501034_0404884_337_933 | 178 |
| 626 | 3300049579 | Ga0501043_0437613 | Ga0501043_0437613_39_662 | 178 |
| 627 | 3300049823 | Ga0501044_0176093 | Ga0501044_0176093_698_1294 | 178 |
| 628 | 3300053085 | Ga0495619_0617963 | Ga0495619_0617963_62_670 | 178 |
| 629 | 3300005338 | Ga0068868_100080304 | Ga0068868_1000803043 | 179 |
| 630 | 3300005434 | Ga0070709_10001493 | Ga0070709_1000149310 | 179 |
| 631 | 3300005435 | Ga0070714_100016089 | Ga0070714_1000160894 | 179 |
| 632 | 3300005436 | Ga0070713_100018419 | Ga0070713_1000184195 | 179 |
| 633 | 3300005437 | Ga0070710_10213368 | Ga0070710_102133681 | 179 |
| 634 | 3300005455 | Ga0070663_100097054 | Ga0070663_1000970542 | 179 |
| 635 | 3300005458 | Ga0070681_10001992 | Ga0070681_100019928 | 179 |
| 636 | 3300005548 | Ga0070665_100041983 | Ga0070665_1000419834 | 179 |
| 637 | 3300005563 | Ga0068855_100236381 | Ga0068855_1002363812 | 179 |
| 638 | 3300005719 | Ga0068861_100146106 | Ga0068861_1001461062 | 179 |
| 639 | 3300005983 | Ga0081540_1018565 | Ga0081540_10185652 | 179 |
| 640 | 3300006163 | Ga0070715_10001806 | Ga0070715_100018067 | 179 |
| 641 | 3300006173 | Ga0070716_100014088 | Ga0070716_1000140883 | 179 |
| 642 | 3300006173 | Ga0070716_100054078 | Ga0070716_1000540782 | 179 |
| 643 | 3300006175 | Ga0070712_100035671 | Ga0070712_1000356712 | 179 |
| 644 | 3300006175 | Ga0070712_100869998 | Ga0070712_1008699981 | 179 |
| 645 | 3300006195 | Ga0075366_10583674 | Ga0075366_105836741 | 179 |
| 646 | 3300006237 | Ga0097621_100092247 | Ga0097621_1000922473 | 179 |
| 647 | 3300006871 | Ga0075434_100675566 | Ga0075434_1006755661 | 179 |
| 648 | 3300007788 | Ga0099795_10121495 | Ga0099795_101214951 | 179 |
| 649 | 3300017792 | Ga0163161_10021791 | Ga0163161_100217914 | 179 |
| 650 | 3300025898 | Ga0207692_10006026 | Ga0207692_100060261 | 179 |
| 651 | 3300025901 | Ga0207688_10486389 | Ga0207688_104863891 | 179 |
| 652 | 3300025904 | Ga0207647_10078653 | Ga0207647_100786532 | 179 |
| 653 | 3300025905 | Ga0207685_10014596 | Ga0207685_100145962 | 179 |
| 654 | 3300025915 | Ga0207693_10001330 | Ga0207693_100013307 | 179 |
| 655 | 3300025916 | Ga0207663_10001827 | Ga0207663_100018276 | 179 |
| 656 | 3300025916 | Ga0207663_10026590 | Ga0207663_100265903 | 179 |
| 657 | 3300025917 | Ga0207660_10246492 | Ga0207660_102464922 | 179 |
| 658 | 3300025921 | Ga0207652_10011887 | Ga0207652_100118876 | 179 |
| 659 | 3300025927 | Ga0207687_10173374 | Ga0207687_101733742 | 179 |
| 660 | 3300025929 | Ga0207664_10002909 | Ga0207664_100029093 | 179 |
| 661 | 3300025929 | Ga0207664_10245040 | Ga0207664_102450401 | 179 |
| 662 | 3300025938 | Ga0207704_10181384 | Ga0207704_101813841 | 179 |
| 663 | 3300025939 | Ga0207665_10000843 | Ga0207665_100008437 | 179 |
| 664 | 3300025940 | Ga0207691_10038499 | Ga0207691_100384994 | 179 |
| 665 | 3300025942 | Ga0207689_10352424 | Ga0207689_103524242 | 179 |
| 666 | 3300025949 | Ga0207667_10336237 | Ga0207667_103362371 | 179 |
| 667 | 3300025972 | Ga0207668_10549444 | Ga0207668_105494441 | 179 |
| 668 | 3300026023 | Ga0207677_10310024 | Ga0207677_103100242 | 179 |
| 669 | 3300026035 | Ga0207703_10185692 | Ga0207703_101856922 | 179 |
| 670 | 3300026067 | Ga0207678_10277926 | Ga0207678_102779262 | 179 |
| 671 | 3300026116 | Ga0207674_10002936 | Ga0207674_1000293616 | 179 |
| 672 | 3300026121 | Ga0207683_10377637 | Ga0207683_103776372 | 179 |
| 673 | 3300028379 | Ga0268266_10040844 | Ga0268266_100408442 | 179 |
| 674 | 3300031238 | Ga0265332_10073435 | Ga0265332_100734352 | 179 |
| 675 | 3300031238 | Ga0265332_10114411 | Ga0265332_101144112 | 179 |
| 676 | 3300031730 | Ga0307516_10013268 | Ga0307516_100132684 | 179 |
| 677 | 3300031911 | Ga0307412_10866129 | Ga0307412_108661291 | 179 |
| 678 | 3300032002 | Ga0307416_100298320 | Ga0307416_1002983201 | 179 |
| 679 | 3300032005 | Ga0307411_11209872 | Ga0307411_112098721 | 179 |
| 680 | 3300035117 | Ga0373953_0003561 | Ga0373953_0003561_684_1280 | 179 |
| 681 | 3300035118 | Ga0373954_0005495 | Ga0373954_0005495_4032_4628 | 179 |
| 682 | 3300035119 | Ga0373956_0012061 | Ga0373956_0012061_1880_2476 | 179 |
| 683 | 3300035120 | Ga0373957_0006428 | Ga0373957_0006428_1215_1811 | 179 |
| 684 | 3300035172 | Ga0373955_0006993 | Ga0373955_0006993_1059_1655 | 179 |
| 685 | 3300035410 | Ga0373924_0008980 | Ga0373924_0008980_1345_1941 | 179 |
| 686 | 3300036401 | Ga0373937_0122269 | Ga0373937_0122269_549_1145 | 179 |
| 687 | 3300037418 | Ga0395900_0260653 | Ga0395900_0260653_814_1422 | 179 |
| 688 | 3300037466 | Ga0395898_0017586 | Ga0395898_0017586_4816_5424 | 179 |
| 689 | 3300037466 | Ga0395898_0172868 | Ga0395898_0172868_711_1367 | 179 |
| 690 | 3300037471 | Ga0395905_0031610 | Ga0395905_0031610_2315_2971 | 179 |
| 691 | 3300038443 | Ga0395901_0258187 | Ga0395901_0258187_516_1172 | 179 |
| 692 | 3300041509 | Ga0451843_1570788 | Ga0451843_1570788_79_696 | 179 |
| 693 | 3300046454 | Ga0495592_0008934 | Ga0495592_0008934_4125_4721 | 179 |
| 694 | 3300046462 | Ga0495651_0014811 | Ga0495651_0014811_3477_4073 | 179 |
| 695 | 3300046463 | Ga0495653_0051592 | Ga0495653_0051592_1395_1991 | 179 |
| 696 | 3300046476 | Ga0495662_0125383 | Ga0495662_0125383_306_902 | 179 |
| 697 | 3300046477 | Ga0495664_0012483 | Ga0495664_0012483_308_904 | 179 |
| 698 | 3300046499 | Ga0495594_0101589 | Ga0495594_0101589_396_1004 | 179 |
| 699 | 3300046516 | Ga0495628_0019320 | Ga0495628_0019320_4115_4711 | 179 |
| 700 | 3300046529 | Ga0495652_0074294 | Ga0495652_0074294_901_1497 | 179 |
| 701 | 3300046533 | Ga0495640_0008655 | Ga0495640_0008655_6180_6776 | 179 |
| 702 | 3300046536 | Ga0495587_0011369 | Ga0495587_0011369_3195_3791 | 179 |
| 703 | 3300046538 | Ga0495609_0161912 | Ga0495609_0161912_14_673 | 179 |
| 704 | 3300046543 | Ga0495645_0003153 | Ga0495645_0003153_6526_7122 | 179 |
| 705 | 3300046558 | Ga0495633_0127781 | Ga0495633_0127781_19_669 | 179 |
| 706 | 3300046559 | Ga0495667_0036954 | Ga0495667_0036954_839_1435 | 179 |
| 707 | 3300046642 | Ga0495634_0103387 | Ga0495634_0103387_970_1566 | 179 |
| 708 | 3300046675 | Ga0495657_0015384 | Ga0495657_0015384_1884_2480 | 179 |
| 709 | 3300046678 | Ga0495599_0004679 | Ga0495599_0004679_2006_2602 | 179 |
| 710 | 3300046679 | Ga0495623_0011461 | Ga0495623_0011461_4256_4852 | 179 |
| 711 | 3300046683 | Ga0495658_0273016 | Ga0495658_0273016_387_983 | 179 |
| 712 | 3300046684 | Ga0495669_0036562 | Ga0495669_0036562_230_892 | 179 |
| 713 | 3300046689 | Ga0495613_0272797 | Ga0495613_0272797_203_799 | 179 |
| 714 | 3300046794 | Ga0495589_0084979 | Ga0495589_0084979_756_1415 | 179 |
| 715 | 3300046809 | Ga0495600_0010405 | Ga0495600_0010405_1594_2190 | 179 |
| 716 | 3300047315 | Ga0495581_0048593 | Ga0495581_0048593_1302_1910 | 179 |
| 717 | 3300047317 | Ga0495604_0057212 | Ga0495604_0057212_271_867 | 179 |
| 718 | 3300047319 | Ga0495674_0036515 | Ga0495674_0036515_441_1037 | 179 |
| 719 | 3300047322 | Ga0495680_0018556 | Ga0495680_0018556_2336_2932 | 179 |
| 720 | 3300047471 | Ga0495684_0019406 | Ga0495684_0019406_2010_2606 | 179 |
| 721 | 3300048088 | Ga0495602_0044685 | Ga0495602_0044685_2966_3562 | 179 |
| 722 | 3300048918 | Ga0496115_0052603 | Ga0496115_0052603_1212_1805 | 179 |
| 723 | 3300053077 | Ga0495601_0052014 | Ga0495601_0052014_1409_2005 | 179 |
| 724 | 3300053078 | Ga0495612_0017966 | Ga0495612_0017966_1271_1867 | 179 |
| 725 | 3300053085 | Ga0495619_0225404 | Ga0495619_0225404_262_858 | 179 |
| 726 | 3300053094 | Ga0500566_0001201 | Ga0500566_0001201_9393_9995 | 179 |
| 727 | 3300053111 | Ga0500572_004757 | Ga0500572_004757_1667_2269 | 179 |
| 728 | 3300053115 | Ga0500591_042842 | Ga0500591_042842_1085_1687 | 179 |
| 729 | 3300053136 | Ga0500559_0042679 | Ga0500559_0042679_948_1550 | 179 |
| 730 | 3300053150 | Ga0500603_003328 | Ga0500603_003328_2089_2691 | 179 |
| 731 | 3300053159 | Ga0500630_047435 | Ga0500630_047435_534_1136 | 179 |
| 732 | 3300053162 | Ga0500638_056238 | Ga0500638_056238_564_1166 | 179 |
| 733 | 3300053163 | Ga0500639_002913 | Ga0500639_002913_2887_3489 | 179 |
| 734 | 3300053735 | Ga0500596_003108 | Ga0500596_003108_2028_2630 | 179 |
| 735 | 3300053737 | Ga0500601_001657 | Ga0500601_001657_763_1365 | 179 |
| 736 | 3300009098 | Ga0105245_10169785 | Ga0105245_101697852 | 180 |
| 737 | 3300000549 | LJQas_1004407 | LJQas_10044072 | 181 |
| 738 | 3300005981 | Ga0081538_10052170 | Ga0081538_100521702 | 181 |
| 739 | 3300005983 | Ga0081540_1006582 | Ga0081540_10065826 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2e0w-assembly1.cif.gz_A | t391a precursor mutant protein of gamma-glutamyltranspeptidase from escherichia coli | 0.69 | 146 | 167 |
| 3dtd-assembly1.cif.gz_C-2 | crystal structure of invasion associated protein b from bartonella henselae | 0.6858 | 39 | 180 |
| 3dtd-assembly1.cif.gz_C-2 | crystal structure of invasion associated protein b from bartonella henselae | 0.6577 | 39 | 180 |
| 7jqz-assembly1.cif.gz_I | crystal structure of cfl2 wild-type from burkholderia cenocepacia | 0.6236 | 35 | 67 |
| 5cen-assembly1.cif.gz_A | crystal structure of dlk (kinase domain) | 0.6155 | 34 | 63 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q18976_2_330_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.8056 | 36 | 62 | 1.10.510.10 |
| af_Q54TA1_482_569_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7872 | 36 | 65 | 3.30.200.20 |
| af_Q4D3P7_9_124_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.7728 | 37 | 65 | 3.30.200.20 |
| af_Q5AP97_783_1043_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.7655 | 35 | 62 | 1.10.510.10 |
| af_I1LRP0_2_307_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.76 | 37 | 62 | 1.10.510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327JMX6-F1-model_v4 | deleted | 0.9551 | 35 | 179 |
|
| AF-A0A4P5T7K9-F1-model_v4 | Uncharacterized protein | 0.9322 | 35 | 179 |
GO:0016020
|
| AF-A0A2E2CY58-F1-model_v4 | Uncharacterized protein | 0.9282 | 38 | 180 |
|
| AF-A0A327JMX6-F1-model_v4 | deleted | 0.9243 | 35 | 179 |
|
| AF-A0A2E6W1X7-F1-model_v4 | Uncharacterized protein | 0.9211 | 57 | 180 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar