F478447
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 739 | 321 | 1478 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100229894|Ga0070662_1002298943 |
| Length | 217 |
| Sequence | MMNTDILIANLSEDVPKVSRHAVARRVGTGLVVGGMVAMIAVTTLLGVRPDLHVAMRGFAFWMKWTYTISLGLGAAFAVTRLARPDTRSLQALWILAVPVLLLAGVCINELARTPPAKWLAMWLGKSWMACPWLVLSLAAPIFVGLLWSFRKMAPTRLRAAGAVAGLAAGAWAATIYCLHCPEVSALFVLTWYSLGIAIAAGLGALIGRASCAGELL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 112 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 200 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 205 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 284 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 285 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 286 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 287 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 288 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 289 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 292 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 293 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 294 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 295 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 298 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 299 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 300 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 301 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 302 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 303 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 304 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 305 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 306 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 307 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 308 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 309 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 310 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 311 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 312 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 313 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 314 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 315 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 316 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 317 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 318 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 319 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 320 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 321 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.89 |
| Metatranscriptomes | 0.14 |
| Isolates | 2.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.86 |
| Nodule | 0 |
| Rhizoplane | 3.52 |
| Rhizosphere | 67.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070662_100229894 | 3300005457 | Bacteria | 1483 |
| 2 | SwRhRL2b_contig_1650000 | 2162886007 | Bacteria | 2722 |
| 3 | SwRhRL2b_contig_1793279 | 2162886007 | Bacteria | 5449 |
| 4 | SwRhRL2b_contig_3665959 | 2162886007 | Bacteria | 6817 |
| 5 | JGI24741J21665_1003678 | 3300001915 | Bacteria | 3585 |
| 6 | JGI24752J21851_1000248 | 3300001976 | Bacteria | 7468 |
| 7 | JGI24740J21852_10003526 | 3300001979 | Bacteria | 6857 |
| 8 | JGI24739J22299_10004763 | 3300001989 | Bacteria | 5179 |
| 9 | JGI24739J22299_10109312 | 3300001989 | Bacteria | 830 |
| 10 | JGI24739J22299_10109411 | 3300001989 | Bacteria | 830 |
| 11 | JGI24737J22298_10001206 | 3300001990 | Bacteria | 9107 |
| 12 | JGI24737J22298_10002877 | 3300001990 | Bacteria | 6104 |
| 13 | JGI24737J22298_10053337 | 3300001990 | Bacteria | 1225 |
| 14 | JGI24743J22301_10014071 | 3300001991 | Bacteria | 1472 |
| 15 | JGI24735J21928_10000508 | 3300002067 | Bacteria | 13774 |
| 16 | JGI24735J21928_10004707 | 3300002067 | Bacteria | 4557 |
| 17 | JGI24735J21928_10005734 | 3300002067 | Bacteria | 4105 |
| 18 | JGI24735J21928_10026103 | 3300002067 | Bacteria | 1759 |
| 19 | JGI24748J21848_1003097 | 3300002074 | Bacteria | 1896 |
| 20 | JGI24738J21930_10013760 | 3300002075 | Bacteria | 1743 |
| 21 | JGI24749J21850_1000256 | 3300002076 | Bacteria | 8348 |
| 22 | JGI24751J29686_10000054 | 3300002459 | Bacteria | 65209 |
| 23 | JGI25150J39212_1000167 | 3300002774 | Bacteria | 36906 |
| 24 | JGI25151J46595_10082065 | 3300003187 | Bacteria | 929 |
| 25 | JGI25165J46597_1000156 | 3300003214 | Bacteria | 109696 |
| 26 | JGI25165J46597_1000289 | 3300003214 | Bacteria | 63916 |
| 27 | JGI25153J46596_10000016 | 3300003215 | Bacteria | 285917 |
| 28 | JGI25153J46596_10000158 | 3300003215 | Bacteria | 68367 |
| 29 | JGI25153J46596_10008781 | 3300003215 | Bacteria | 4783 |
| 30 | rootH2_10187327 | 3300003320 | Unclassified | 2881 |
| 31 | rootL2_10205962 | 3300003322 | Bacteria | 4125 |
| 32 | Ga0055525_1000035 | 3300003759 | Bacteria | 300887 |
| 33 | Ga0055542_1000132 | 3300003762 | Bacteria | 96749 |
| 34 | Ga0055529_1000088 | 3300003763 | Bacteria | 139031 |
| 35 | Ga0055526_1003911 | 3300003771 | Bacteria | 9195 |
| 36 | Ga0055537_1002542 | 3300003773 | Bacteria | 6031 |
| 37 | Ga0055524_1000250 | 3300003775 | Bacteria | 55936 |
| 38 | Ga0055530_10005650 | 3300003791 | Bacteria | 5858 |
| 39 | Ga0055530_10032168 | 3300003791 | Bacteria | 1367 |
| 40 | Ga0055531_10002208 | 3300003794 | Bacteria | 13238 |
| 41 | Ga0055543_1034603 | 3300004625 | Bacteria | 870 |
| 42 | Ga0065165_1000284 | 3300005262 | Bacteria | 86057 |
| 43 | Ga0065165_1006724 | 3300005262 | Bacteria | 5905 |
| 44 | Ga0065704_10072411 | 3300005289 | Bacteria | 8575 |
| 45 | Ga0065704_10072823 | 3300005289 | Bacteria | 7957 |
| 46 | Ga0065704_10276187 | 3300005289 | Bacteria | 912 |
| 47 | Ga0070658_10000265 | 3300005327 | Bacteria | 46194 |
| 48 | Ga0070658_10001217 | 3300005327 | Bacteria | 22089 |
| 49 | Ga0070658_10004386 | 3300005327 | Bacteria | 11507 |
| 50 | Ga0070658_10005072 | 3300005327 | Bacteria | 10715 |
| 51 | Ga0070676_10000135 | 3300005328 | Bacteria | 28224 |
| 52 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 53 | Ga0070670_100002547 | 3300005331 | Bacteria | 15040 |
| 54 | Ga0070670_100277463 | 3300005331 | Bacteria | 1463 |
| 55 | Ga0068869_100000965 | 3300005334 | Bacteria | 16736 |
| 56 | Ga0070666_10024908 | 3300005335 | Bacteria | 3900 |
| 57 | Ga0070666_10049820 | 3300005335 | Bacteria | 2816 |
| 58 | Ga0068868_100000155 | 3300005338 | Bacteria | 44610 |
| 59 | Ga0070660_100001781 | 3300005339 | Bacteria | 14791 |
| 60 | Ga0070660_100009128 | 3300005339 | Bacteria | 6961 |
| 61 | Ga0070660_100036945 | 3300005339 | Bacteria | 3702 |
| 62 | Ga0070660_100143632 | 3300005339 | Bacteria | 1916 |
| 63 | Ga0070661_100024033 | 3300005344 | Bacteria | 4372 |
| 64 | Ga0070661_100098395 | 3300005344 | Bacteria | 2173 |
| 65 | Ga0070668_100001513 | 3300005347 | Bacteria | 16795 |
| 66 | Ga0070668_100005762 | 3300005347 | Bacteria | 9188 |
| 67 | Ga0070668_100008465 | 3300005347 | Bacteria | 7640 |
| 68 | Ga0070668_100124469 | 3300005347 | Bacteria | 2064 |
| 69 | Ga0070669_100000020 | 3300005353 | Bacteria | 181297 |
| 70 | Ga0070669_100002401 | 3300005353 | Bacteria | 13554 |
| 71 | Ga0070669_100046320 | 3300005353 | Bacteria | 3171 |
| 72 | Ga0070669_100050134 | 3300005353 | Bacteria | 3049 |
| 73 | Ga0070669_100066674 | 3300005353 | Bacteria | 2654 |
| 74 | Ga0070669_100115152 | 3300005353 | Bacteria | 2045 |
| 75 | Ga0070675_100369873 | 3300005354 | Bacteria | 1274 |
| 76 | Ga0070671_100000858 | 3300005355 | Bacteria | 22169 |
| 77 | Ga0070671_100128033 | 3300005355 | Bacteria | 2138 |
| 78 | Ga0070671_100150001 | 3300005355 | Bacteria | 1968 |
| 79 | Ga0070674_100001506 | 3300005356 | Bacteria | 12427 |
| 80 | Ga0070673_100000013 | 3300005364 | Bacteria | 137021 |
| 81 | Ga0070673_100060240 | 3300005364 | Bacteria | 3007 |
| 82 | Ga0070659_100029275 | 3300005366 | Bacteria | 4256 |
| 83 | Ga0070659_100036279 | 3300005366 | Bacteria | 3843 |
| 84 | Ga0070659_100081921 | 3300005366 | Bacteria | 2578 |
| 85 | Ga0070659_100440241 | 3300005366 | Bacteria | 1104 |
| 86 | Ga0070667_100000019 | 3300005367 | Bacteria | 224710 |
| 87 | Ga0070667_100001705 | 3300005367 | Bacteria | 19664 |
| 88 | Ga0070667_100007648 | 3300005367 | Bacteria | 8962 |
| 89 | Ga0070667_100007908 | 3300005367 | Bacteria | 8819 |
| 90 | Ga0070667_100017940 | 3300005367 | Bacteria | 5867 |
| 91 | Ga0070667_100089557 | 3300005367 | Bacteria | 2643 |
| 92 | Ga0070667_101013779 | 3300005367 | Unclassified | 775 |
| 93 | Ga0070711_100228271 | 3300005439 | Unclassified | 1451 |
| 94 | Ga0070705_100562733 | 3300005440 | Bacteria | 876 |
| 95 | Ga0070663_100087917 | 3300005455 | Bacteria | 2297 |
| 96 | Ga0070678_100000187 | 3300005456 | Bacteria | 27177 |
| 97 | Ga0070662_100001289 | 3300005457 | Bacteria | 15403 |
| 98 | Ga0070662_100020720 | 3300005457 | Bacteria | 4483 |
| 99 | Ga0070662_100021818 | 3300005457 | Bacteria | 4377 |
| 100 | Ga0070662_100046847 | 3300005457 | Bacteria | 3107 |
| 101 | Ga0068867_100000009 | 3300005459 | Bacteria | 137021 |
