F478447

General Info

Members Datasets Scaffolds Average Seq Length
739 321 1478 207

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100229894|Ga0070662_1002298943
Length 217
Sequence MMNTDILIANLSEDVPKVSRHAVARRVGTGLVVGGMVAMIAVTTLLGVRPDLHVAMRGFAFWMKWTYTISLGLGAAFAVTRLARPDTRSLQALWILAVPVLLLAGVCINELARTPPAKWLAMWLGKSWMACPWLVLSLAAPIFVGLLWSFRKMAPTRLRAAGAVAGLAAGAWAATIYCLHCPEVSALFVLTWYSLGIAIAAGLGALIGRASCAGELL

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
120 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
200 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
284 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
287 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
288 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
292 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
293 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
294 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
295 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
296 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
297 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
298 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
299 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
300 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
301 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
302 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
303 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
304 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
305 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
306 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
307 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
308 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
309 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
310 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
311 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
312 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
313 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
314 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
315 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
316 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
317 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
318 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
319 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
320 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
321 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0.14
Isolates 2.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.86
Nodule 0
Rhizoplane 3.52
Rhizosphere 67.66
Stem 0
Stem Tuber 0
Unclassified 1.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100229894 3300005457 Bacteria 1483
2 SwRhRL2b_contig_1650000 2162886007 Bacteria 2722
3 SwRhRL2b_contig_1793279 2162886007 Bacteria 5449
4 SwRhRL2b_contig_3665959 2162886007 Bacteria 6817
5 JGI24741J21665_1003678 3300001915 Bacteria 3585
6 JGI24752J21851_1000248 3300001976 Bacteria 7468
7 JGI24740J21852_10003526 3300001979 Bacteria 6857
8 JGI24739J22299_10004763 3300001989 Bacteria 5179
9 JGI24739J22299_10109312 3300001989 Bacteria 830
10 JGI24739J22299_10109411 3300001989 Bacteria 830
11 JGI24737J22298_10001206 3300001990 Bacteria 9107
12 JGI24737J22298_10002877 3300001990 Bacteria 6104
13 JGI24737J22298_10053337 3300001990 Bacteria 1225
14 JGI24743J22301_10014071 3300001991 Bacteria 1472
15 JGI24735J21928_10000508 3300002067 Bacteria 13774
16 JGI24735J21928_10004707 3300002067 Bacteria 4557
17 JGI24735J21928_10005734 3300002067 Bacteria 4105
18 JGI24735J21928_10026103 3300002067 Bacteria 1759
19 JGI24748J21848_1003097 3300002074 Bacteria 1896
20 JGI24738J21930_10013760 3300002075 Bacteria 1743
21 JGI24749J21850_1000256 3300002076 Bacteria 8348
22 JGI24751J29686_10000054 3300002459 Bacteria 65209
23 JGI25150J39212_1000167 3300002774 Bacteria 36906
24 JGI25151J46595_10082065 3300003187 Bacteria 929
25 JGI25165J46597_1000156 3300003214 Bacteria 109696
26 JGI25165J46597_1000289 3300003214 Bacteria 63916
27 JGI25153J46596_10000016 3300003215 Bacteria 285917
28 JGI25153J46596_10000158 3300003215 Bacteria 68367
29 JGI25153J46596_10008781 3300003215 Bacteria 4783
30 rootH2_10187327 3300003320 Unclassified 2881
31 rootL2_10205962 3300003322 Bacteria 4125
32 Ga0055525_1000035 3300003759 Bacteria 300887
33 Ga0055542_1000132 3300003762 Bacteria 96749
34 Ga0055529_1000088 3300003763 Bacteria 139031
35 Ga0055526_1003911 3300003771 Bacteria 9195
36 Ga0055537_1002542 3300003773 Bacteria 6031
37 Ga0055524_1000250 3300003775 Bacteria 55936
38 Ga0055530_10005650 3300003791 Bacteria 5858
39 Ga0055530_10032168 3300003791 Bacteria 1367
40 Ga0055531_10002208 3300003794 Bacteria 13238
41 Ga0055543_1034603 3300004625 Bacteria 870
42 Ga0065165_1000284 3300005262 Bacteria 86057
43 Ga0065165_1006724 3300005262 Bacteria 5905
44 Ga0065704_10072411 3300005289 Bacteria 8575
45 Ga0065704_10072823 3300005289 Bacteria 7957
46 Ga0065704_10276187 3300005289 Bacteria 912
47 Ga0070658_10000265 3300005327 Bacteria 46194
48 Ga0070658_10001217 3300005327 Bacteria 22089
49 Ga0070658_10004386 3300005327 Bacteria 11507
50 Ga0070658_10005072 3300005327 Bacteria 10715
51 Ga0070676_10000135 3300005328 Bacteria 28224
52 Ga0070670_100000003 3300005331 Bacteria 529510
53 Ga0070670_100002547 3300005331 Bacteria 15040
54 Ga0070670_100277463 3300005331 Bacteria 1463
55 Ga0068869_100000965 3300005334 Bacteria 16736
56 Ga0070666_10024908 3300005335 Bacteria 3900
57 Ga0070666_10049820 3300005335 Bacteria 2816
58 Ga0068868_100000155 3300005338 Bacteria 44610
59 Ga0070660_100001781 3300005339 Bacteria 14791
60 Ga0070660_100009128 3300005339 Bacteria 6961
61 Ga0070660_100036945 3300005339 Bacteria 3702
62 Ga0070660_100143632 3300005339 Bacteria 1916
63 Ga0070661_100024033 3300005344 Bacteria 4372
64 Ga0070661_100098395 3300005344 Bacteria 2173
65 Ga0070668_100001513 3300005347 Bacteria 16795
66 Ga0070668_100005762 3300005347 Bacteria 9188
67 Ga0070668_100008465 3300005347 Bacteria 7640
68 Ga0070668_100124469 3300005347 Bacteria 2064
69 Ga0070669_100000020 3300005353 Bacteria 181297
70 Ga0070669_100002401 3300005353 Bacteria 13554
71 Ga0070669_100046320 3300005353 Bacteria 3171
72 Ga0070669_100050134 3300005353 Bacteria 3049
73 Ga0070669_100066674 3300005353 Bacteria 2654
74 Ga0070669_100115152 3300005353 Bacteria 2045
75 Ga0070675_100369873 3300005354 Bacteria 1274
76 Ga0070671_100000858 3300005355 Bacteria 22169
77 Ga0070671_100128033 3300005355 Bacteria 2138
78 Ga0070671_100150001 3300005355 Bacteria 1968
79 Ga0070674_100001506 3300005356 Bacteria 12427
80 Ga0070673_100000013 3300005364 Bacteria 137021
81 Ga0070673_100060240 3300005364 Bacteria 3007
82 Ga0070659_100029275 3300005366 Bacteria 4256
83 Ga0070659_100036279 3300005366 Bacteria 3843
84 Ga0070659_100081921 3300005366 Bacteria 2578
85 Ga0070659_100440241 3300005366 Bacteria 1104
86 Ga0070667_100000019 3300005367 Bacteria 224710
87 Ga0070667_100001705 3300005367 Bacteria 19664
88 Ga0070667_100007648 3300005367 Bacteria 8962
89 Ga0070667_100007908 3300005367 Bacteria 8819
90 Ga0070667_100017940 3300005367 Bacteria 5867
91 Ga0070667_100089557 3300005367 Bacteria 2643
92 Ga0070667_101013779 3300005367 Unclassified 775
93 Ga0070711_100228271 3300005439 Unclassified 1451
94 Ga0070705_100562733 3300005440 Bacteria 876
95 Ga0070663_100087917 3300005455 Bacteria 2297
96 Ga0070678_100000187 3300005456 Bacteria 27177
97 Ga0070662_100001289 3300005457 Bacteria 15403
98 Ga0070662_100020720 3300005457 Bacteria 4483
99 Ga0070662_100021818 3300005457 Bacteria 4377
100 Ga0070662_100046847 3300005457 Bacteria 3107
101 Ga0068867_100000009 3300005459 Bacteria 137021
102 Ga0068867_100069173 3300005459 Bacteria 2636
103 Ga0068867_100102850 3300005459 Bacteria 2184
104 Ga0068853_100001142 3300005539 Bacteria 18805
105 Ga0068853_100100752 3300005539 Bacteria 2554
106 Ga0068853_100359947 3300005539 Bacteria 1355
107 Ga0070665_100000385 3300005548 Bacteria 65243
108 Ga0070665_100002939 3300005548 Bacteria 18407
109 Ga0070665_100011694 3300005548 Bacteria 8869
110 Ga0070665_100022421 3300005548 Bacteria 6354
111 Ga0070665_100065537 3300005548 Bacteria 3644
112 Ga0068855_100123487 3300005563 Bacteria 2962
113 Ga0068855_100326074 3300005563 Bacteria 1696
114 Ga0068855_100430430 3300005563 Bacteria 1442
115 Ga0068855_100506348 3300005563 Bacteria 1311
116 Ga0068855_100836633 3300005563 Bacteria 976
117 Ga0068855_101038504 3300005563 Bacteria 859
118 Ga0070664_100257696 3300005564 Bacteria 1569
119 Ga0068857_100004484 3300005577 Bacteria 11800
120 Ga0068857_100030929 3300005577 Bacteria 4730
121 Ga0068857_100108017 3300005577 Bacteria 2500
122 Ga0068854_100001459 3300005578 Bacteria 14323
123 Ga0068854_100011043 3300005578 Bacteria 5863
124 Ga0068854_100018465 3300005578 Bacteria 4682
125 Ga0068854_100097502 3300005578 Bacteria 2198
126 Ga0068854_100222969 3300005578 Bacteria 1492
127 Ga0068856_100007394 3300005614 Bacteria 10720
128 Ga0068856_100075361 3300005614 Bacteria 3342
129 Ga0068852_100002750 3300005616 Bacteria 12180
130 Ga0068852_100051698 3300005616 Bacteria 3528
131 Ga0068859_100007640 3300005617 Bacteria 10987
132 Ga0068859_100040574 3300005617 Bacteria 4671
133 Ga0068859_100041065 3300005617 Bacteria 4647
134 Ga0068859_100063321 3300005617 Bacteria 3729
135 Ga0068864_100000005 3300005618 Bacteria 400840
136 Ga0068864_100000021 3300005618 Bacteria 262378
137 Ga0068864_100001977 3300005618 Bacteria 16873
138 Ga0068861_100004363 3300005719 Bacteria 9487
139 Ga0068861_100059995 3300005719 Bacteria 2914
140 Ga0068863_100005477 3300005841 Bacteria 12502
141 Ga0068863_100006774 3300005841 Bacteria 11234
142 Ga0068863_100014465 3300005841 Bacteria 7599
143 Ga0068863_100017809 3300005841 Bacteria 6800
144 Ga0068863_100101045 3300005841 Bacteria 2741
145 Ga0068858_100000138 3300005842 Bacteria 77033
146 Ga0068858_100000769 3300005842 Bacteria 33482
147 Ga0068858_100015762 3300005842 Bacteria 7108
148 Ga0068860_100000042 3300005843 Bacteria 227404
149 Ga0068860_100001393 3300005843 Bacteria 26213
150 Ga0068862_100000001 3300005844 Bacteria 523031
151 Ga0068862_100000158 3300005844 Bacteria 75829
152 Ga0068862_100005645 3300005844 Bacteria 10449
153 Ga0068862_100006948 3300005844 Bacteria 9390
154 Ga0068862_100016278 3300005844 Bacteria 6187
155 Ga0068862_100342463 3300005844 Bacteria 1385
156 Ga0068862_100634321 3300005844 Bacteria 1029
157 Ga0081539_10013835 3300005985 Bacteria 6038
158 Ga0070717_10285242 3300006028 Bacteria 1465
159 Ga0075368_10000243 3300006042 Bacteria 15387
160 Ga0075368_10002102 3300006042 Bacteria 6434
161 Ga0075363_100001469 3300006048 Bacteria 8957
162 Ga0075363_100028702 3300006048 Bacteria 2865
163 Ga0070715_10272291 3300006163 Unclassified 894
164 Ga0070716_100297830 3300006173 Bacteria 1120
165 Ga0075367_10000651 3300006178 Bacteria 13311
166 Ga0075367_10005198 3300006178 Bacteria 6434
167 Ga0075369_10237373 3300006186 Bacteria 845
168 Ga0075370_10019573 3300006353 Bacteria 3688
169 Ga0068871_100067445 3300006358 Bacteria 2935
170 Ga0068871_100350382 3300006358 Unclassified 1306
171 Ga0075434_100225804 3300006871 Bacteria 1892
172 Ga0068865_100000005 3300006881 Bacteria 213248
173 Ga0097620_100007640 3300006931 Bacteria 10987
174 Ga0097620_100040576 3300006931 Bacteria 4671
175 Ga0097620_100041062 3300006931 Bacteria 4647
176 Ga0097620_100063324 3300006931 Bacteria 3729
177 Ga0075435_100117537 3300007076 Bacteria 2216
178 Ga0105251_10000253 3300009011 Bacteria 53797
179 Ga0105251_10004109 3300009011 Bacteria 10177
180 Ga0105251_10042819 3300009011 Bacteria 2195
181 Ga0105240_10008344 3300009093 Bacteria 14825
182 Ga0105240_10024971 3300009093 Bacteria 7865
183 Ga0105240_10025167 3300009093 Bacteria 7827
184 Ga0105240_10038048 3300009093 Bacteria 6176
185 Ga0105240_10069900 3300009093 Bacteria 4345
186 Ga0105240_10359924 3300009093 Bacteria 1648
187 Ga0105245_10006241 3300009098 Bacteria 10486
188 Ga0105247_10087507 3300009101 Bacteria 1973
189 Ga0105243_10000032 3300009148 Bacteria 183324
190 Ga0105243_10000077 3300009148 Bacteria 110432
191 Ga0105243_10045805 3300009148 Bacteria 3439
192 Ga0105241_10003044 3300009174 Bacteria 12509
193 Ga0105241_10674168 3300009174 Unclassified 941
194 Ga0105242_10000148 3300009176 Bacteria 51694
195 Ga0105248_10000086 3300009177 Bacteria 106349
196 Ga0105248_10101066 3300009177 Bacteria 3250
197 Ga0105237_10001230 3300009545 Bacteria 34130
198 Ga0105237_10001347 3300009545 Bacteria 32527
199 Ga0105237_10039220 3300009545 Bacteria 4781
200 Ga0105237_10122815 3300009545 Bacteria 2591
201 Ga0105238_10164534 3300009551 Bacteria 2194
202 Ga0105238_10209676 3300009551 Bacteria 1924
203 Ga0105238_10269778 3300009551 Bacteria 1682
204 Ga0105249_10001047 3300009553 Bacteria 24478
205 Ga0105249_10006483 3300009553 Bacteria 10179
206 Ga0105249_10047250 3300009553 Bacteria 3922
207 Ga0105249_10072524 3300009553 Bacteria 3183
208 Ga0105249_10131182 3300009553 Bacteria 2392
209 Ga0105239_10000113 3300010375 Bacteria 114562
210 Ga0105239_10004322 3300010375 Bacteria 17032
211 Ga0105239_10068549 3300010375 Bacteria 3898
212 Ga0105239_10302756 3300010375 Bacteria 1800
213 Ga0105246_10001422 3300011119 Bacteria 14184
214 Ga0157373_10057752 3300013100 Bacteria 2752
215 Ga0157373_10489871 3300013100 Bacteria 887
216 Ga0157371_10000048 3300013102 Bacteria 184015
217 Ga0157371_10067695 3300013102 Bacteria 2527
218 Ga0157371_10158952 3300013102 Bacteria 1614
219 Ga0157371_10312025 3300013102 Bacteria 1140
220 Ga0157370_10000176 3300013104 Bacteria 79656
221 Ga0157369_10010454 3300013105 Bacteria 10572
222 Ga0157369_10053466 3300013105 Bacteria 4365
223 Ga0157369_10140664 3300013105 Bacteria 2554
224 Ga0157374_10005361 3300013296 Bacteria 10772
225 Ga0157374_10164712 3300013296 Bacteria 2160
226 Ga0157378_10005618 3300013297 Bacteria 10988
227 Ga0157378_10059632 3300013297 Bacteria 3405
228 Ga0163162_10013809 3300013306 Bacteria 7889
229 Ga0163162_10771050 3300013306 Bacteria 1080
230 Ga0157372_10003759 3300013307 Bacteria 16306
231 Ga0157372_10103674 3300013307 Bacteria 3250
232 Ga0157372_10259845 3300013307 Unclassified 2016
233 Ga0157372_10377717 3300013307 Bacteria 1651
234 Ga0157372_10511185 3300013307 Bacteria 1400
235 Ga0157375_10000636 3300013308 Bacteria 31210
236 Ga0163163_10028250 3300014325 Bacteria 5384
237 Ga0163163_10806620 3300014325 Bacteria 1002
238 Ga0157380_10000057 3300014326 Bacteria 63054
239 Ga0157380_10000060 3300014326 Bacteria 62248
240 Ga0157380_10115317 3300014326 Bacteria 2265
241 Ga0157377_10010382 3300014745 Bacteria 4604
242 Ga0157379_10108914 3300014968 Bacteria 2488
243 Ga0157379_10293257 3300014968 Bacteria 1481
244 Ga0157376_10000244 3300014969 Bacteria 37827
245 Ga0183363_1011 3300015690 Bacteria 101930
246 Ga0163161_10016808 3300017792 Bacteria 5115
247 Ga0206353_11472309 3300020082 Bacteria 1719
248 Ga0213872_10007952 3300021361 Bacteria 5169
249 Ga0213872_10008732 3300021361 Bacteria 4892
250 Ga0213872_10012664 3300021361 Bacteria 3963
251 Ga0213872_10031207 3300021361 Bacteria 2442
252 Ga0213872_10032154 3300021361 Bacteria 2405
253 Ga0213872_10173239 3300021361 Bacteria 934
254 Ga0213872_10177789 3300021361 Bacteria 920
255 Ga0209147_100263 3300025229 Bacteria 47901
256 Ga0209563_100047 3300025230 Bacteria 366620
257 Ga0207427_100436 3300025231 Bacteria 23280
258 Ga0207425_1000019 3300025245 Bacteria 399942
259 Ga0207425_1011296 3300025245 Bacteria 2136
260 Ga0209026_1001456 3300025250 Bacteria 10450
261 Ga0209026_1015603 3300025250 Bacteria 1244
262 Ga0209148_1000017 3300025254 Bacteria 787064
263 Ga0209148_1000457 3300025254 Bacteria 44291
264 Ga0209148_1000736 3300025254 Bacteria 25511
265 Ga0209129_1000413 3300025258 Bacteria 33495
266 Ga0209233_1000213 3300025261 Bacteria 109881
267 Ga0209233_1000291 3300025261 Bacteria 64111
268 Ga0209565_1000030 3300025263 Bacteria 325058
269 Ga0209565_1000314 3300025263 Bacteria 44878
270 Ga0209455_1000005 3300025272 Bacteria 1416756
271 Ga0209455_1001006 3300025272 Bacteria 14217
272 Ga0209673_1001192 3300025273 Bacteria 27915
273 Ga0209675_1014328 3300025291 Bacteria 2420
274 Ga0209676_1076997 3300025292 Bacteria 772
275 Ga0209025_1000559 3300025294 Bacteria 68241
276 Ga0209564_1000670 3300025295 Bacteria 50564
277 Ga0209564_1004569 3300025295 Bacteria 8385
278 Ga0209758_1000019 3300025297 Bacteria 743682
279 Ga0209758_1000035 3300025297 Bacteria 448190
280 Ga0209758_1005071 3300025297 Bacteria 10435
281 Ga0209050_1000001 3300025298 Bacteria 3563507
282 Ga0209050_1001657 3300025298 Bacteria 22579
283 Ga0209050_1007464 3300025298 Bacteria 6125
284 Ga0209050_1007633 3300025298 Bacteria 6000
285 Ga0209050_1057367 3300025298 Bacteria 942
286 Ga0209256_1000046 3300025299 Bacteria 325040
287 Ga0209256_1010036 3300025299 Bacteria 4041
288 Ga0209051_1002722 3300025303 Bacteria 12282
289 Ga0209257_1000111 3300025304 Bacteria 234809
290 Ga0209257_1000395 3300025304 Bacteria 86373
291 Ga0209257_1010870 3300025304 Bacteria 4504
292 Ga0209257_1015873 3300025304 Bacteria 3092
293 Ga0207656_10005643 3300025321 Bacteria 4440
294 Ga0207696_1003816 3300025711 Bacteria 6703
295 Ga0207713_1000266 3300025735 Bacteria 64691
296 Ga0207713_1003594 3300025735 Bacteria 10459
297 Ga0207713_1010826 3300025735 Bacteria 5014
298 Ga0207710_10094100 3300025900 Bacteria 1406
299 Ga0207710_10280844 3300025900 Bacteria 838
300 Ga0207647_10000068 3300025904 Bacteria 81240
301 Ga0207647_10015339 3300025904 Bacteria 5256
302 Ga0207647_10017721 3300025904 Bacteria 4836
303 Ga0207645_10000416 3300025907 Bacteria 35380
304 Ga0207705_10000583 3300025909 Bacteria 30635
305 Ga0207705_10000665 3300025909 Bacteria 28572
306 Ga0207705_10012795 3300025909 Bacteria 6058
307 Ga0207705_10067611 3300025909 Bacteria 2586
308 Ga0207654_10000587 3300025911 Bacteria 20506
309 Ga0207695_10006747 3300025913 Bacteria 14805
310 Ga0207695_10015458 3300025913 Bacteria 8985
311 Ga0207695_10019521 3300025913 Bacteria 7802
312 Ga0207695_10022134 3300025913 Bacteria 7228
313 Ga0207695_10047354 3300025913 Bacteria 4552
314 Ga0207695_10051781 3300025913 Bacteria 4307
315 Ga0207695_10346441 3300025913 Bacteria 1373
316 Ga0207671_10001107 3300025914 Bacteria 32491
317 Ga0207671_10002399 3300025914 Bacteria 20094
318 Ga0207671_10015428 3300025914 Bacteria 5980
319 Ga0207671_10031391 3300025914 Bacteria 3959
320 Ga0207693_10011415 3300025915 Bacteria 7192
321 Ga0207663_10023856 3300025916 Bacteria 3518
322 Ga0207657_10002418 3300025919 Bacteria 20170
323 Ga0207657_10006429 3300025919 Bacteria 12187
324 Ga0207657_10009661 3300025919 Bacteria 9680
325 Ga0207657_10023846 3300025919 Bacteria 5686
326 Ga0207657_10108096 3300025919 Bacteria 2299
327 Ga0207649_10000795 3300025920 Bacteria 20334
328 Ga0207649_10531344 3300025920 Bacteria 898
329 Ga0207681_10000005 3300025923 Bacteria 555724
330 Ga0207681_10001728 3300025923 Bacteria 14035
331 Ga0207681_10003742 3300025923 Bacteria 9454
332 Ga0207681_10151488 3300025923 Bacteria 1738
333 Ga0207681_10226125 3300025923 Bacteria 1450
334 Ga0207681_10235331 3300025923 Bacteria 1423
335 Ga0207694_10004292 3300025924 Bacteria 11153
336 Ga0207694_10066780 3300025924 Bacteria 2806
337 Ga0207650_10000004 3300025925 Bacteria 743372
338 Ga0207650_10001292 3300025925 Bacteria 18172
339 Ga0207650_10002951 3300025925 Bacteria 11733
340 Ga0207650_10062646 3300025925 Bacteria 2779
341 Ga0207659_10318760 3300025926 Bacteria 1282
342 Ga0207687_10004279 3300025927 Bacteria 9541
343 Ga0207644_10000089 3300025931 Bacteria 65175
344 Ga0207644_10001935 3300025931 Bacteria 13435
345 Ga0207644_10103524 3300025931 Bacteria 2142
346 Ga0207690_10002864 3300025932 Bacteria 10391
347 Ga0207690_10038499 3300025932 Bacteria 3113
348 Ga0207706_10011382 3300025933 Bacteria 8105
349 Ga0207706_10015188 3300025933 Bacteria 6969
350 Ga0207706_10015296 3300025933 Bacteria 6937
351 Ga0207706_10038770 3300025933 Bacteria 4226
352 Ga0207686_10000743 3300025934 Bacteria 20164
353 Ga0207709_10000051 3300025935 Bacteria 227968
354 Ga0207709_10000110 3300025935 Bacteria 127725
355 Ga0207709_10014707 3300025935 Bacteria 4325
356 Ga0207669_10000015 3300025937 Bacteria 125492
357 Ga0207704_10000001 3300025938 Bacteria 716296
358 Ga0207665_10085984 3300025939 Bacteria 2171
359 Ga0207691_10023627 3300025940 Bacteria 5788
360 Ga0207711_10000460 3300025941 Bacteria 42417
361 Ga0207711_10002321 3300025941 Bacteria 17049
362 Ga0207689_10006900 3300025942 Bacteria 9988
363 Ga0207667_10000004 3300025949 Bacteria 737718
364 Ga0207667_10010934 3300025949 Bacteria 10576
365 Ga0207667_10082377 3300025949 Bacteria 3333
366 Ga0207667_10660806 3300025949 Bacteria 1050
367 Ga0207667_10669769 3300025949 Bacteria 1042
368 Ga0207651_10000006 3300025960 Bacteria 227893
369 Ga0207651_10500607 3300025960 Bacteria 1050
370 Ga0207712_10000754 3300025961 Bacteria 24470
371 Ga0207712_10056247 3300025961 Bacteria 2771
372 Ga0207712_10091446 3300025961 Bacteria 2241
373 Ga0207668_10000565 3300025972 Bacteria 23257
374 Ga0207668_10005073 3300025972 Bacteria 7748
375 Ga0207668_10014334 3300025972 Bacteria 4904
376 Ga0207668_10021629 3300025972 Bacteria 4105
377 Ga0207640_10004471 3300025981 Bacteria 7580
378 Ga0207640_10010286 3300025981 Bacteria 5265
379 Ga0207640_10075492 3300025981 Bacteria 2285
380 Ga0207658_10000002 3300025986 Bacteria 1364188
381 Ga0207658_10001897 3300025986 Bacteria 15649
382 Ga0207658_10003845 3300025986 Bacteria 10575
383 Ga0207658_10005180 3300025986 Bacteria 8975
384 Ga0207658_10011727 3300025986 Bacteria 5968
385 Ga0207658_10035471 3300025986 Bacteria 3573
386 Ga0207677_10003122 3300026023 Bacteria 8745
387 Ga0207703_10000208 3300026035 Bacteria 68360
388 Ga0207703_10000686 3300026035 Bacteria 33490
389 Ga0207703_10083199 3300026035 Bacteria 2673
390 Ga0207639_10001247 3300026041 Bacteria 17238
391 Ga0207639_10006058 3300026041 Bacteria 8208
392 Ga0207639_10050993 3300026041 Bacteria 3145
393 Ga0207639_10078570 3300026041 Bacteria 2605
394 Ga0207639_10631413 3300026041 Bacteria 990
395 Ga0207678_10028634 3300026067 Bacteria 4861
396 Ga0207678_11023084 3300026067 Bacteria 731
397 Ga0207702_10005914 3300026078 Bacteria 10635
398 Ga0207702_10006519 3300026078 Bacteria 10041
399 Ga0207702_10018630 3300026078 Bacteria 5743
400 Ga0207702_10099834 3300026078 Bacteria 2559
401 Ga0207641_10000017 3300026088 Bacteria 299119
402 Ga0207641_10006143 3300026088 Bacteria 10161
403 Ga0207641_10017027 3300026088 Bacteria 5949
404 Ga0207641_10047342 3300026088 Bacteria 3626
405 Ga0207641_10065623 3300026088 Bacteria 3105
406 Ga0207641_10081182 3300026088 Bacteria 2815
407 Ga0207648_10000022 3300026089 Bacteria 137000
408 Ga0207648_10140015 3300026089 Bacteria 2132
409 Ga0207676_10000006 3300026095 Bacteria 681936
410 Ga0207676_10000037 3300026095 Bacteria 180826
411 Ga0207674_10006117 3300026116 Bacteria 14233
412 Ga0207674_10013572 3300026116 Bacteria 9027
413 Ga0207674_10022656 3300026116 Bacteria 6741
414 Ga0207674_10070699 3300026116 Bacteria 3509
415 Ga0207674_10107392 3300026116 Bacteria 2768
416 Ga0207674_10130694 3300026116 Bacteria 2474
417 Ga0207675_100000195 3300026118 Bacteria 55663
418 Ga0207675_100111626 3300026118 Bacteria 2580
419 Ga0207683_10000954 3300026121 Bacteria 26517
420 Ga0207698_10001904 3300026142 Bacteria 12226
421 Ga0207698_10112272 3300026142 Bacteria 2287
422 Ga0207698_11065545 3300026142 Bacteria 820
423 Ga0209813_10000102 3300027866 Bacteria 31660
424 Ga0209813_10000375 3300027866 Bacteria 11234
425 Ga0268266_10000338 3300028379 Bacteria 73458
426 Ga0268266_10017809 3300028379 Bacteria 6054
427 Ga0268266_10022870 3300028379 Bacteria 5320
428 Ga0268265_10000001 3300028380 Bacteria 1230727
429 Ga0268265_10000673 3300028380 Bacteria 33766
430 Ga0268265_10000863 3300028380 Bacteria 28360
431 Ga0268265_10003220 3300028380 Bacteria 11856
432 Ga0268265_10010725 3300028380 Bacteria 6187
433 Ga0268265_10083823 3300028380 Bacteria 2525
434 Ga0268265_10910722 3300028380 Bacteria 864
435 Ga0268264_10000001 3300028381 Bacteria 1221000
436 Ga0268264_10001067 3300028381 Bacteria 27231
437 Ga0268264_10005380 3300028381 Bacteria 10838
438 Ga0268264_10019007 3300028381 Bacteria 5617
439 Ga0268264_10652556 3300028381 Bacteria 1041
440 Ga0307515_10012945 3300028794 Bacteria 15643
441 Ga0307408_100020416 3300031548 Bacteria 4472
442 Ga0307408_100034108 3300031548 Bacteria 3561
443 Ga0307405_10017441 3300031731 Bacteria 3939
444 Ga0307405_10126432 3300031731 Bacteria 1758
445 Ga0307413_10068780 3300031824 Bacteria 2219
446 Ga0307413_10141758 3300031824 Bacteria 1662
447 Ga0307413_10209837 3300031824 Bacteria 1414
448 Ga0307410_10003830 3300031852 Bacteria 7644
449 Ga0307410_10092451 3300031852 Bacteria 2150
450 Ga0307406_10020393 3300031901 Bacteria 3902
451 Ga0307406_10062514 3300031901 Bacteria 2409
452 Ga0307407_10041308 3300031903 Bacteria 2578
453 Ga0307412_10003194 3300031911 Bacteria 9106
454 Ga0307412_10003934 3300031911 Bacteria 8276
455 Ga0307412_10010732 3300031911 Bacteria 5283
456 Ga0307412_10086032 3300031911 Bacteria 2186
457 Ga0307409_100181713 3300031995 Bacteria 1863
458 Ga0307409_100959967 3300031995 Bacteria 871
459 Ga0307416_101743361 3300032002 Bacteria 727
460 Ga0307414_10056562 3300032004 Bacteria 2752
461 Ga0307414_10298234 3300032004 Bacteria 1362
462 Ga0307414_10593998 3300032004 Unclassified 992
463 Ga0307510_10156800 3300033180 Bacteria 1882
464 Ga0395899_0006882 3300037312 Bacteria 8809
465 Ga0395899_0275288 3300037312 Bacteria 1147
466 Ga0395905_0029762 3300037471 Bacteria 5147
467 Ga0395901_0051879 3300038443 Bacteria 4264
468 Ga0237819_02847 3300038705 Bacteria 3287
469 Ga0237816_01980 3300039145 Bacteria 1616
470 Ga0436361_0054467 3300039447 Bacteria 1002
471 Ga0436361_0101796 3300039447 Bacteria 1050
472 Ga0436361_0294799 3300039447 Bacteria 3065
473 Ga0436361_0377188 3300039447 Bacteria 4713
474 Ga0436361_0470588 3300039447 Bacteria 4688
475 Ga0436361_0578054 3300039447 Bacteria 4931
476 Ga0436361_0607077 3300039447 Bacteria 8854
477 Ga0436361_0608675 3300039447 Bacteria 840
478 Ga0436361_0854789 3300039447 Bacteria 2434
479 Ga0436361_1023646 3300039447 Bacteria 6804
480 Ga0436361_1202216 3300039447 Bacteria 11508
481 Ga0451833_0136820 3300041491 Bacteria 1008
482 Ga0439448_0029509 3300042005 Bacteria 1736
483 Ga0439455_0007153 3300042012 Bacteria 2351
484 Ga0439458_0000470 3300042157 Bacteria 10290
485 Ga0466966_0172887 3300044684 Bacteria 1312
486 Ga0466971_0032564 3300044719 Bacteria 2336
487 Ga0466957_0261871 3300044842 Bacteria 1153
488 Ga0466967_0029645 3300045976 Bacteria 4582
489 Ga0495617_021739 3300046452 Bacteria 2167
490 Ga0495617_045276 3300046452 Bacteria 1467
491 Ga0495627_002167 3300046453 Bacteria 9821
492 Ga0495638_0000336 3300046460 Bacteria 59114
493 Ga0495638_0003765 3300046460 Bacteria 11789
494 Ga0495638_0223637 3300046460 Bacteria 1051
495 Ga0495650_0000302 3300046471 Bacteria 89516
496 Ga0495584_0044514 3300046491 Bacteria 2240
497 Ga0495585_0004581 3300046492 Bacteria 8938
498 Ga0495596_0001091 3300046500 Bacteria 16079
499 Ga0495596_0007393 3300046500 Bacteria 4957
500 Ga0495607_0008994 3300046501 Bacteria 6795
501 Ga0495583_0000023 3300046506 Bacteria 280019
502 Ga0495583_0002372 3300046506 Bacteria 16255
503 Ga0495583_0005352 3300046506 Bacteria 8750
504 Ga0495606_0000809 3300046507 Bacteria 47581
505 Ga0495606_0009634 3300046507 Bacteria 8137
506 Ga0495606_0016375 3300046507 Bacteria 5657
507 Ga0495606_0278950 3300046507 Bacteria 914
508 Ga0495610_0003133 3300046512 Bacteria 13155
509 Ga0495610_0009533 3300046512 Bacteria 6126
510 Ga0495610_0069738 3300046512 Bacteria 1644
511 Ga0495616_0000013 3300046513 Bacteria 202334
512 Ga0495616_0077953 3300046513 Bacteria 1590
513 Ga0495632_0301278 3300046519 Unclassified 711
514 Ga0495637_0103624 3300046520 Bacteria 1109
515 Ga0495643_0001684 3300046522 Bacteria 19277
516 Ga0495643_0005282 3300046522 Bacteria 8772
517 Ga0495643_0021178 3300046522 Bacteria 3735
518 Ga0495643_0161224 3300046522 Bacteria 1103
519 Ga0495648_0000088 3300046524 Bacteria 115109
520 Ga0495652_0257817 3300046529 Bacteria 1289
521 Ga0495587_0064229 3300046536 Bacteria 2145
522 Ga0495622_0001921 3300046557 Bacteria 10214
523 Ga0495633_0022857 3300046558 Bacteria 3103
524 Ga0495633_0092264 3300046558 Bacteria 1407
525 Ga0495668_0028309 3300046616 Bacteria 3169
526 Ga0495668_0210047 3300046616 Unclassified 1066
527 Ga0495611_0071050 3300046648 Bacteria 1591
528 Ga0495625_0001696 3300046660 Bacteria 25671
529 Ga0495625_0018082 3300046660 Bacteria 5510
530 Ga0495661_0018024 3300046665 Bacteria 4650
531 Ga0495661_0052699 3300046665 Bacteria 2450
532 Ga0495670_0000003 3300046691 Bacteria 326779
533 Ga0495670_0024660 3300046691 Bacteria 2973
534 Ga0495600_0048688 3300046809 Bacteria 2764
535 Ga0495687_000192 3300047443 Bacteria 87877
536 Ga0495687_003523 3300047443 Bacteria 11270
537 Ga0495687_103589 3300047443 Bacteria 1062
538 Ga0495677_0003309 3300047445 Bacteria 6272
539 Ga0495673_0017400 3300047469 Bacteria 3654
540 Ga0495673_0068295 3300047469 Bacteria 1502
541 Ga0495681_0000003 3300047470 Bacteria 245567
542 Ga0495681_0152612 3300047470 Bacteria 968
543 Ga0495686_0000124 3300047472 Bacteria 159708
544 Ga0495686_0000383 3300047472 Bacteria 70528
545 Ga0495686_0000550 3300047472 Bacteria 53672
546 Ga0495686_0002025 3300047472 Bacteria 19995
547 Ga0495686_0002694 3300047472 Bacteria 16296
548 Ga0495686_0003151 3300047472 Bacteria 14544
549 Ga0495686_0003367 3300047472 Bacteria 13928
550 Ga0495686_0004993 3300047472 Bacteria 10667
551 Ga0495686_0046677 3300047472 Bacteria 2737
552 Ga0495686_0079422 3300047472 Bacteria 2006
553 Ga0495626_0000890 3300048091 Bacteria 26470
554 Ga0496100_0081646 3300048903 Bacteria 2184
555 Ga0496101_0243480 3300048904 Unclassified 1400
556 Ga0496102_0000125 3300048905 Bacteria 109075
557 Ga0496102_0000555 3300048905 Bacteria 40031
558 Ga0496102_0001484 3300048905 Bacteria 20725
559 Ga0496103_0000111 3300048906 Bacteria 89596
560 Ga0496103_0000322 3300048906 Bacteria 43840
561 Ga0496103_0000557 3300048906 Bacteria 29704
562 Ga0496103_0020230 3300048906 Bacteria 3998
563 Ga0496103_0111519 3300048906 Bacteria 1738
564 Ga0496104_0005088 3300048907 Bacteria 11475
565 Ga0496104_0012726 3300048907 Bacteria 7578
566 Ga0496105_0000261 3300048908 Bacteria 35507
567 Ga0496105_0006966 3300048908 Bacteria 8709
568 Ga0496105_0036203 3300048908 Bacteria 4065
569 Ga0496107_0080966 3300048910 Bacteria 2369
570 Ga0496108_0003893 3300048911 Bacteria 11988
571 Ga0496109_0251953 3300048912 Bacteria 1663
572 Ga0496110_0041185 3300048913 Bacteria 4030
573 Ga0496110_0343671 3300048913 Bacteria 1359
574 Ga0496112_0006155 3300048915 Bacteria 10491
575 Ga0496113_0000042 3300048916 Bacteria 53513
576 Ga0496114_0001428 3300048917 Bacteria 18118
577 Ga0496115_0000142 3300048918 Bacteria 65915
578 Ga0496115_0101045 3300048918 Bacteria 2364
579 Ga0496116_0001007 3300048919 Bacteria 34381
580 Ga0496116_0001035 3300048919 Bacteria 33974
581 Ga0496116_0002161 3300048919 Bacteria 20943
582 Ga0496116_0040950 3300048919 Bacteria 3184
583 Ga0496116_0044255 3300048919 Bacteria 3026
584 Ga0496116_0059986 3300048919 Bacteria 2470
585 Ga0496117_0000414 3300048920 Bacteria 71876
586 Ga0496117_0001978 3300048920 Bacteria 27244
587 Ga0496117_0002434 3300048920 Bacteria 23501
588 Ga0496117_0012452 3300048920 Bacteria 7492
589 Ga0496117_0023551 3300048920 Bacteria 4901
590 Ga0496117_0027433 3300048920 Bacteria 4438
591 Ga0496117_0034236 3300048920 Bacteria 3830
592 Ga0496117_0057092 3300048920 Bacteria 2714
593 Ga0496117_0111376 3300048920 Bacteria 1704
594 Ga0496117_0128328 3300048920 Bacteria 1542
595 Ga0496118_0000285 3300048921 Bacteria 88805
596 Ga0496118_0000901 3300048921 Bacteria 46540
597 Ga0496118_0005641 3300048921 Bacteria 14116
598 Ga0496118_0006842 3300048921 Bacteria 12373
599 Ga0496118_0011088 3300048921 Bacteria 8846
600 Ga0496118_0024301 3300048921 Bacteria 5236
601 Ga0496118_0040516 3300048921 Bacteria 3703
602 Ga0496118_0042672 3300048921 Bacteria 3576
603 Ga0496118_0125479 3300048921 Bacteria 1662
604 Ga0496118_0263748 3300048921 Bacteria 970
605 Ga0496119_0000232 3300048922 Bacteria 78129
606 Ga0496119_0000838 3300048922 Bacteria 40796
607 Ga0496119_0008828 3300048922 Bacteria 8770
608 Ga0496119_0141335 3300048922 Bacteria 1299
609 Ga0496120_0000061 3300048923 Bacteria 172817
610 Ga0496120_0005812 3300048923 Bacteria 9665
611 Ga0496120_0030913 3300048923 Bacteria 3249
612 Ga0496121_0000072 3300048924 Bacteria 244975
613 Ga0496121_0000356 3300048924 Bacteria 94447
614 Ga0496121_0000512 3300048924 Bacteria 73820
615 Ga0496121_0000653 3300048924 Bacteria 64947
616 Ga0496121_0001101 3300048924 Bacteria 47588
617 Ga0496121_0002248 3300048924 Bacteria 30091
618 Ga0496121_0003957 3300048924 Bacteria 20469
619 Ga0496121_0008027 3300048924 Bacteria 12589
620 Ga0496121_0012732 3300048924 Bacteria 9119
621 Ga0496121_0018515 3300048924 Bacteria 7018
622 Ga0496121_0022798 3300048924 Bacteria 6053
623 Ga0496121_0162779 3300048924 Bacteria 1629
624 Ga0496122_0000269 3300048925 Bacteria 116292
625 Ga0496122_0001374 3300048925 Bacteria 39556
626 Ga0496122_0005977 3300048925 Bacteria 14244
627 Ga0496122_0006100 3300048925 Bacteria 14037
628 Ga0496122_0008406 3300048925 Bacteria 11149
629 Ga0496122_0014497 3300048925 Bacteria 7610
630 Ga0496122_0081914 3300048925 Bacteria 2244
631 Ga0496122_0168932 3300048925 Bacteria 1321
632 Ga0496122_0208372 3300048925 Bacteria 1135
633 Ga0496123_0000712 3300048926 Bacteria 54440
634 Ga0496123_0000858 3300048926 Bacteria 48557
635 Ga0496123_0001146 3300048926 Bacteria 39552
636 Ga0496123_0017870 3300048926 Bacteria 5680
637 Ga0496123_0024155 3300048926 Bacteria 4628
638 Ga0496123_0026785 3300048926 Bacteria 4311
639 Ga0496123_0033685 3300048926 Bacteria 3681
640 Ga0496123_0185333 3300048926 Bacteria 1082
641 Ga0496124_0000110 3300048927 Bacteria 166321
642 Ga0496124_0000306 3300048927 Bacteria 90641
643 Ga0496124_0000320 3300048927 Bacteria 88704
644 Ga0496124_0001208 3300048927 Bacteria 40031
645 Ga0496124_0001811 3300048927 Bacteria 29573
646 Ga0496124_0002707 3300048927 Bacteria 22633
647 Ga0496124_0006398 3300048927 Bacteria 12841
648 Ga0496124_0007499 3300048927 Bacteria 11584
649 Ga0496124_0034267 3300048927 Bacteria 4458
650 Ga0496124_0180787 3300048927 Bacteria 1623
651 Ga0496124_0192750 3300048927 Bacteria 1557
652 Ga0496124_0272229 3300048927 Bacteria 1239
653 Ga0496124_0389584 3300048927 Bacteria 971
654 Ga0496124_0675665 3300048927 Bacteria 658
655 Ga0496125_0002079 3300048928 Bacteria 26983
656 Ga0496125_0002282 3300048928 Bacteria 25394
657 Ga0496125_0006415 3300048928 Bacteria 12716
658 Ga0496125_0007599 3300048928 Bacteria 11509
659 Ga0496125_0016849 3300048928 Bacteria 7000
660 Ga0496125_0027074 3300048928 Bacteria 5206
661 Ga0496125_0027965 3300048928 Bacteria 5100
662 Ga0496125_0056267 3300048928 Bacteria 3196
663 Ga0496125_0244594 3300048928 Bacteria 1136
664 Ga0496125_0307452 3300048928 Bacteria 968
665 Ga0496125_0323857 3300048928 Bacteria 933
666 Ga0496125_0331907 3300048928 Bacteria 917
667 Ga0496125_0496916 3300048928 Bacteria 687
668 Ga0496126_0000219 3300048929 Bacteria 125157
669 Ga0496126_0000655 3300048929 Bacteria 64225
670 Ga0496126_0001930 3300048929 Bacteria 29576
671 Ga0496126_0002197 3300048929 Bacteria 27072
672 Ga0496126_0014860 3300048929 Bacteria 7853
673 Ga0496126_0015060 3300048929 Bacteria 7794
674 Ga0496126_0015817 3300048929 Bacteria 7577
675 Ga0496126_0036932 3300048929 Bacteria 4564
676 Ga0495682_0005648 3300049460 Bacteria 5173
677 Ga0501033_0089759 3300049570 Bacteria 2248
678 Ga0501034_0614122 3300049571 Bacteria 992
679 Ga0501043_0059375 3300049579 Bacteria 3002
680 Ga0501043_0278559 3300049579 Bacteria 1282
681 Ga0501047_0703660 3300049581 Bacteria 828
682 Ga0501044_0030400 3300049823 Bacteria 5693
683 Ga0501044_0421919 3300049823 Bacteria 1244
684 nmdc:mga03n38_5604_c1 3300050490 Bacteria 4290
685 nmdc:mga03n38_5774_c1 3300050490 Bacteria 4247
686 nmdc:mga06z11_352_c1 3300050494 Bacteria 17353
687 nmdc:mga06z11_841_c1 3300050494 Bacteria 11233
688 nmdc:mga04h51_185_c1 3300050495 Bacteria 17353
689 nmdc:mga04h51_361_c1 3300050495 Bacteria 11233
690 nmdc:mga07m45_1668_c1 3300050496 Bacteria 10212
691 nmdc:mga0n895_200008_c1 3300050512 Bacteria 2029
692 nmdc:mga0rr50_119420_c1 3300050513 Bacteria 2096
693 nmdc:mga08x19_12208_c1 3300050514 Bacteria 5171
694 nmdc:mga0sz30_14580_c1 3300050516 Bacteria 3096
695 Ga0500610_0000059 3300053079 Bacteria 34324
696 Ga0500583_0049662 3300053092 Bacteria 1942
697 Ga0500583_0055735 3300053092 Bacteria 1849
698 Ga0500641_0045965 3300053096 Bacteria 1780
699 Ga0500555_000209 3300053103 Bacteria 27373
700 Ga0500595_000530 3300053119 Bacteria 23016
701 Ga0500607_162406 3300053121 Bacteria 1019
702 Ga0500608_059233 3300053122 Bacteria 1832
703 Ga0500652_088265 3300053131 Bacteria 1294
704 Ga0500658_0001200 3300053134 Bacteria 10542
705 Ga0500559_0011287 3300053136 Bacteria 3818
706 Ga0500559_0066765 3300053136 Bacteria 1614
707 Ga0500568_0012470 3300053139 Bacteria 3908
708 Ga0500568_0021691 3300053139 Bacteria 2760
709 Ga0500590_000472 3300053148 Bacteria 13775
710 Ga0500604_0082088 3300053151 Bacteria 1042
711 Ga0500616_0101838 3300053153 Bacteria 1402
712 Ga0500616_0140209 3300053153 Bacteria 1131
713 Ga0500619_015417 3300053154 Bacteria 2078
714 Ga0500627_0000195 3300053158 Bacteria 17448
715 Ga0500637_0040459 3300053178 Bacteria 2634
716 Ga0500596_000155 3300053735 Bacteria 10552
717 Ga0466962_0009728 3300061719 Bacteria 4613
718 2512644750 2512564014 Bacteria 4639632
719 2600226713 2599185359 Bacteria 4772316
720 2643729220 2643221541 Bacteria 5498788
721 2644037770 2643221605 Bacteria 4772303
722 2644045696 2643221606 Bacteria 5588032
723 2644393273 2643221671 Bacteria 5496681
724 2738712368 2738541275 Bacteria 4830863
725 2738850793 2738541301 Bacteria 4834102
726 2738866522 2738541304 Bacteria 4833665
727 2739299040 2738543022 Bacteria 4835059
728 2739360718 2738543033 Bacteria 4833336
729 2792462218 2791355048 Bacteria 5832535
730 2809065460 2808606401 Bacteria 4586670
731 2809081481 2808606404 Bacteria 4652788
732 2809085792 2808606405 Bacteria 4586632
733 2819712316 2818991466 Bacteria 4748179
734 2879165523 2879163058 Bacteria 4223965
735 2880523571 2880518877 Bacteria 5012590
736 2928526831 2928526807 Bacteria 4760224
737 2928963313 2928959182 Bacteria 4725774
738 2928969620 2928968154 Bacteria 4633371
739 8057104116 8057101203 Bacteria 5034064
740 Ga0070662_100229894
741 SwRhRL2b_contig_1650000
742 SwRhRL2b_contig_1793279
743 SwRhRL2b_contig_3665959
744 JGI24741J21665_1003678
745 JGI24752J21851_1000248
746 JGI24740J21852_10003526
747 JGI24739J22299_10004763
748 JGI24739J22299_10109312
749 JGI24739J22299_10109411
750 JGI24737J22298_10001206
751 JGI24737J22298_10002877
752 JGI24737J22298_10053337
753 JGI24743J22301_10014071
754 JGI24735J21928_10000508
755 JGI24735J21928_10004707
756 JGI24735J21928_10005734
757 JGI24735J21928_10026103
758 JGI24748J21848_1003097
759 JGI24738J21930_10013760
760 JGI24749J21850_1000256
761 JGI24751J29686_10000054
762 JGI25150J39212_1000167
763 JGI25151J46595_10082065
764 JGI25165J46597_1000156
765 JGI25165J46597_1000289
766 JGI25153J46596_10000016
767 JGI25153J46596_10000158
768 JGI25153J46596_10008781
769 rootH2_10187327
770 rootL2_10205962
771 Ga0055525_1000035
772 Ga0055542_1000132
773 Ga0055529_1000088
774 Ga0055526_1003911
775 Ga0055537_1002542
776 Ga0055524_1000250
777 Ga0055530_10005650
778 Ga0055530_10032168
779 Ga0055531_10002208
780 Ga0055543_1034603
781 Ga0065165_1000284
782 Ga0065165_1006724
783 Ga0065704_10072411
784 Ga0065704_10072823
785 Ga0065704_10276187
786 Ga0070658_10000265
787 Ga0070658_10001217
788 Ga0070658_10004386
789 Ga0070658_10005072
790 Ga0070676_10000135
791 Ga0070670_100000003
792 Ga0070670_100002547
793 Ga0070670_100277463
794 Ga0068869_100000965
795 Ga0070666_10024908
796 Ga0070666_10049820
797 Ga0068868_100000155
798 Ga0070660_100001781
799 Ga0070660_100009128
800 Ga0070660_100036945
801 Ga0070660_100143632
802 Ga0070661_100024033
803 Ga0070661_100098395
804 Ga0070668_100001513
805 Ga0070668_100005762
806 Ga0070668_100008465
807 Ga0070668_100124469
808 Ga0070669_100000020
809 Ga0070669_100002401
810 Ga0070669_100046320
811 Ga0070669_100050134
812 Ga0070669_100066674
813 Ga0070669_100115152
814 Ga0070675_100369873
815 Ga0070671_100000858
816 Ga0070671_100128033
817 Ga0070671_100150001
818 Ga0070674_100001506
819 Ga0070673_100000013
820 Ga0070673_100060240
821 Ga0070659_100029275
822 Ga0070659_100036279
823 Ga0070659_100081921
824 Ga0070659_100440241
825 Ga0070667_100000019
826 Ga0070667_100001705
827 Ga0070667_100007648
828 Ga0070667_100007908
829 Ga0070667_100017940
830 Ga0070667_100089557
831 Ga0070667_101013779
832 Ga0070711_100228271
833 Ga0070705_100562733
834 Ga0070663_100087917
835 Ga0070678_100000187
836 Ga0070662_100001289
837 Ga0070662_100020720
838 Ga0070662_100021818
839 Ga0070662_100046847
840 Ga0068867_100000009
841 Ga0068867_100069173
842 Ga0068867_100102850
843 Ga0068853_100001142
844 Ga0068853_100100752
845 Ga0068853_100359947
846 Ga0070665_100000385
847 Ga0070665_100002939
848 Ga0070665_100011694
849 Ga0070665_100022421
850 Ga0070665_100065537
851 Ga0068855_100123487
852 Ga0068855_100326074
853 Ga0068855_100430430
854 Ga0068855_100506348
855 Ga0068855_100836633
856 Ga0068855_101038504
857 Ga0070664_100257696
858 Ga0068857_100004484
859 Ga0068857_100030929
860 Ga0068857_100108017
861 Ga0068854_100001459
862 Ga0068854_100011043
863 Ga0068854_100018465
864 Ga0068854_100097502
865 Ga0068854_100222969
866 Ga0068856_100007394
867 Ga0068856_100075361
868 Ga0068852_100002750
869 Ga0068852_100051698
870 Ga0068859_100007640
871 Ga0068859_100040574
872 Ga0068859_100041065
873 Ga0068859_100063321
874 Ga0068864_100000005
875 Ga0068864_100000021
876 Ga0068864_100001977
877 Ga0068861_100004363
878 Ga0068861_100059995
879 Ga0068863_100005477
880 Ga0068863_100006774
881 Ga0068863_100014465
882 Ga0068863_100017809
883 Ga0068863_100101045
884 Ga0068858_100000138
885 Ga0068858_100000769
886 Ga0068858_100015762
887 Ga0068860_100000042
888 Ga0068860_100001393
889 Ga0068862_100000001
890 Ga0068862_100000158
891 Ga0068862_100005645
892 Ga0068862_100006948
893 Ga0068862_100016278
894 Ga0068862_100342463
895 Ga0068862_100634321
896 Ga0081539_10013835
897 Ga0070717_10285242
898 Ga0075368_10000243
899 Ga0075368_10002102
900 Ga0075363_100001469
901 Ga0075363_100028702
902 Ga0070715_10272291
903 Ga0070716_100297830
904 Ga0075367_10000651
905 Ga0075367_10005198
906 Ga0075369_10237373
907 Ga0075370_10019573
908 Ga0068871_100067445
909 Ga0068871_100350382
910 Ga0075434_100225804
911 Ga0068865_100000005
912 Ga0097620_100007640
913 Ga0097620_100040576
914 Ga0097620_100041062
915 Ga0097620_100063324
916 Ga0075435_100117537
917 Ga0105251_10000253
918 Ga0105251_10004109
919 Ga0105251_10042819