| 102 | Ga0068867_100069173 | 3300005459 | Bacteria | 2636 |
| 103 | Ga0068867_100102850 | 3300005459 | Bacteria | 2184 |
| 104 | Ga0068853_100001142 | 3300005539 | Bacteria | 18805 |
| 105 | Ga0068853_100100752 | 3300005539 | Bacteria | 2554 |
| 106 | Ga0068853_100359947 | 3300005539 | Bacteria | 1355 |
| 107 | Ga0070665_100000385 | 3300005548 | Bacteria | 65243 |
| 108 | Ga0070665_100002939 | 3300005548 | Bacteria | 18407 |
| 109 | Ga0070665_100011694 | 3300005548 | Bacteria | 8869 |
| 110 | Ga0070665_100022421 | 3300005548 | Bacteria | 6354 |
| 111 | Ga0070665_100065537 | 3300005548 | Bacteria | 3644 |
| 112 | Ga0068855_100123487 | 3300005563 | Bacteria | 2962 |
| 113 | Ga0068855_100326074 | 3300005563 | Bacteria | 1696 |
| 114 | Ga0068855_100430430 | 3300005563 | Bacteria | 1442 |
| 115 | Ga0068855_100506348 | 3300005563 | Bacteria | 1311 |
| 116 | Ga0068855_100836633 | 3300005563 | Bacteria | 976 |
| 117 | Ga0068855_101038504 | 3300005563 | Bacteria | 859 |
| 118 | Ga0070664_100257696 | 3300005564 | Bacteria | 1569 |
| 119 | Ga0068857_100004484 | 3300005577 | Bacteria | 11800 |
| 120 | Ga0068857_100030929 | 3300005577 | Bacteria | 4730 |
| 121 | Ga0068857_100108017 | 3300005577 | Bacteria | 2500 |
| 122 | Ga0068854_100001459 | 3300005578 | Bacteria | 14323 |
| 123 | Ga0068854_100011043 | 3300005578 | Bacteria | 5863 |
| 124 | Ga0068854_100018465 | 3300005578 | Bacteria | 4682 |
| 125 | Ga0068854_100097502 | 3300005578 | Bacteria | 2198 |
| 126 | Ga0068854_100222969 | 3300005578 | Bacteria | 1492 |
| 127 | Ga0068856_100007394 | 3300005614 | Bacteria | 10720 |
| 128 | Ga0068856_100075361 | 3300005614 | Bacteria | 3342 |
| 129 | Ga0068852_100002750 | 3300005616 | Bacteria | 12180 |
| 130 | Ga0068852_100051698 | 3300005616 | Bacteria | 3528 |
| 131 | Ga0068859_100007640 | 3300005617 | Bacteria | 10987 |
| 132 | Ga0068859_100040574 | 3300005617 | Bacteria | 4671 |
| 133 | Ga0068859_100041065 | 3300005617 | Bacteria | 4647 |
| 134 | Ga0068859_100063321 | 3300005617 | Bacteria | 3729 |
| 135 | Ga0068864_100000005 | 3300005618 | Bacteria | 400840 |
| 136 | Ga0068864_100000021 | 3300005618 | Bacteria | 262378 |
| 137 | Ga0068864_100001977 | 3300005618 | Bacteria | 16873 |
| 138 | Ga0068861_100004363 | 3300005719 | Bacteria | 9487 |
| 139 | Ga0068861_100059995 | 3300005719 | Bacteria | 2914 |
| 140 | Ga0068863_100005477 | 3300005841 | Bacteria | 12502 |
| 141 | Ga0068863_100006774 | 3300005841 | Bacteria | 11234 |
| 142 | Ga0068863_100014465 | 3300005841 | Bacteria | 7599 |
| 143 | Ga0068863_100017809 | 3300005841 | Bacteria | 6800 |
| 144 | Ga0068863_100101045 | 3300005841 | Bacteria | 2741 |
| 145 | Ga0068858_100000138 | 3300005842 | Bacteria | 77033 |
| 146 | Ga0068858_100000769 | 3300005842 | Bacteria | 33482 |
| 147 | Ga0068858_100015762 | 3300005842 | Bacteria | 7108 |
| 148 | Ga0068860_100000042 | 3300005843 | Bacteria | 227404 |
| 149 | Ga0068860_100001393 | 3300005843 | Bacteria | 26213 |
| 150 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 151 | Ga0068862_100000158 | 3300005844 | Bacteria | 75829 |
| 152 | Ga0068862_100005645 | 3300005844 | Bacteria | 10449 |
| 153 | Ga0068862_100006948 | 3300005844 | Bacteria | 9390 |
| 154 | Ga0068862_100016278 | 3300005844 | Bacteria | 6187 |
| 155 | Ga0068862_100342463 | 3300005844 | Bacteria | 1385 |
| 156 | Ga0068862_100634321 | 3300005844 | Bacteria | 1029 |
| 157 | Ga0081539_10013835 | 3300005985 | Bacteria | 6038 |
| 158 | Ga0070717_10285242 | 3300006028 | Bacteria | 1465 |
| 159 | Ga0075368_10000243 | 3300006042 | Bacteria | 15387 |
| 160 | Ga0075368_10002102 | 3300006042 | Bacteria | 6434 |
| 161 | Ga0075363_100001469 | 3300006048 | Bacteria | 8957 |
| 162 | Ga0075363_100028702 | 3300006048 | Bacteria | 2865 |
| 163 | Ga0070715_10272291 | 3300006163 | Unclassified | 894 |
| 164 | Ga0070716_100297830 | 3300006173 | Bacteria | 1120 |
| 165 | Ga0075367_10000651 | 3300006178 | Bacteria | 13311 |
| 166 | Ga0075367_10005198 | 3300006178 | Bacteria | 6434 |
| 167 | Ga0075369_10237373 | 3300006186 | Bacteria | 845 |
| 168 | Ga0075370_10019573 | 3300006353 | Bacteria | 3688 |
| 169 | Ga0068871_100067445 | 3300006358 | Bacteria | 2935 |
| 170 | Ga0068871_100350382 | 3300006358 | Unclassified | 1306 |
| 171 | Ga0075434_100225804 | 3300006871 | Bacteria | 1892 |
| 172 | Ga0068865_100000005 | 3300006881 | Bacteria | 213248 |
| 173 | Ga0097620_100007640 | 3300006931 | Bacteria | 10987 |
| 174 | Ga0097620_100040576 | 3300006931 | Bacteria | 4671 |
| 175 | Ga0097620_100041062 | 3300006931 | Bacteria | 4647 |
| 176 | Ga0097620_100063324 | 3300006931 | Bacteria | 3729 |
| 177 | Ga0075435_100117537 | 3300007076 | Bacteria | 2216 |
| 178 | Ga0105251_10000253 | 3300009011 | Bacteria | 53797 |
| 179 | Ga0105251_10004109 | 3300009011 | Bacteria | 10177 |
| 180 | Ga0105251_10042819 | 3300009011 | Bacteria | 2195 |
| 181 | Ga0105240_10008344 | 3300009093 | Bacteria | 14825 |
| 182 | Ga0105240_10024971 | 3300009093 | Bacteria | 7865 |
| 183 | Ga0105240_10025167 | 3300009093 | Bacteria | 7827 |
| 184 | Ga0105240_10038048 | 3300009093 | Bacteria | 6176 |
| 185 | Ga0105240_10069900 | 3300009093 | Bacteria | 4345 |
| 186 | Ga0105240_10359924 | 3300009093 | Bacteria | 1648 |
| 187 | Ga0105245_10006241 | 3300009098 | Bacteria | 10486 |
| 188 | Ga0105247_10087507 | 3300009101 | Bacteria | 1973 |
| 189 | Ga0105243_10000032 | 3300009148 | Bacteria | 183324 |
| 190 | Ga0105243_10000077 | 3300009148 | Bacteria | 110432 |
| 191 | Ga0105243_10045805 | 3300009148 | Bacteria | 3439 |
| 192 | Ga0105241_10003044 | 3300009174 | Bacteria | 12509 |
| 193 | Ga0105241_10674168 | 3300009174 | Unclassified | 941 |
| 194 | Ga0105242_10000148 | 3300009176 | Bacteria | 51694 |
| 195 | Ga0105248_10000086 | 3300009177 | Bacteria | 106349 |
| 196 | Ga0105248_10101066 | 3300009177 | Bacteria | 3250 |
| 197 | Ga0105237_10001230 | 3300009545 | Bacteria | 34130 |
| 198 | Ga0105237_10001347 | 3300009545 | Bacteria | 32527 |
| 199 | Ga0105237_10039220 | 3300009545 | Bacteria | 4781 |
| 200 | Ga0105237_10122815 | 3300009545 | Bacteria | 2591 |
| 201 | Ga0105238_10164534 | 3300009551 | Bacteria | 2194 |
| 202 | Ga0105238_10209676 | 3300009551 | Bacteria | 1924 |
| 203 | Ga0105238_10269778 | 3300009551 | Bacteria | 1682 |
| 204 | Ga0105249_10001047 | 3300009553 | Bacteria | 24478 |
| 205 | Ga0105249_10006483 | 3300009553 | Bacteria | 10179 |
| 206 | Ga0105249_10047250 | 3300009553 | Bacteria | 3922 |
| 207 | Ga0105249_10072524 | 3300009553 | Bacteria | 3183 |
| 208 | Ga0105249_10131182 | 3300009553 | Bacteria | 2392 |
| 209 | Ga0105239_10000113 | 3300010375 | Bacteria | 114562 |
| 210 | Ga0105239_10004322 | 3300010375 | Bacteria | 17032 |
| 211 | Ga0105239_10068549 | 3300010375 | Bacteria | 3898 |
| 212 | Ga0105239_10302756 | 3300010375 | Bacteria | 1800 |
| 213 | Ga0105246_10001422 | 3300011119 | Bacteria | 14184 |
| 214 | Ga0157373_10057752 | 3300013100 | Bacteria | 2752 |
| 215 | Ga0157373_10489871 | 3300013100 | Bacteria | 887 |
| 216 | Ga0157371_10000048 | 3300013102 | Bacteria | 184015 |
| 217 | Ga0157371_10067695 | 3300013102 | Bacteria | 2527 |
| 218 | Ga0157371_10158952 | 3300013102 | Bacteria | 1614 |
| 219 | Ga0157371_10312025 | 3300013102 | Bacteria | 1140 |
| 220 | Ga0157370_10000176 | 3300013104 | Bacteria | 79656 |
| 221 | Ga0157369_10010454 | 3300013105 | Bacteria | 10572 |
| 222 | Ga0157369_10053466 | 3300013105 | Bacteria | 4365 |
| 223 | Ga0157369_10140664 | 3300013105 | Bacteria | 2554 |
| 224 | Ga0157374_10005361 | 3300013296 | Bacteria | 10772 |
| 225 | Ga0157374_10164712 | 3300013296 | Bacteria | 2160 |
| 226 | Ga0157378_10005618 | 3300013297 | Bacteria | 10988 |
| 227 | Ga0157378_10059632 | 3300013297 | Bacteria | 3405 |
| 228 | Ga0163162_10013809 | 3300013306 | Bacteria | 7889 |
| 229 | Ga0163162_10771050 | 3300013306 | Bacteria | 1080 |
| 230 | Ga0157372_10003759 | 3300013307 | Bacteria | 16306 |
| 231 | Ga0157372_10103674 | 3300013307 | Bacteria | 3250 |
| 232 | Ga0157372_10259845 | 3300013307 | Unclassified | 2016 |
| 233 | Ga0157372_10377717 | 3300013307 | Bacteria | 1651 |
| 234 | Ga0157372_10511185 | 3300013307 | Bacteria | 1400 |
| 235 | Ga0157375_10000636 | 3300013308 | Bacteria | 31210 |
| 236 | Ga0163163_10028250 | 3300014325 | Bacteria | 5384 |
| 237 | Ga0163163_10806620 | 3300014325 | Bacteria | 1002 |
| 238 | Ga0157380_10000057 | 3300014326 | Bacteria | 63054 |
| 239 | Ga0157380_10000060 | 3300014326 | Bacteria | 62248 |
| 240 | Ga0157380_10115317 | 3300014326 | Bacteria | 2265 |
| 241 | Ga0157377_10010382 | 3300014745 | Bacteria | 4604 |
| 242 | Ga0157379_10108914 | 3300014968 | Bacteria | 2488 |
| 243 | Ga0157379_10293257 | 3300014968 | Bacteria | 1481 |
| 244 | Ga0157376_10000244 | 3300014969 | Bacteria | 37827 |
| 245 | Ga0183363_1011 | 3300015690 | Bacteria | 101930 |
| 246 | Ga0163161_10016808 | 3300017792 | Bacteria | 5115 |
| 247 | Ga0206353_11472309 | 3300020082 | Bacteria | 1719 |
| 248 | Ga0213872_10007952 | 3300021361 | Bacteria | 5169 |
| 249 | Ga0213872_10008732 | 3300021361 | Bacteria | 4892 |
| 250 | Ga0213872_10012664 | 3300021361 | Bacteria | 3963 |
| 251 | Ga0213872_10031207 | 3300021361 | Bacteria | 2442 |
| 252 | Ga0213872_10032154 | 3300021361 | Bacteria | 2405 |
| 253 | Ga0213872_10173239 | 3300021361 | Bacteria | 934 |
| 254 | Ga0213872_10177789 | 3300021361 | Bacteria | 920 |
| 255 | Ga0209147_100263 | 3300025229 | Bacteria | 47901 |
| 256 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 257 | Ga0207427_100436 | 3300025231 | Bacteria | 23280 |
| 258 | Ga0207425_1000019 | 3300025245 | Bacteria | 399942 |
| 259 | Ga0207425_1011296 | 3300025245 | Bacteria | 2136 |
| 260 | Ga0209026_1001456 | 3300025250 | Bacteria | 10450 |
| 261 | Ga0209026_1015603 | 3300025250 | Bacteria | 1244 |
| 262 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 263 | Ga0209148_1000457 | 3300025254 | Bacteria | 44291 |
| 264 | Ga0209148_1000736 | 3300025254 | Bacteria | 25511 |
| 265 | Ga0209129_1000413 | 3300025258 | Bacteria | 33495 |
| 266 | Ga0209233_1000213 | 3300025261 | Bacteria | 109881 |
| 267 | Ga0209233_1000291 | 3300025261 | Bacteria | 64111 |
| 268 | Ga0209565_1000030 | 3300025263 | Bacteria | 325058 |
| 269 | Ga0209565_1000314 | 3300025263 | Bacteria | 44878 |
| 270 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 271 | Ga0209455_1001006 | 3300025272 | Bacteria | 14217 |
| 272 | Ga0209673_1001192 | 3300025273 | Bacteria | 27915 |
| 273 | Ga0209675_1014328 | 3300025291 | Bacteria | 2420 |
| 274 | Ga0209676_1076997 | 3300025292 | Bacteria | 772 |
| 275 | Ga0209025_1000559 | 3300025294 | Bacteria | 68241 |
| 276 | Ga0209564_1000670 | 3300025295 | Bacteria | 50564 |
| 277 | Ga0209564_1004569 | 3300025295 | Bacteria | 8385 |
| 278 | Ga0209758_1000019 | 3300025297 | Bacteria | 743682 |
| 279 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 280 | Ga0209758_1005071 | 3300025297 | Bacteria | 10435 |
| 281 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 282 | Ga0209050_1001657 | 3300025298 | Bacteria | 22579 |
| 283 | Ga0209050_1007464 | 3300025298 | Bacteria | 6125 |
| 284 | Ga0209050_1007633 | 3300025298 | Bacteria | 6000 |
| 285 | Ga0209050_1057367 | 3300025298 | Bacteria | 942 |
| 286 | Ga0209256_1000046 | 3300025299 | Bacteria | 325040 |
| 287 | Ga0209256_1010036 | 3300025299 | Bacteria | 4041 |
| 288 | Ga0209051_1002722 | 3300025303 | Bacteria | 12282 |
| 289 | Ga0209257_1000111 | 3300025304 | Bacteria | 234809 |
| 290 | Ga0209257_1000395 | 3300025304 | Bacteria | 86373 |
| 291 | Ga0209257_1010870 | 3300025304 | Bacteria | 4504 |
| 292 | Ga0209257_1015873 | 3300025304 | Bacteria | 3092 |
| 293 | Ga0207656_10005643 | 3300025321 | Bacteria | 4440 |
| 294 | Ga0207696_1003816 | 3300025711 | Bacteria | 6703 |
| 295 | Ga0207713_1000266 | 3300025735 | Bacteria | 64691 |
| 296 | Ga0207713_1003594 | 3300025735 | Bacteria | 10459 |
| 297 | Ga0207713_1010826 | 3300025735 | Bacteria | 5014 |
| 298 | Ga0207710_10094100 | 3300025900 | Bacteria | 1406 |
| 299 | Ga0207710_10280844 | 3300025900 | Bacteria | 838 |
| 300 | Ga0207647_10000068 | 3300025904 | Bacteria | 81240 |
| 301 | Ga0207647_10015339 | 3300025904 | Bacteria | 5256 |
| 302 | Ga0207647_10017721 | 3300025904 | Bacteria | 4836 |
| 303 | Ga0207645_10000416 | 3300025907 | Bacteria | 35380 |
| 304 | Ga0207705_10000583 | 3300025909 | Bacteria | 30635 |
| 305 | Ga0207705_10000665 | 3300025909 | Bacteria | 28572 |
| 306 | Ga0207705_10012795 | 3300025909 | Bacteria | 6058 |
| 307 | Ga0207705_10067611 | 3300025909 | Bacteria | 2586 |
| 308 | Ga0207654_10000587 | 3300025911 | Bacteria | 20506 |
| 309 | Ga0207695_10006747 | 3300025913 | Bacteria | 14805 |
| 310 | Ga0207695_10015458 | 3300025913 | Bacteria | 8985 |
| 311 | Ga0207695_10019521 | 3300025913 | Bacteria | 7802 |
| 312 | Ga0207695_10022134 | 3300025913 | Bacteria | 7228 |
| 313 | Ga0207695_10047354 | 3300025913 | Bacteria | 4552 |
| 314 | Ga0207695_10051781 | 3300025913 | Bacteria | 4307 |
| 315 | Ga0207695_10346441 | 3300025913 | Bacteria | 1373 |
| 316 | Ga0207671_10001107 | 3300025914 | Bacteria | 32491 |
| 317 | Ga0207671_10002399 | 3300025914 | Bacteria | 20094 |
| 318 | Ga0207671_10015428 | 3300025914 | Bacteria | 5980 |
| 319 | Ga0207671_10031391 | 3300025914 | Bacteria | 3959 |
| 320 | Ga0207693_10011415 | 3300025915 | Bacteria | 7192 |
| 321 | Ga0207663_10023856 | 3300025916 | Bacteria | 3518 |
| 322 | Ga0207657_10002418 | 3300025919 | Bacteria | 20170 |
| 323 | Ga0207657_10006429 | 3300025919 | Bacteria | 12187 |
| 324 | Ga0207657_10009661 | 3300025919 | Bacteria | 9680 |
| 325 | Ga0207657_10023846 | 3300025919 | Bacteria | 5686 |
| 326 | Ga0207657_10108096 | 3300025919 | Bacteria | 2299 |
| 327 | Ga0207649_10000795 | 3300025920 | Bacteria | 20334 |
| 328 | Ga0207649_10531344 | 3300025920 | Bacteria | 898 |
| 329 | Ga0207681_10000005 | 3300025923 | Bacteria | 555724 |
| 330 | Ga0207681_10001728 | 3300025923 | Bacteria | 14035 |
| 331 | Ga0207681_10003742 | 3300025923 | Bacteria | 9454 |
| 332 | Ga0207681_10151488 | 3300025923 | Bacteria | 1738 |
| 333 | Ga0207681_10226125 | 3300025923 | Bacteria | 1450 |
| 334 | Ga0207681_10235331 | 3300025923 | Bacteria | 1423 |
| 335 | Ga0207694_10004292 | 3300025924 | Bacteria | 11153 |
| 336 | Ga0207694_10066780 | 3300025924 | Bacteria | 2806 |
| 337 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 338 | Ga0207650_10001292 | 3300025925 | Bacteria | 18172 |
| 339 | Ga0207650_10002951 | 3300025925 | Bacteria | 11733 |
| 340 | Ga0207650_10062646 | 3300025925 | Bacteria | 2779 |
| 341 | Ga0207659_10318760 | 3300025926 | Bacteria | 1282 |
| 342 | Ga0207687_10004279 | 3300025927 | Bacteria | 9541 |
| 343 | Ga0207644_10000089 | 3300025931 | Bacteria | 65175 |
| 344 | Ga0207644_10001935 | 3300025931 | Bacteria | 13435 |
| 345 | Ga0207644_10103524 | 3300025931 | Bacteria | 2142 |
| 346 | Ga0207690_10002864 | 3300025932 | Bacteria | 10391 |
| 347 | Ga0207690_10038499 | 3300025932 | Bacteria | 3113 |
| 348 | Ga0207706_10011382 | 3300025933 | Bacteria | 8105 |
| 349 | Ga0207706_10015188 | 3300025933 | Bacteria | 6969 |
| 350 | Ga0207706_10015296 | 3300025933 | Bacteria | 6937 |
| 351 | Ga0207706_10038770 | 3300025933 | Bacteria | 4226 |
| 352 | Ga0207686_10000743 | 3300025934 | Bacteria | 20164 |
| 353 | Ga0207709_10000051 | 3300025935 | Bacteria | 227968 |
| 354 | Ga0207709_10000110 | 3300025935 | Bacteria | 127725 |
| 355 | Ga0207709_10014707 | 3300025935 | Bacteria | 4325 |
| 356 | Ga0207669_10000015 | 3300025937 | Bacteria | 125492 |
| 357 | Ga0207704_10000001 | 3300025938 | Bacteria | 716296 |
| 358 | Ga0207665_10085984 | 3300025939 | Bacteria | 2171 |
| 359 | Ga0207691_10023627 | 3300025940 | Bacteria | 5788 |
| 360 | Ga0207711_10000460 | 3300025941 | Bacteria | 42417 |
| 361 | Ga0207711_10002321 | 3300025941 | Bacteria | 17049 |
| 362 | Ga0207689_10006900 | 3300025942 | Bacteria | 9988 |
| 363 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 364 | Ga0207667_10010934 | 3300025949 | Bacteria | 10576 |
| 365 | Ga0207667_10082377 | 3300025949 | Bacteria | 3333 |
| 366 | Ga0207667_10660806 | 3300025949 | Bacteria | 1050 |
| 367 | Ga0207667_10669769 | 3300025949 | Bacteria | 1042 |
| 368 | Ga0207651_10000006 | 3300025960 | Bacteria | 227893 |
| 369 | Ga0207651_10500607 | 3300025960 | Bacteria | 1050 |
| 370 | Ga0207712_10000754 | 3300025961 | Bacteria | 24470 |
| 371 | Ga0207712_10056247 | 3300025961 | Bacteria | 2771 |
| 372 | Ga0207712_10091446 | 3300025961 | Bacteria | 2241 |
| 373 | Ga0207668_10000565 | 3300025972 | Bacteria | 23257 |
| 374 | Ga0207668_10005073 | 3300025972 | Bacteria | 7748 |
| 375 | Ga0207668_10014334 | 3300025972 | Bacteria | 4904 |
| 376 | Ga0207668_10021629 | 3300025972 | Bacteria | 4105 |
| 377 | Ga0207640_10004471 | 3300025981 | Bacteria | 7580 |
| 378 | Ga0207640_10010286 | 3300025981 | Bacteria | 5265 |
| 379 | Ga0207640_10075492 | 3300025981 | Bacteria | 2285 |
| 380 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 381 | Ga0207658_10001897 | 3300025986 | Bacteria | 15649 |
| 382 | Ga0207658_10003845 | 3300025986 | Bacteria | 10575 |
| 383 | Ga0207658_10005180 | 3300025986 | Bacteria | 8975 |
| 384 | Ga0207658_10011727 | 3300025986 | Bacteria | 5968 |
| 385 | Ga0207658_10035471 | 3300025986 | Bacteria | 3573 |
| 386 | Ga0207677_10003122 | 3300026023 | Bacteria | 8745 |
| 387 | Ga0207703_10000208 | 3300026035 | Bacteria | 68360 |
| 388 | Ga0207703_10000686 | 3300026035 | Bacteria | 33490 |
| 389 | Ga0207703_10083199 | 3300026035 | Bacteria | 2673 |
| 390 | Ga0207639_10001247 | 3300026041 | Bacteria | 17238 |
| 391 | Ga0207639_10006058 | 3300026041 | Bacteria | 8208 |
| 392 | Ga0207639_10050993 | 3300026041 | Bacteria | 3145 |
| 393 | Ga0207639_10078570 | 3300026041 | Bacteria | 2605 |
| 394 | Ga0207639_10631413 | 3300026041 | Bacteria | 990 |
| 395 | Ga0207678_10028634 | 3300026067 | Bacteria | 4861 |
| 396 | Ga0207678_11023084 | 3300026067 | Bacteria | 731 |
| 397 | Ga0207702_10005914 | 3300026078 | Bacteria | 10635 |
| 398 | Ga0207702_10006519 | 3300026078 | Bacteria | 10041 |
| 399 | Ga0207702_10018630 | 3300026078 | Bacteria | 5743 |
| 400 | Ga0207702_10099834 | 3300026078 | Bacteria | 2559 |
| 401 | Ga0207641_10000017 | 3300026088 | Bacteria | 299119 |
| 402 | Ga0207641_10006143 | 3300026088 | Bacteria | 10161 |
| 403 | Ga0207641_10017027 | 3300026088 | Bacteria | 5949 |
| 404 | Ga0207641_10047342 | 3300026088 | Bacteria | 3626 |
| 405 | Ga0207641_10065623 | 3300026088 | Bacteria | 3105 |
| 406 | Ga0207641_10081182 | 3300026088 | Bacteria | 2815 |
| 407 | Ga0207648_10000022 | 3300026089 | Bacteria | 137000 |
| 408 | Ga0207648_10140015 | 3300026089 | Bacteria | 2132 |
| 409 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 410 | Ga0207676_10000037 | 3300026095 | Bacteria | 180826 |
| 411 | Ga0207674_10006117 | 3300026116 | Bacteria | 14233 |
| 412 | Ga0207674_10013572 | 3300026116 | Bacteria | 9027 |
| 413 | Ga0207674_10022656 | 3300026116 | Bacteria | 6741 |
| 414 | Ga0207674_10070699 | 3300026116 | Bacteria | 3509 |
| 415 | Ga0207674_10107392 | 3300026116 | Bacteria | 2768 |
| 416 | Ga0207674_10130694 | 3300026116 | Bacteria | 2474 |
| 417 | Ga0207675_100000195 | 3300026118 | Bacteria | 55663 |
| 418 | Ga0207675_100111626 | 3300026118 | Bacteria | 2580 |
| 419 | Ga0207683_10000954 | 3300026121 | Bacteria | 26517 |
| 420 | Ga0207698_10001904 | 3300026142 | Bacteria | 12226 |
| 421 | Ga0207698_10112272 | 3300026142 | Bacteria | 2287 |
| 422 | Ga0207698_11065545 | 3300026142 | Bacteria | 820 |
| 423 | Ga0209813_10000102 | 3300027866 | Bacteria | 31660 |
| 424 | Ga0209813_10000375 | 3300027866 | Bacteria | 11234 |
| 425 | Ga0268266_10000338 | 3300028379 | Bacteria | 73458 |
| 426 | Ga0268266_10017809 | 3300028379 | Bacteria | 6054 |
| 427 | Ga0268266_10022870 | 3300028379 | Bacteria | 5320 |
| 428 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 429 | Ga0268265_10000673 | 3300028380 | Bacteria | 33766 |
| 430 | Ga0268265_10000863 | 3300028380 | Bacteria | 28360 |
| 431 | Ga0268265_10003220 | 3300028380 | Bacteria | 11856 |
| 432 | Ga0268265_10010725 | 3300028380 | Bacteria | 6187 |
| 433 | Ga0268265_10083823 | 3300028380 | Bacteria | 2525 |
| 434 | Ga0268265_10910722 | 3300028380 | Bacteria | 864 |
| 435 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 436 | Ga0268264_10001067 | 3300028381 | Bacteria | 27231 |
| 437 | Ga0268264_10005380 | 3300028381 | Bacteria | 10838 |
| 438 | Ga0268264_10019007 | 3300028381 | Bacteria | 5617 |
| 439 | Ga0268264_10652556 | 3300028381 | Bacteria | 1041 |
| 440 | Ga0307515_10012945 | 3300028794 | Bacteria | 15643 |
| 441 | Ga0307408_100020416 | 3300031548 | Bacteria | 4472 |
| 442 | Ga0307408_100034108 | 3300031548 | Bacteria | 3561 |
| 443 | Ga0307405_10017441 | 3300031731 | Bacteria | 3939 |
| 444 | Ga0307405_10126432 | 3300031731 | Bacteria | 1758 |
| 445 | Ga0307413_10068780 | 3300031824 | Bacteria | 2219 |
| 446 | Ga0307413_10141758 | 3300031824 | Bacteria | 1662 |
| 447 | Ga0307413_10209837 | 3300031824 | Bacteria | 1414 |
| 448 | Ga0307410_10003830 | 3300031852 | Bacteria | 7644 |
| 449 | Ga0307410_10092451 | 3300031852 | Bacteria | 2150 |
| 450 | Ga0307406_10020393 | 3300031901 | Bacteria | 3902 |
| 451 | Ga0307406_10062514 | 3300031901 | Bacteria | 2409 |
| 452 | Ga0307407_10041308 | 3300031903 | Bacteria | 2578 |
| 453 | Ga0307412_10003194 | 3300031911 | Bacteria | 9106 |
| 454 | Ga0307412_10003934 | 3300031911 | Bacteria | 8276 |
| 455 | Ga0307412_10010732 | 3300031911 | Bacteria | 5283 |
| 456 | Ga0307412_10086032 | 3300031911 | Bacteria | 2186 |
| 457 | Ga0307409_100181713 | 3300031995 | Bacteria | 1863 |
| 458 | Ga0307409_100959967 | 3300031995 | Bacteria | 871 |
| 459 | Ga0307416_101743361 | 3300032002 | Bacteria | 727 |
| 460 | Ga0307414_10056562 | 3300032004 | Bacteria | 2752 |
| 461 | Ga0307414_10298234 | 3300032004 | Bacteria | 1362 |
| 462 | Ga0307414_10593998 | 3300032004 | Unclassified | 992 |
| 463 | Ga0307510_10156800 | 3300033180 | Bacteria | 1882 |
| 464 | Ga0395899_0006882 | 3300037312 | Bacteria | 8809 |
| 465 | Ga0395899_0275288 | 3300037312 | Bacteria | 1147 |
| 466 | Ga0395905_0029762 | 3300037471 | Bacteria | 5147 |
| 467 | Ga0395901_0051879 | 3300038443 | Bacteria | 4264 |
| 468 | Ga0237819_02847 | 3300038705 | Bacteria | 3287 |
| 469 | Ga0237816_01980 | 3300039145 | Bacteria | 1616 |
| 470 | Ga0436361_0054467 | 3300039447 | Bacteria | 1002 |
| 471 | Ga0436361_0101796 | 3300039447 | Bacteria | 1050 |
| 472 | Ga0436361_0294799 | 3300039447 | Bacteria | 3065 |
| 473 | Ga0436361_0377188 | 3300039447 | Bacteria | 4713 |
| 474 | Ga0436361_0470588 | 3300039447 | Bacteria | 4688 |
| 475 | Ga0436361_0578054 | 3300039447 | Bacteria | 4931 |
| 476 | Ga0436361_0607077 | 3300039447 | Bacteria | 8854 |
| 477 | Ga0436361_0608675 | 3300039447 | Bacteria | 840 |
| 478 | Ga0436361_0854789 | 3300039447 | Bacteria | 2434 |
| 479 | Ga0436361_1023646 | 3300039447 | Bacteria | 6804 |
| 480 | Ga0436361_1202216 | 3300039447 | Bacteria | 11508 |
| 481 | Ga0451833_0136820 | 3300041491 | Bacteria | 1008 |
| 482 | Ga0439448_0029509 | 3300042005 | Bacteria | 1736 |
| 483 | Ga0439455_0007153 | 3300042012 | Bacteria | 2351 |
| 484 | Ga0439458_0000470 | 3300042157 | Bacteria | 10290 |
| 485 | Ga0466966_0172887 | 3300044684 | Bacteria | 1312 |
| 486 | Ga0466971_0032564 | 3300044719 | Bacteria | 2336 |
| 487 | Ga0466957_0261871 | 3300044842 | Bacteria | 1153 |
| 488 | Ga0466967_0029645 | 3300045976 | Bacteria | 4582 |
| 489 | Ga0495617_021739 | 3300046452 | Bacteria | 2167 |
| 490 | Ga0495617_045276 | 3300046452 | Bacteria | 1467 |
| 491 | Ga0495627_002167 | 3300046453 | Bacteria | 9821 |
| 492 | Ga0495638_0000336 | 3300046460 | Bacteria | 59114 |
| 493 | Ga0495638_0003765 | 3300046460 | Bacteria | 11789 |
| 494 | Ga0495638_0223637 | 3300046460 | Bacteria | 1051 |
| 495 | Ga0495650_0000302 | 3300046471 | Bacteria | 89516 |
| 496 | Ga0495584_0044514 | 3300046491 | Bacteria | 2240 |
| 497 | Ga0495585_0004581 | 3300046492 | Bacteria | 8938 |
| 498 | Ga0495596_0001091 | 3300046500 | Bacteria | 16079 |
| 499 | Ga0495596_0007393 | 3300046500 | Bacteria | 4957 |
| 500 | Ga0495607_0008994 | 3300046501 | Bacteria | 6795 |
| 501 | Ga0495583_0000023 | 3300046506 | Bacteria | 280019 |
| 502 | Ga0495583_0002372 | 3300046506 | Bacteria | 16255 |
| 503 | Ga0495583_0005352 | 3300046506 | Bacteria | 8750 |
| 504 | Ga0495606_0000809 | 3300046507 | Bacteria | 47581 |
| 505 | Ga0495606_0009634 | 3300046507 | Bacteria | 8137 |
| 506 | Ga0495606_0016375 | 3300046507 | Bacteria | 5657 |
| 507 | Ga0495606_0278950 | 3300046507 | Bacteria | 914 |
| 508 | Ga0495610_0003133 | 3300046512 | Bacteria | 13155 |
| 509 | Ga0495610_0009533 | 3300046512 | Bacteria | 6126 |
| 510 | Ga0495610_0069738 | 3300046512 | Bacteria | 1644 |
| 511 | Ga0495616_0000013 | 3300046513 | Bacteria | 202334 |
| 512 | Ga0495616_0077953 | 3300046513 | Bacteria | 1590 |
| 513 | Ga0495632_0301278 | 3300046519 | Unclassified | 711 |
| 514 | Ga0495637_0103624 | 3300046520 | Bacteria | 1109 |
| 515 | Ga0495643_0001684 | 3300046522 | Bacteria | 19277 |
| 516 | Ga0495643_0005282 | 3300046522 | Bacteria | 8772 |
| 517 | Ga0495643_0021178 | 3300046522 | Bacteria | 3735 |
| 518 | Ga0495643_0161224 | 3300046522 | Bacteria | 1103 |
| 519 | Ga0495648_0000088 | 3300046524 | Bacteria | 115109 |
| 520 | Ga0495652_0257817 | 3300046529 | Bacteria | 1289 |
| 521 | Ga0495587_0064229 | 3300046536 | Bacteria | 2145 |
| 522 | Ga0495622_0001921 | 3300046557 | Bacteria | 10214 |
| 523 | Ga0495633_0022857 | 3300046558 | Bacteria | 3103 |
| 524 | Ga0495633_0092264 | 3300046558 | Bacteria | 1407 |
| 525 | Ga0495668_0028309 | 3300046616 | Bacteria | 3169 |
| 526 | Ga0495668_0210047 | 3300046616 | Unclassified | 1066 |
| 527 | Ga0495611_0071050 | 3300046648 | Bacteria | 1591 |
| 528 | Ga0495625_0001696 | 3300046660 | Bacteria | 25671 |
| 529 | Ga0495625_0018082 | 3300046660 | Bacteria | 5510 |
| 530 | Ga0495661_0018024 | 3300046665 | Bacteria | 4650 |
| 531 | Ga0495661_0052699 | 3300046665 | Bacteria | 2450 |
| 532 | Ga0495670_0000003 | 3300046691 | Bacteria | 326779 |
| 533 | Ga0495670_0024660 | 3300046691 | Bacteria | 2973 |
| 534 | Ga0495600_0048688 | 3300046809 | Bacteria | 2764 |
| 535 | Ga0495687_000192 | 3300047443 | Bacteria | 87877 |
| 536 | Ga0495687_003523 | 3300047443 | Bacteria | 11270 |
| 537 | Ga0495687_103589 | 3300047443 | Bacteria | 1062 |
| 538 | Ga0495677_0003309 | 3300047445 | Bacteria | 6272 |
| 539 | Ga0495673_0017400 | 3300047469 | Bacteria | 3654 |
| 540 | Ga0495673_0068295 | 3300047469 | Bacteria | 1502 |
| 541 | Ga0495681_0000003 | 3300047470 | Bacteria | 245567 |
| 542 | Ga0495681_0152612 | 3300047470 | Bacteria | 968 |
| 543 | Ga0495686_0000124 | 3300047472 | Bacteria | 159708 |
| 544 | Ga0495686_0000383 | 3300047472 | Bacteria | 70528 |
| 545 | Ga0495686_0000550 | 3300047472 | Bacteria | 53672 |
| 546 | Ga0495686_0002025 | 3300047472 | Bacteria | 19995 |
| 547 | Ga0495686_0002694 | 3300047472 | Bacteria | 16296 |
| 548 | Ga0495686_0003151 | 3300047472 | Bacteria | 14544 |
| 549 | Ga0495686_0003367 | 3300047472 | Bacteria | 13928 |
| 550 | Ga0495686_0004993 | 3300047472 | Bacteria | 10667 |
| 551 | Ga0495686_0046677 | 3300047472 | Bacteria | 2737 |
| 552 | Ga0495686_0079422 | 3300047472 | Bacteria | 2006 |
| 553 | Ga0495626_0000890 | 3300048091 | Bacteria | 26470 |
| 554 | Ga0496100_0081646 | 3300048903 | Bacteria | 2184 |
| 555 | Ga0496101_0243480 | 3300048904 | Unclassified | 1400 |
| 556 | Ga0496102_0000125 | 3300048905 | Bacteria | 109075 |
| 557 | Ga0496102_0000555 | 3300048905 | Bacteria | 40031 |
| 558 | Ga0496102_0001484 | 3300048905 | Bacteria | 20725 |
| 559 | Ga0496103_0000111 | 3300048906 | Bacteria | 89596 |
| 560 | Ga0496103_0000322 | 3300048906 | Bacteria | 43840 |
| 561 | Ga0496103_0000557 | 3300048906 | Bacteria | 29704 |
| 562 | Ga0496103_0020230 | 3300048906 | Bacteria | 3998 |
| 563 | Ga0496103_0111519 | 3300048906 | Bacteria | 1738 |
| 564 | Ga0496104_0005088 | 3300048907 | Bacteria | 11475 |
| 565 | Ga0496104_0012726 | 3300048907 | Bacteria | 7578 |
| 566 | Ga0496105_0000261 | 3300048908 | Bacteria | 35507 |
| 567 | Ga0496105_0006966 | 3300048908 | Bacteria | 8709 |
| 568 | Ga0496105_0036203 | 3300048908 | Bacteria | 4065 |
| 569 | Ga0496107_0080966 | 3300048910 | Bacteria | 2369 |
| 570 | Ga0496108_0003893 | 3300048911 | Bacteria | 11988 |
| 571 | Ga0496109_0251953 | 3300048912 | Bacteria | 1663 |
| 572 | Ga0496110_0041185 | 3300048913 | Bacteria | 4030 |
| 573 | Ga0496110_0343671 | 3300048913 | Bacteria | 1359 |
| 574 | Ga0496112_0006155 | 3300048915 | Bacteria | 10491 |
| 575 | Ga0496113_0000042 | 3300048916 | Bacteria | 53513 |
| 576 | Ga0496114_0001428 | 3300048917 | Bacteria | 18118 |
| 577 | Ga0496115_0000142 | 3300048918 | Bacteria | 65915 |
| 578 | Ga0496115_0101045 | 3300048918 | Bacteria | 2364 |
| 579 | Ga0496116_0001007 | 3300048919 | Bacteria | 34381 |
| 580 | Ga0496116_0001035 | 3300048919 | Bacteria | 33974 |
| 581 | Ga0496116_0002161 | 3300048919 | Bacteria | 20943 |
| 582 | Ga0496116_0040950 | 3300048919 | Bacteria | 3184 |
| 583 | Ga0496116_0044255 | 3300048919 | Bacteria | 3026 |
| 584 | Ga0496116_0059986 | 3300048919 | Bacteria | 2470 |
| 585 | Ga0496117_0000414 | 3300048920 | Bacteria | 71876 |
| 586 | Ga0496117_0001978 | 3300048920 | Bacteria | 27244 |
| 587 | Ga0496117_0002434 | 3300048920 | Bacteria | 23501 |
| 588 | Ga0496117_0012452 | 3300048920 | Bacteria | 7492 |
| 589 | Ga0496117_0023551 | 3300048920 | Bacteria | 4901 |
| 590 | Ga0496117_0027433 | 3300048920 | Bacteria | 4438 |
| 591 | Ga0496117_0034236 | 3300048920 | Bacteria | 3830 |
| 592 | Ga0496117_0057092 | 3300048920 | Bacteria | 2714 |
| 593 | Ga0496117_0111376 | 3300048920 | Bacteria | 1704 |
| 594 | Ga0496117_0128328 | 3300048920 | Bacteria | 1542 |
| 595 | Ga0496118_0000285 | 3300048921 | Bacteria | 88805 |
| 596 | Ga0496118_0000901 | 3300048921 | Bacteria | 46540 |
| 597 | Ga0496118_0005641 | 3300048921 | Bacteria | 14116 |
| 598 | Ga0496118_0006842 | 3300048921 | Bacteria | 12373 |
| 599 | Ga0496118_0011088 | 3300048921 | Bacteria | 8846 |
| 600 | Ga0496118_0024301 | 3300048921 | Bacteria | 5236 |
| 601 | Ga0496118_0040516 | 3300048921 | Bacteria | 3703 |
| 602 | Ga0496118_0042672 | 3300048921 | Bacteria | 3576 |
| 603 | Ga0496118_0125479 | 3300048921 | Bacteria | 1662 |
| 604 | Ga0496118_0263748 | 3300048921 | Bacteria | 970 |
| 605 | Ga0496119_0000232 | 3300048922 | Bacteria | 78129 |
| 606 | Ga0496119_0000838 | 3300048922 | Bacteria | 40796 |
| 607 | Ga0496119_0008828 | 3300048922 | Bacteria | 8770 |
| 608 | Ga0496119_0141335 | 3300048922 | Bacteria | 1299 |
| 609 | Ga0496120_0000061 | 3300048923 | Bacteria | 172817 |
| 610 | Ga0496120_0005812 | 3300048923 | Bacteria | 9665 |
| 611 | Ga0496120_0030913 | 3300048923 | Bacteria | 3249 |
| 612 | Ga0496121_0000072 | 3300048924 | Bacteria | 244975 |
| 613 | Ga0496121_0000356 | 3300048924 | Bacteria | 94447 |
| 614 | Ga0496121_0000512 | 3300048924 | Bacteria | 73820 |
| 615 | Ga0496121_0000653 | 3300048924 | Bacteria | 64947 |
| 616 | Ga0496121_0001101 | 3300048924 | Bacteria | 47588 |
| 617 | Ga0496121_0002248 | 3300048924 | Bacteria | 30091 |
| 618 | Ga0496121_0003957 | 3300048924 | Bacteria | 20469 |
| 619 | Ga0496121_0008027 | 3300048924 | Bacteria | 12589 |
| 620 | Ga0496121_0012732 | 3300048924 | Bacteria | 9119 |
| 621 | Ga0496121_0018515 | 3300048924 | Bacteria | 7018 |
| 622 | Ga0496121_0022798 | 3300048924 | Bacteria | 6053 |
| 623 | Ga0496121_0162779 | 3300048924 | Bacteria | 1629 |
| 624 | Ga0496122_0000269 | 3300048925 | Bacteria | 116292 |
| 625 | Ga0496122_0001374 | 3300048925 | Bacteria | 39556 |
| 626 | Ga0496122_0005977 | 3300048925 | Bacteria | 14244 |
| 627 | Ga0496122_0006100 | 3300048925 | Bacteria | 14037 |
| 628 | Ga0496122_0008406 | 3300048925 | Bacteria | 11149 |
| 629 | Ga0496122_0014497 | 3300048925 | Bacteria | 7610 |
| 630 | Ga0496122_0081914 | 3300048925 | Bacteria | 2244 |
| 631 | Ga0496122_0168932 | 3300048925 | Bacteria | 1321 |
| 632 | Ga0496122_0208372 | 3300048925 | Bacteria | 1135 |
| 633 | Ga0496123_0000712 | 3300048926 | Bacteria | 54440 |
| 634 | Ga0496123_0000858 | 3300048926 | Bacteria | 48557 |
| 635 | Ga0496123_0001146 | 3300048926 | Bacteria | 39552 |
| 636 | Ga0496123_0017870 | 3300048926 | Bacteria | 5680 |
| 637 | Ga0496123_0024155 | 3300048926 | Bacteria | 4628 |
| 638 | Ga0496123_0026785 | 3300048926 | Bacteria | 4311 |
| 639 | Ga0496123_0033685 | 3300048926 | Bacteria | 3681 |
| 640 | Ga0496123_0185333 | 3300048926 | Bacteria | 1082 |
| 641 | Ga0496124_0000110 | 3300048927 | Bacteria | 166321 |
| 642 | Ga0496124_0000306 | 3300048927 | Bacteria | 90641 |
| 643 | Ga0496124_0000320 | 3300048927 | Bacteria | 88704 |
| 644 | Ga0496124_0001208 | 3300048927 | Bacteria | 40031 |
| 645 | Ga0496124_0001811 | 3300048927 | Bacteria | 29573 |
| 646 | Ga0496124_0002707 | 3300048927 | Bacteria | 22633 |
| 647 | Ga0496124_0006398 | 3300048927 | Bacteria | 12841 |
| 648 | Ga0496124_0007499 | 3300048927 | Bacteria | 11584 |
| 649 | Ga0496124_0034267 | 3300048927 | Bacteria | 4458 |
| 650 | Ga0496124_0180787 | 3300048927 | Bacteria | 1623 |
| 651 | Ga0496124_0192750 | 3300048927 | Bacteria | 1557 |
| 652 | Ga0496124_0272229 | 3300048927 | Bacteria | 1239 |
| 653 | Ga0496124_0389584 | 3300048927 | Bacteria | 971 |
| 654 | Ga0496124_0675665 | 3300048927 | Bacteria | 658 |
| 655 | Ga0496125_0002079 | 3300048928 | Bacteria | 26983 |
| 656 | Ga0496125_0002282 | 3300048928 | Bacteria | 25394 |
| 657 | Ga0496125_0006415 | 3300048928 | Bacteria | 12716 |
| 658 | Ga0496125_0007599 | 3300048928 | Bacteria | 11509 |
| 659 | Ga0496125_0016849 | 3300048928 | Bacteria | 7000 |
| 660 | Ga0496125_0027074 | 3300048928 | Bacteria | 5206 |
| 661 | Ga0496125_0027965 | 3300048928 | Bacteria | 5100 |
| 662 | Ga0496125_0056267 | 3300048928 | Bacteria | 3196 |
| 663 | Ga0496125_0244594 | 3300048928 | Bacteria | 1136 |
| 664 | Ga0496125_0307452 | 3300048928 | Bacteria | 968 |
| 665 | Ga0496125_0323857 | 3300048928 | Bacteria | 933 |
| 666 | Ga0496125_0331907 | 3300048928 | Bacteria | 917 |
| 667 | Ga0496125_0496916 | 3300048928 | Bacteria | 687 |
| 668 | Ga0496126_0000219 | 3300048929 | Bacteria | 125157 |
| 669 | Ga0496126_0000655 | 3300048929 | Bacteria | 64225 |
| 670 | Ga0496126_0001930 | 3300048929 | Bacteria | 29576 |
| 671 | Ga0496126_0002197 | 3300048929 | Bacteria | 27072 |
| 672 | Ga0496126_0014860 | 3300048929 | Bacteria | 7853 |
| 673 | Ga0496126_0015060 | 3300048929 | Bacteria | 7794 |
| 674 | Ga0496126_0015817 | 3300048929 | Bacteria | 7577 |
| 675 | Ga0496126_0036932 | 3300048929 | Bacteria | 4564 |
| 676 | Ga0495682_0005648 | 3300049460 | Bacteria | 5173 |
| 677 | Ga0501033_0089759 | 3300049570 | Bacteria | 2248 |
| 678 | Ga0501034_0614122 | 3300049571 | Bacteria | 992 |
| 679 | Ga0501043_0059375 | 3300049579 | Bacteria | 3002 |
| 680 | Ga0501043_0278559 | 3300049579 | Bacteria | 1282 |
| 681 | Ga0501047_0703660 | 3300049581 | Bacteria | 828 |
| 682 | Ga0501044_0030400 | 3300049823 | Bacteria | 5693 |
| 683 | Ga0501044_0421919 | 3300049823 | Bacteria | 1244 |
| 684 | nmdc:mga03n38_5604_c1 | 3300050490 | Bacteria | 4290 |
| 685 | nmdc:mga03n38_5774_c1 | 3300050490 | Bacteria | 4247 |
| 686 | nmdc:mga06z11_352_c1 | 3300050494 | Bacteria | 17353 |
| 687 | nmdc:mga06z11_841_c1 | 3300050494 | Bacteria | 11233 |
| 688 | nmdc:mga04h51_185_c1 | 3300050495 | Bacteria | 17353 |
| 689 | nmdc:mga04h51_361_c1 | 3300050495 | Bacteria | 11233 |
| 690 | nmdc:mga07m45_1668_c1 | 3300050496 | Bacteria | 10212 |
| 691 | nmdc:mga0n895_200008_c1 | 3300050512 | Bacteria | 2029 |
| 692 | nmdc:mga0rr50_119420_c1 | 3300050513 | Bacteria | 2096 |
| 693 | nmdc:mga08x19_12208_c1 | 3300050514 | Bacteria | 5171 |
| 694 | nmdc:mga0sz30_14580_c1 | 3300050516 | Bacteria | 3096 |
| 695 | Ga0500610_0000059 | 3300053079 | Bacteria | 34324 |
| 696 | Ga0500583_0049662 | 3300053092 | Bacteria | 1942 |
| 697 | Ga0500583_0055735 | 3300053092 | Bacteria | 1849 |
| 698 | Ga0500641_0045965 | 3300053096 | Bacteria | 1780 |
| 699 | Ga0500555_000209 | 3300053103 | Bacteria | 27373 |
| 700 | Ga0500595_000530 | 3300053119 | Bacteria | 23016 |
| 701 | Ga0500607_162406 | 3300053121 | Bacteria | 1019 |
| 702 | Ga0500608_059233 | 3300053122 | Bacteria | 1832 |
| 703 | Ga0500652_088265 | 3300053131 | Bacteria | 1294 |
| 704 | Ga0500658_0001200 | 3300053134 | Bacteria | 10542 |
| 705 | Ga0500559_0011287 | 3300053136 | Bacteria | 3818 |
| 706 | Ga0500559_0066765 | 3300053136 | Bacteria | 1614 |
| 707 | Ga0500568_0012470 | 3300053139 | Bacteria | 3908 |
| 708 | Ga0500568_0021691 | 3300053139 | Bacteria | 2760 |
| 709 | Ga0500590_000472 | 3300053148 | Bacteria | 13775 |
| 710 | Ga0500604_0082088 | 3300053151 | Bacteria | 1042 |
| 711 | Ga0500616_0101838 | 3300053153 | Bacteria | 1402 |
| 712 | Ga0500616_0140209 | 3300053153 | Bacteria | 1131 |
| 713 | Ga0500619_015417 | 3300053154 | Bacteria | 2078 |
| 714 | Ga0500627_0000195 | 3300053158 | Bacteria | 17448 |
| 715 | Ga0500637_0040459 | 3300053178 | Bacteria | 2634 |
| 716 | Ga0500596_000155 | 3300053735 | Bacteria | 10552 |
| 717 | Ga0466962_0009728 | 3300061719 | Bacteria | 4613 |
| 718 | 2512644750 | 2512564014 | Bacteria | 4639632 |
| 719 | 2600226713 | 2599185359 | Bacteria | 4772316 |
| 720 | 2643729220 | 2643221541 | Bacteria | 5498788 |
| 721 | 2644037770 | 2643221605 | Bacteria | 4772303 |
| 722 | 2644045696 | 2643221606 | Bacteria | 5588032 |
| 723 | 2644393273 | 2643221671 | Bacteria | 5496681 |
| 724 | 2738712368 | 2738541275 | Bacteria | 4830863 |
| 725 | 2738850793 | 2738541301 | Bacteria | 4834102 |
| 726 | 2738866522 | 2738541304 | Bacteria | 4833665 |
| 727 | 2739299040 | 2738543022 | Bacteria | 4835059 |
| 728 | 2739360718 | 2738543033 | Bacteria | 4833336 |
| 729 | 2792462218 | 2791355048 | Bacteria | 5832535 |
| 730 | 2809065460 | 2808606401 | Bacteria | 4586670 |
| 731 | 2809081481 | 2808606404 | Bacteria | 4652788 |
| 732 | 2809085792 | 2808606405 | Bacteria | 4586632 |
| 733 | 2819712316 | 2818991466 | Bacteria | 4748179 |
| 734 | 2879165523 | 2879163058 | Bacteria | 4223965 |
| 735 | 2880523571 | 2880518877 | Bacteria | 5012590 |
| 736 | 2928526831 | 2928526807 | Bacteria | 4760224 |
| 737 | 2928963313 | 2928959182 | Bacteria | 4725774 |
| 738 | 2928969620 | 2928968154 | Bacteria | 4633371 |
| 739 | 8057104116 | 8057101203 | Bacteria | 5034064 |
| 740 | Ga0070662_100229894 | |||
| 741 | SwRhRL2b_contig_1650000 | |||
| 742 | SwRhRL2b_contig_1793279 | |||
| 743 | SwRhRL2b_contig_3665959 | |||
| 744 | JGI24741J21665_1003678 | |||
| 745 | JGI24752J21851_1000248 | |||
| 746 | JGI24740J21852_10003526 | |||
| 747 | JGI24739J22299_10004763 | |||
| 748 | JGI24739J22299_10109312 | |||
| 749 | JGI24739J22299_10109411 | |||
| 750 | JGI24737J22298_10001206 | |||
| 751 | JGI24737J22298_10002877 | |||
| 752 | JGI24737J22298_10053337 | |||
| 753 | JGI24743J22301_10014071 | |||
| 754 | JGI24735J21928_10000508 | |||
| 755 | JGI24735J21928_10004707 | |||
| 756 | JGI24735J21928_10005734 | |||
| 757 | JGI24735J21928_10026103 | |||
| 758 | JGI24748J21848_1003097 | |||
| 759 | JGI24738J21930_10013760 | |||
| 760 | JGI24749J21850_1000256 | |||
| 761 | JGI24751J29686_10000054 | |||
| 762 | JGI25150J39212_1000167 | |||
| 763 | JGI25151J46595_10082065 | |||
| 764 | JGI25165J46597_1000156 | |||
| 765 | JGI25165J46597_1000289 | |||
| 766 | JGI25153J46596_10000016 | |||
| 767 | JGI25153J46596_10000158 | |||
| 768 | JGI25153J46596_10008781 | |||
| 769 | rootH2_10187327 | |||
| 770 | rootL2_10205962 | |||
| 771 | Ga0055525_1000035 | |||
| 772 | Ga0055542_1000132 | |||
| 773 | Ga0055529_1000088 | |||
| 774 | Ga0055526_1003911 | |||
| 775 | Ga0055537_1002542 | |||
| 776 | Ga0055524_1000250 | |||
| 777 | Ga0055530_10005650 | |||
| 778 | Ga0055530_10032168 | |||
| 779 | Ga0055531_10002208 | |||
| 780 | Ga0055543_1034603 | |||
| 781 | Ga0065165_1000284 | |||
| 782 | Ga0065165_1006724 | |||
| 783 | Ga0065704_10072411 | |||
| 784 | Ga0065704_10072823 | |||
| 785 | Ga0065704_10276187 | |||
| 786 | Ga0070658_10000265 | |||
| 787 | Ga0070658_10001217 | |||
| 788 | Ga0070658_10004386 | |||
| 789 | Ga0070658_10005072 | |||
| 790 | Ga0070676_10000135 | |||
| 791 | Ga0070670_100000003 | |||
| 792 | Ga0070670_100002547 | |||
| 793 | Ga0070670_100277463 | |||
| 794 | Ga0068869_100000965 | |||
| 795 | Ga0070666_10024908 | |||
| 796 | Ga0070666_10049820 | |||
| 797 | Ga0068868_100000155 | |||
| 798 | Ga0070660_100001781 | |||
| 799 | Ga0070660_100009128 | |||
| 800 | Ga0070660_100036945 | |||
| 801 | Ga0070660_100143632 | |||
| 802 | Ga0070661_100024033 | |||
| 803 | Ga0070661_100098395 | |||
| 804 | Ga0070668_100001513 | |||
| 805 | Ga0070668_100005762 | |||
| 806 | Ga0070668_100008465 | |||
| 807 | Ga0070668_100124469 | |||
| 808 | Ga0070669_100000020 | |||
| 809 | Ga0070669_100002401 | |||
| 810 | Ga0070669_100046320 | |||
| 811 | Ga0070669_100050134 | |||
| 812 | Ga0070669_100066674 | |||
| 813 | Ga0070669_100115152 | |||
| 814 | Ga0070675_100369873 | |||
| 815 | Ga0070671_100000858 | |||
| 816 | Ga0070671_100128033 | |||
| 817 | Ga0070671_100150001 | |||
| 818 | Ga0070674_100001506 | |||
| 819 | Ga0070673_100000013 | |||
| 820 | Ga0070673_100060240 | |||
| 821 | Ga0070659_100029275 | |||
| 822 | Ga0070659_100036279 | |||
| 823 | Ga0070659_100081921 | |||
| 824 | Ga0070659_100440241 | |||
| 825 | Ga0070667_100000019 | |||
| 826 | Ga0070667_100001705 | |||
| 827 | Ga0070667_100007648 | |||
| 828 | Ga0070667_100007908 | |||
| 829 | Ga0070667_100017940 | |||
| 830 | Ga0070667_100089557 | |||
| 831 | Ga0070667_101013779 | |||
| 832 | Ga0070711_100228271 | |||
| 833 | Ga0070705_100562733 | |||
| 834 | Ga0070663_100087917 | |||
| 835 | Ga0070678_100000187 | |||
| 836 | Ga0070662_100001289 | |||
| 837 | Ga0070662_100020720 | |||
| 838 | Ga0070662_100021818 | |||
| 839 | Ga0070662_100046847 | |||
| 840 | Ga0068867_100000009 | |||
| 841 | Ga0068867_100069173 | |||
| 842 | Ga0068867_100102850 | |||
| 843 | Ga0068853_100001142 | |||
| 844 | Ga0068853_100100752 | |||
| 845 | Ga0068853_100359947 | |||
| 846 | Ga0070665_100000385 | |||
| 847 | Ga0070665_100002939 | |||
| 848 | Ga0070665_100011694 | |||
| 849 | Ga0070665_100022421 | |||
| 850 | Ga0070665_100065537 | |||
| 851 | Ga0068855_100123487 | |||
| 852 | Ga0068855_100326074 | |||
| 853 | Ga0068855_100430430 | |||
| 854 | Ga0068855_100506348 | |||
| 855 | Ga0068855_100836633 | |||
| 856 | Ga0068855_101038504 | |||
| 857 | Ga0070664_100257696 | |||
| 858 | Ga0068857_100004484 | |||
| 859 | Ga0068857_100030929 | |||
| 860 | Ga0068857_100108017 | |||
| 861 | Ga0068854_100001459 | |||
| 862 | Ga0068854_100011043 | |||
| 863 | Ga0068854_100018465 | |||
| 864 | Ga0068854_100097502 | |||
| 865 | Ga0068854_100222969 | |||
| 866 | Ga0068856_100007394 | |||
| 867 | Ga0068856_100075361 | |||
| 868 | Ga0068852_100002750 | |||
| 869 | Ga0068852_100051698 | |||
| 870 | Ga0068859_100007640 | |||
| 871 | Ga0068859_100040574 | |||
| 872 | Ga0068859_100041065 | |||
| 873 | Ga0068859_100063321 | |||
| 874 | Ga0068864_100000005 | |||
| 875 | Ga0068864_100000021 | |||
| 876 | Ga0068864_100001977 | |||
| 877 | Ga0068861_100004363 | |||
| 878 | Ga0068861_100059995 | |||
| 879 | Ga0068863_100005477 | |||
| 880 | Ga0068863_100006774 | |||
| 881 | Ga0068863_100014465 | |||
| 882 | Ga0068863_100017809 | |||
| 883 | Ga0068863_100101045 | |||
| 884 | Ga0068858_100000138 | |||
| 885 | Ga0068858_100000769 | |||
| 886 | Ga0068858_100015762 | |||
| 887 | Ga0068860_100000042 | |||
| 888 | Ga0068860_100001393 | |||
| 889 | Ga0068862_100000001 | |||
| 890 | Ga0068862_100000158 | |||
| 891 | Ga0068862_100005645 | |||
| 892 | Ga0068862_100006948 | |||
| 893 | Ga0068862_100016278 | |||
| 894 | Ga0068862_100342463 | |||
| 895 | Ga0068862_100634321 | |||
| 896 | Ga0081539_10013835 | |||
| 897 | Ga0070717_10285242 | |||
| 898 | Ga0075368_10000243 | |||
| 899 | Ga0075368_10002102 | |||
| 900 | Ga0075363_100001469 | |||
| 901 | Ga0075363_100028702 | |||
| 902 | Ga0070715_10272291 | |||
| 903 | Ga0070716_100297830 | |||
| 904 | Ga0075367_10000651 | |||
| 905 | Ga0075367_10005198 | |||
| 906 | Ga0075369_10237373 | |||
| 907 | Ga0075370_10019573 | |||
| 908 | Ga0068871_100067445 | |||
| 909 | Ga0068871_100350382 | |||
| 910 | Ga0075434_100225804 | |||
| 911 | Ga0068865_100000005 | |||
| 912 | Ga0097620_100007640 | |||
| 913 | Ga0097620_100040576 | |||
| 914 | Ga0097620_100041062 | |||
| 915 | Ga0097620_100063324 | |||
| 916 | Ga0075435_100117537 | |||
| 917 | Ga0105251_10000253 | |||
| 918 | Ga0105251_10004109 | |||
| 919 | Ga0105251_10042819 | |||
| 920 | Ga0105240_10008344 | |||
| 921 | Ga0105240_10024971 | |||
| 922 | Ga0105240_10025167 | |||
| 923 | Ga0105240_10038048 | |||
| 924 | Ga0105240_10069900 | |||
| 925 | Ga0105240_10359924 | |||
| 926 | Ga0105245_10006241 | |||
| 927 | Ga0105247_10087507 | |||
| 928 | Ga0105243_10000032 | |||
| 929 | Ga0105243_10000077 | |||
| 930 | Ga0105243_10045805 | |||
| 931 | Ga0105241_10003044 | |||
| 932 | Ga0105241_10674168 | |||
| 933 | Ga0105242_10000148 | |||
| 934 | Ga0105248_10000086 | |||
| 935 | Ga0105248_10101066 | |||
| 936 | Ga0105237_10001230 | |||
| 937 | Ga0105237_10001347 | |||
| 938 | Ga0105237_10039220 | |||
| 939 | Ga0105237_10122815 | |||
| 940 | Ga0105238_10164534 | |||
| 941 | Ga0105238_10209676 | |||
| 942 | Ga0105238_10269778 | |||
| 943 | Ga0105249_10001047 | |||
| 944 | Ga0105249_10006483 | |||
| 945 | Ga0105249_10047250 | |||
| 946 | Ga0105249_10072524 | |||
| 947 | Ga0105249_10131182 | |||
| 948 | Ga0105239_10000113 | |||
| 949 | Ga0105239_10004322 | |||
| 950 | Ga0105239_10068549 | |||
| 951 | Ga0105239_10302756 | |||
| 952 | Ga0105246_10001422 | |||
| 953 | Ga0157373_10057752 | |||
| 954 | Ga0157373_10489871 | |||
| 955 | Ga0157371_10000048 | |||
| 956 | Ga0157371_10067695 | |||
| 957 | Ga0157371_10158952 | |||
| 958 | Ga0157371_10312025 | |||
| 959 | Ga0157370_10000176 | |||
| 960 | Ga0157369_10010454 | |||
| 961 | Ga0157369_10053466 | |||
| 962 | Ga0157369_10140664 | |||
| 963 | Ga0157374_10005361 | |||
| 964 | Ga0157374_10164712 | |||
| 965 | Ga0157378_10005618 | |||
| 966 | Ga0157378_10059632 | |||
| 967 | Ga0163162_10013809 | |||
| 968 | Ga0163162_10771050 | |||
| 969 | Ga0157372_10003759 | |||
| 970 | Ga0157372_10103674 | |||
| 971 | Ga0157372_10259845 | |||
| 972 | Ga0157372_10377717 | |||
| 973 | Ga0157372_10511185 | |||
| 974 | Ga0157375_10000636 | |||
| 975 | Ga0163163_10028250 | |||
| 976 | Ga0163163_10806620 | |||
| 977 | Ga0157380_10000057 | |||
| 978 | Ga0157380_10000060 | |||
| 979 | Ga0157380_10115317 | |||
| 980 | Ga0157377_10010382 | |||
| 981 | Ga0157379_10108914 | |||
| 982 | Ga0157379_10293257 | |||
| 983 | Ga0157376_10000244 | |||
| 984 | Ga0183363_1011 | |||
| 985 | Ga0163161_10016808 | |||
| 986 | Ga0206353_11472309 | |||
| 987 | Ga0213872_10007952 | |||
| 988 | Ga0213872_10008732 | |||
| 989 | Ga0213872_10012664 | |||
| 990 | Ga0213872_10031207 | |||
| 991 | Ga0213872_10032154 | |||
| 992 | Ga0213872_10173239 | |||
| 993 | Ga0213872_10177789 | |||
| 994 | Ga0209147_100263 | |||
| 995 | Ga0209563_100047 | |||
| 996 | Ga0207427_100436 | |||
| 997 | Ga0207425_1000019 | |||
| 998 | Ga0207425_1011296 | |||
| 999 | Ga0209026_1001456 | |||
| 1000 | Ga0209026_1015603 | |||
| 1001 | Ga0209148_1000017 | |||
| 1002 | Ga0209148_1000457 | |||
| 1003 | Ga0209148_1000736 | |||
| 1004 | Ga0209129_1000413 | |||
| 1005 | Ga0209233_1000213 | |||
| 1006 | Ga0209233_1000291 | |||
| 1007 | Ga0209565_1000030 | |||
| 1008 | Ga0209565_1000314 | |||
| 1009 | Ga0209455_1000005 | |||
| 1010 | Ga0209455_1001006 | |||
| 1011 | Ga0209673_1001192 | |||
| 1012 | Ga0209675_1014328 | |||
| 1013 | Ga0209676_1076997 | |||
| 1014 | Ga0209025_1000559 | |||
| 1015 | Ga0209564_1000670 | |||
| 1016 | Ga0209564_1004569 | |||
| 1017 | Ga0209758_1000019 | |||
| 1018 | Ga0209758_1000035 | |||
| 1019 | Ga0209758_1005071 | |||
| 1020 | Ga0209050_1000001 | |||
| 1021 | Ga0209050_1001657 | |||
| 1022 | Ga0209050_1007464 | |||
| 1023 | Ga0209050_1007633 | |||
| 1024 | Ga0209050_1057367 | |||
| 1025 | Ga0209256_1000046 | |||
| 1026 | Ga0209256_1010036 | |||
| 1027 | Ga0209051_1002722 | |||
| 1028 | Ga0209257_1000111 | |||
| 1029 | Ga0209257_1000395 | |||
| 1030 | Ga0209257_1010870 | |||
| 1031 | Ga0209257_1015873 | |||
| 1032 | Ga0207656_10005643 | |||
| 1033 | Ga0207696_1003816 | |||
| 1034 | Ga0207713_1000266 | |||
| 1035 | Ga0207713_1003594 | |||
| 1036 | Ga0207713_1010826 | |||
| 1037 | Ga0207710_10094100 | |||
| 1038 | Ga0207710_10280844 | |||
| 1039 | Ga0207647_10000068 | |||
| 1040 | Ga0207647_10015339 | |||
| 1041 | Ga0207647_10017721 | |||
| 1042 | Ga0207645_10000416 | |||
| 1043 | Ga0207705_10000583 | |||
| 1044 | Ga0207705_10000665 | |||
| 1045 | Ga0207705_10012795 | |||
| 1046 | Ga0207705_10067611 | |||
| 1047 | Ga0207654_10000587 | |||
| 1048 | Ga0207695_10006747 | |||
| 1049 | Ga0207695_10015458 | |||
| 1050 | Ga0207695_10019521 | |||
| 1051 | Ga0207695_10022134 | |||
| 1052 | Ga0207695_10047354 | |||
| 1053 | Ga0207695_10051781 | |||
| 1054 | Ga0207695_10346441 | |||
| 1055 | Ga0207671_10001107 | |||
| 1056 | Ga0207671_10002399 | |||
| 1057 | Ga0207671_10015428 | |||
| 1058 | Ga0207671_10031391 | |||
| 1059 | Ga0207693_10011415 | |||
| 1060 | Ga0207663_10023856 | |||
| 1061 | Ga0207657_10002418 | |||
| 1062 | Ga0207657_10006429 | |||
| 1063 | Ga0207657_10009661 | |||
| 1064 | Ga0207657_10023846 | |||
| 1065 | Ga0207657_10108096 | |||
| 1066 | Ga0207649_10000795 | |||
| 1067 | Ga0207649_10531344 | |||
| 1068 | Ga0207681_10000005 | |||
| 1069 | Ga0207681_10001728 | |||
| 1070 | Ga0207681_10003742 | |||
| 1071 | Ga0207681_10151488 | |||
| 1072 | Ga0207681_10226125 | |||
| 1073 | Ga0207681_10235331 | |||
| 1074 | Ga0207694_10004292 | |||
| 1075 | Ga0207694_10066780 | |||
| 1076 | Ga0207650_10000004 | |||
| 1077 | Ga0207650_10001292 | |||
| 1078 | Ga0207650_10002951 | |||
| 1079 | Ga0207650_10062646 | |||
| 1080 | Ga0207659_10318760 | |||
| 1081 | Ga0207687_10004279 | |||
| 1082 | Ga0207644_10000089 | |||
| 1083 | Ga0207644_10001935 | |||
| 1084 | Ga0207644_10103524 | |||
| 1085 | Ga0207690_10002864 | |||
| 1086 | Ga0207690_10038499 | |||
| 1087 | Ga0207706_10011382 | |||
| 1088 | Ga0207706_10015188 | |||
| 1089 | Ga0207706_10015296 | |||
| 1090 | Ga0207706_10038770 | |||
| 1091 | Ga0207686_10000743 | |||
| 1092 | Ga0207709_10000051 | |||
| 1093 | Ga0207709_10000110 | |||
| 1094 | Ga0207709_10014707 | |||
| 1095 | Ga0207669_10000015 | |||
| 1096 | Ga0207704_10000001 | |||
| 1097 | Ga0207665_10085984 | |||
| 1098 | Ga0207691_10023627 | |||
| 1099 | Ga0207711_10000460 | |||
| 1100 | Ga0207711_10002321 | |||
| 1101 | Ga0207689_10006900 | |||
| 1102 | Ga0207667_10000004 | |||
| 1103 | Ga0207667_10010934 | |||
| 1104 | Ga0207667_10082377 | |||
| 1105 | Ga0207667_10660806 | |||
| 1106 | Ga0207667_10669769 | |||
| 1107 | Ga0207651_10000006 | |||
| 1108 | Ga0207651_10500607 | |||
| 1109 | Ga0207712_10000754 | |||
| 1110 | Ga0207712_10056247 | |||
| 1111 | Ga0207712_10091446 | |||
| 1112 | Ga0207668_10000565 | |||
| 1113 | Ga0207668_10005073 | |||
| 1114 | Ga0207668_10014334 | |||
| 1115 | Ga0207668_10021629 | |||
| 1116 | Ga0207640_10004471 | |||
| 1117 | Ga0207640_10010286 | |||
| 1118 | Ga0207640_10075492 | |||
| 1119 | Ga0207658_10000002 | |||
| 1120 | Ga0207658_10001897 | |||
| 1121 | Ga0207658_10003845 | |||
| 1122 | Ga0207658_10005180 | |||
| 1123 | Ga0207658_10011727 | |||
| 1124 | Ga0207658_10035471 | |||
| 1125 | Ga0207677_10003122 | |||
| 1126 | Ga0207703_10000208 | |||
| 1127 | Ga0207703_10000686 | |||
| 1128 | Ga0207703_10083199 | |||
| 1129 | Ga0207639_10001247 | |||
| 1130 | Ga0207639_10006058 | |||
| 1131 | Ga0207639_10050993 | |||
| 1132 | Ga0207639_10078570 | |||
| 1133 | Ga0207639_10631413 | |||
| 1134 | Ga0207678_10028634 | |||
| 1135 | Ga0207678_11023084 | |||
| 1136 | Ga0207702_10005914 | |||
| 1137 | Ga0207702_10006519 | |||
| 1138 | Ga0207702_10018630 | |||
| 1139 | Ga0207702_10099834 | |||
| 1140 | Ga0207641_10000017 | |||
| 1141 | Ga0207641_10006143 | |||
| 1142 | Ga0207641_10017027 | |||
| 1143 | Ga0207641_10047342 | |||
| 1144 | Ga0207641_10065623 | |||
| 1145 | Ga0207641_10081182 | |||
| 1146 | Ga0207648_10000022 | |||
| 1147 | Ga0207648_10140015 | |||
| 1148 | Ga0207676_10000006 | |||
| 1149 | Ga0207676_10000037 | |||
| 1150 | Ga0207674_10006117 | |||
| 1151 | Ga0207674_10013572 | |||
| 1152 | Ga0207674_10022656 | |||
| 1153 | Ga0207674_10070699 | |||
| 1154 | Ga0207674_10107392 | |||
| 1155 | Ga0207674_10130694 | |||
| 1156 | Ga0207675_100000195 | |||
| 1157 | Ga0207675_100111626 | |||
| 1158 | Ga0207683_10000954 | |||
| 1159 | Ga0207698_10001904 | |||
| 1160 | Ga0207698_10112272 | |||
| 1161 | Ga0207698_11065545 | |||
| 1162 | Ga0209813_10000102 | |||
| 1163 | Ga0209813_10000375 | |||
| 1164 | Ga0268266_10000338 | |||
| 1165 | Ga0268266_10017809 | |||
| 1166 | Ga0268266_10022870 | |||
| 1167 | Ga0268265_10000001 | |||
| 1168 | Ga0268265_10000673 | |||
| 1169 | Ga0268265_10000863 | |||
| 1170 | Ga0268265_10003220 | |||
| 1171 | Ga0268265_10010725 | |||
| 1172 | Ga0268265_10083823 | |||
| 1173 | Ga0268265_10910722 | |||
| 1174 | Ga0268264_10000001 | |||
| 1175 | Ga0268264_10001067 | |||
| 1176 | Ga0268264_10005380 | |||
| 1177 | Ga0268264_10019007 | |||
| 1178 | Ga0268264_10652556 | |||
| 1179 | Ga0307515_10012945 | |||
| 1180 | Ga0307408_100020416 | |||
| 1181 | Ga0307408_100034108 | |||
| 1182 | Ga0307405_10017441 | |||
| 1183 | Ga0307405_10126432 | |||
| 1184 | Ga0307413_10068780 | |||
| 1185 | Ga0307413_10141758 | |||
| 1186 | Ga0307413_10209837 | |||
| 1187 | Ga0307410_10003830 | |||
| 1188 | Ga0307410_10092451 | |||
| 1189 | Ga0307406_10020393 | |||
| 1190 | Ga0307406_10062514 | |||
| 1191 | Ga0307407_10041308 | |||
| 1192 | Ga0307412_10003194 | |||
| 1193 | Ga0307412_10003934 | |||
| 1194 | Ga0307412_10010732 | |||
| 1195 | Ga0307412_10086032 | |||
| 1196 | Ga0307409_100181713 | |||
| 1197 | Ga0307409_100959967 | |||
| 1198 | Ga0307416_101743361 | |||
| 1199 | Ga0307414_10056562 | |||
| 1200 | Ga0307414_10298234 | |||
| 1201 | Ga0307414_10593998 | |||
| 1202 | Ga0307510_10156800 | |||
| 1203 | Ga0395899_0006882 | |||
| 1204 | Ga0395899_0275288 | |||
| 1205 | Ga0395905_0029762 | |||
| 1206 | Ga0395901_0051879 | |||
| 1207 | Ga0237819_02847 | |||
| 1208 | Ga0237816_01980 | |||
| 1209 | Ga0436361_0054467 | |||
| 1210 | Ga0436361_0101796 | |||
| 1211 | Ga0436361_0294799 | |||
| 1212 | Ga0436361_0377188 | |||
| 1213 | Ga0436361_0470588 | |||
| 1214 | Ga0436361_0578054 | |||
| 1215 | Ga0436361_0607077 | |||
| 1216 | Ga0436361_0608675 | |||
| 1217 | Ga0436361_0854789 | |||
| 1218 | Ga0436361_1023646 | |||
| 1219 | Ga0436361_1202216 | |||
| 1220 | Ga0451833_0136820 | |||
| 1221 | Ga0439448_0029509 | |||
| 1222 | Ga0439455_0007153 | |||
| 1223 | Ga0439458_0000470 | |||
| 1224 | Ga0466966_0172887 | |||
| 1225 | Ga0466971_0032564 | |||
| 1226 | Ga0466957_0261871 | |||
| 1227 | Ga0466967_0029645 | |||
| 1228 | Ga0495617_021739 | |||
| 1229 | Ga0495617_045276 | |||
| 1230 | Ga0495627_002167 | |||
| 1231 | Ga0495638_0000336 | |||
| 1232 | Ga0495638_0003765 | |||
| 1233 | Ga0495638_0223637 | |||
| 1234 | Ga0495650_0000302 | |||
| 1235 | Ga0495584_0044514 | |||
| 1236 | Ga0495585_0004581 | |||
| 1237 | Ga0495596_0001091 | |||
| 1238 | Ga0495596_0007393 | |||
| 1239 | Ga0495607_0008994 | |||
| 1240 | Ga0495583_0000023 | |||
| 1241 | Ga0495583_0002372 | |||
| 1242 | Ga0495583_0005352 | |||
| 1243 | Ga0495606_0000809 | |||
| 1244 | Ga0495606_0009634 | |||
| 1245 | Ga0495606_0016375 | |||
| 1246 | Ga0495606_0278950 | |||
| 1247 | Ga0495610_0003133 | |||
| 1248 | Ga0495610_0009533 | |||
| 1249 | Ga0495610_0069738 | |||
| 1250 | Ga0495616_0000013 | |||
| 1251 | Ga0495616_0077953 | |||
| 1252 | Ga0495632_0301278 | |||
| 1253 | Ga0495637_0103624 | |||
| 1254 | Ga0495643_0001684 | |||
| 1255 | Ga0495643_0005282 | |||
| 1256 | Ga0495643_0021178 | |||
| 1257 | Ga0495643_0161224 | |||
| 1258 | Ga0495648_0000088 | |||
| 1259 | Ga0495652_0257817 | |||
| 1260 | Ga0495587_0064229 | |||
| 1261 | Ga0495622_0001921 | |||
| 1262 | Ga0495633_0022857 | |||
| 1263 | Ga0495633_0092264 | |||
| 1264 | Ga0495668_0028309 | |||
| 1265 | Ga0495668_0210047 | |||
| 1266 | Ga0495611_0071050 | |||
| 1267 | Ga0495625_0001696 | |||
| 1268 | Ga0495625_0018082 | |||
| 1269 | Ga0495661_0018024 | |||
| 1270 | Ga0495661_0052699 | |||
| 1271 | Ga0495670_0000003 | |||
| 1272 | Ga0495670_0024660 | |||
| 1273 | Ga0495600_0048688 | |||
| 1274 | Ga0495687_000192 | |||
| 1275 | Ga0495687_003523 | |||
| 1276 | Ga0495687_103589 | |||
| 1277 | Ga0495677_0003309 | |||
| 1278 | Ga0495673_0017400 | |||
| 1279 | Ga0495673_0068295 | |||
| 1280 | Ga0495681_0000003 | |||
| 1281 | Ga0495681_0152612 | |||
| 1282 | Ga0495686_0000124 | |||
| 1283 | Ga0495686_0000383 | |||
| 1284 | Ga0495686_0000550 | |||
| 1285 | Ga0495686_0002025 | |||
| 1286 | Ga0495686_0002694 | |||
| 1287 | Ga0495686_0003151 | |||
| 1288 | Ga0495686_0003367 | |||
| 1289 | Ga0495686_0004993 | |||
| 1290 | Ga0495686_0046677 | |||
| 1291 | Ga0495686_0079422 | |||
| 1292 | Ga0495626_0000890 | |||
| 1293 | Ga0496100_0081646 | |||
| 1294 | Ga0496101_0243480 | |||
| 1295 | Ga0496102_0000125 | |||
| 1296 | Ga0496102_0000555 | |||
| 1297 | Ga0496102_0001484 | |||
| 1298 | Ga0496103_0000111 | |||
| 1299 | Ga0496103_0000322 | |||
| 1300 | Ga0496103_0000557 | |||
| 1301 | Ga0496103_0020230 | |||
| 1302 | Ga0496103_0111519 | |||
| 1303 | Ga0496104_0005088 | |||
| 1304 | Ga0496104_0012726 | |||
| 1305 | Ga0496105_0000261 | |||
| 1306 | Ga0496105_0006966 | |||
| 1307 | Ga0496105_0036203 | |||
| 1308 | Ga0496107_0080966 | |||
| 1309 | Ga0496108_0003893 | |||
| 1310 | Ga0496109_0251953 | |||
| 1311 | Ga0496110_0041185 | |||
| 1312 | Ga0496110_0343671 | |||
| 1313 | Ga0496112_0006155 | |||
| 1314 | Ga0496113_0000042 | |||
| 1315 | Ga0496114_0001428 | |||
| 1316 | Ga0496115_0000142 | |||
| 1317 | Ga0496115_0101045 | |||
| 1318 | Ga0496116_0001007 | |||
| 1319 | Ga0496116_0001035 | |||
| 1320 | Ga0496116_0002161 | |||
| 1321 | Ga0496116_0040950 | |||
| 1322 | Ga0496116_0044255 | |||
| 1323 | Ga0496116_0059986 | |||
| 1324 | Ga0496117_0000414 | |||
| 1325 | Ga0496117_0001978 | |||
| 1326 | Ga0496117_0002434 | |||
| 1327 | Ga0496117_0012452 | |||
| 1328 | Ga0496117_0023551 | |||
| 1329 | Ga0496117_0027433 | |||
| 1330 | Ga0496117_0034236 | |||
| 1331 | Ga0496117_0057092 | |||
| 1332 | Ga0496117_0111376 | |||
| 1333 | Ga0496117_0128328 | |||
| 1334 | Ga0496118_0000285 | |||
| 1335 | Ga0496118_0000901 | |||
| 1336 | Ga0496118_0005641 | |||
| 1337 | Ga0496118_0006842 | |||
| 1338 | Ga0496118_0011088 | |||
| 1339 | Ga0496118_0024301 | |||
| 1340 | Ga0496118_0040516 | |||
| 1341 | Ga0496118_0042672 | |||
| 1342 | Ga0496118_0125479 | |||
| 1343 | Ga0496118_0263748 | |||
| 1344 | Ga0496119_0000232 | |||
| 1345 | Ga0496119_0000838 | |||
| 1346 | Ga0496119_0008828 | |||
| 1347 | Ga0496119_0141335 | |||
| 1348 | Ga0496120_0000061 | |||
| 1349 | Ga0496120_0005812 | |||
| 1350 | Ga0496120_0030913 | |||
| 1351 | Ga0496121_0000072 | |||
| 1352 | Ga0496121_0000356 | |||
| 1353 | Ga0496121_0000512 | |||
| 1354 | Ga0496121_0000653 | |||
| 1355 | Ga0496121_0001101 | |||
| 1356 | Ga0496121_0002248 | |||
| 1357 | Ga0496121_0003957 | |||
| 1358 | Ga0496121_0008027 | |||
| 1359 | Ga0496121_0012732 | |||
| 1360 | Ga0496121_0018515 | |||
| 1361 | Ga0496121_0022798 | |||
| 1362 | Ga0496121_0162779 | |||
| 1363 | Ga0496122_0000269 | |||
| 1364 | Ga0496122_0001374 | |||
| 1365 | Ga0496122_0005977 | |||
| 1366 | Ga0496122_0006100 | |||
| 1367 | Ga0496122_0008406 | |||
| 1368 | Ga0496122_0014497 | |||
| 1369 | Ga0496122_0081914 | |||
| 1370 | Ga0496122_0168932 | |||
| 1371 | Ga0496122_0208372 | |||
| 1372 | Ga0496123_0000712 | |||
| 1373 | Ga0496123_0000858 | |||
| 1374 | Ga0496123_0001146 | |||
| 1375 | Ga0496123_0017870 | |||
| 1376 | Ga0496123_0024155 | |||
| 1377 | Ga0496123_0026785 | |||
| 1378 | Ga0496123_0033685 | |||
| 1379 | Ga0496123_0185333 | |||
| 1380 | Ga0496124_0000110 | |||
| 1381 | Ga0496124_0000306 | |||
| 1382 | Ga0496124_0000320 | |||
| 1383 | Ga0496124_0001208 | |||
| 1384 | Ga0496124_0001811 | |||
| 1385 | Ga0496124_0002707 | |||
| 1386 | Ga0496124_0006398 | |||
| 1387 | Ga0496124_0007499 | |||
| 1388 | Ga0496124_0034267 | |||
| 1389 | Ga0496124_0180787 | |||
| 1390 | Ga0496124_0192750 | |||
| 1391 | Ga0496124_0272229 | |||
| 1392 | Ga0496124_0389584 | |||
| 1393 | Ga0496124_0675665 | |||
| 1394 | Ga0496125_0002079 | |||
| 1395 | Ga0496125_0002282 | |||
| 1396 | Ga0496125_0006415 | |||
| 1397 | Ga0496125_0007599 | |||
| 1398 | Ga0496125_0016849 | |||
| 1399 | Ga0496125_0027074 | |||
| 1400 | Ga0496125_0027965 | |||
| 1401 | Ga0496125_0056267 | |||
| 1402 | Ga0496125_0244594 | |||
| 1403 | Ga0496125_0307452 | |||
| 1404 | Ga0496125_0323857 | |||
| 1405 | Ga0496125_0331907 | |||
| 1406 | Ga0496125_0496916 | |||
| 1407 | Ga0496126_0000219 | |||
| 1408 | Ga0496126_0000655 | |||
| 1409 | Ga0496126_0001930 | |||
| 1410 | Ga0496126_0002197 | |||
| 1411 | Ga0496126_0014860 | |||
| 1412 | Ga0496126_0015060 | |||
| 1413 | Ga0496126_0015817 | |||
| 1414 | Ga0496126_0036932 | |||
| 1415 | Ga0495682_0005648 | |||
| 1416 | Ga0501033_0089759 | |||
| 1417 | Ga0501034_0614122 | |||
| 1418 | Ga0501043_0059375 | |||
| 1419 | Ga0501043_0278559 | |||
| 1420 | Ga0501047_0703660 | |||
| 1421 | Ga0501044_0030400 | |||
| 1422 | Ga0501044_0421919 | |||
| 1423 | nmdc:mga03n38_5604_c1 | |||
| 1424 | nmdc:mga03n38_5774_c1 | |||
| 1425 | nmdc:mga06z11_352_c1 | |||
| 1426 | nmdc:mga06z11_841_c1 | |||
| 1427 | nmdc:mga04h51_185_c1 | |||
| 1428 | nmdc:mga04h51_361_c1 | |||
| 1429 | nmdc:mga07m45_1668_c1 | |||
| 1430 | nmdc:mga0n895_200008_c1 | |||
| 1431 | nmdc:mga0rr50_119420_c1 | |||
| 1432 | nmdc:mga08x19_12208_c1 | |||
| 1433 | nmdc:mga0sz30_14580_c1 | |||
| 1434 | Ga0500610_0000059 | |||
| 1435 | Ga0500583_0049662 | |||
| 1436 | Ga0500583_0055735 | |||
| 1437 | Ga0500641_0045965 | |||
| 1438 | Ga0500555_000209 | |||
| 1439 | Ga0500595_000530 | |||
| 1440 | Ga0500607_162406 | |||
| 1441 | Ga0500608_059233 | |||
| 1442 | Ga0500652_088265 | |||
| 1443 | Ga0500658_0001200 | |||
| 1444 | Ga0500559_0011287 | |||
| 1445 | Ga0500559_0066765 | |||
| 1446 | Ga0500568_0012470 | |||
| 1447 | Ga0500568_0021691 | |||
| 1448 | Ga0500590_000472 | |||
| 1449 | Ga0500604_0082088 | |||
| 1450 | Ga0500616_0101838 | |||
| 1451 | Ga0500616_0140209 | |||
| 1452 | Ga0500619_015417 | |||
| 1453 | Ga0500627_0000195 | |||
| 1454 | Ga0500637_0040459 | |||
| 1455 | Ga0500596_000155 | |||
| 1456 | Ga0466962_0009728 | |||
| 1457 | 2512644750 | |||
| 1458 | 2600226713 | |||
| 1459 | 2643729220 | |||
| 1460 | 2644037770 | |||
| 1461 | 2644045696 | |||
| 1462 | 2644393273 | |||
| 1463 | 2738712368 | |||
| 1464 | 2738850793 | |||
| 1465 | 2738866522 | |||
| 1466 | 2739299040 | |||
| 1467 | 2739360718 | |||
| 1468 | 2792462218 | |||
| 1469 | 2809065460 | |||
| 1470 | 2809081481 | |||
| 1471 | 2809085792 | |||
| 1472 | 2819712316 | |||
| 1473 | 2879165523 | |||
| 1474 | 2880523571 | |||
| 1475 | 2928526831 | |||
| 1476 | 2928963313 | |||
| 1477 | 2928969620 | |||
| 1478 | 8057104116 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy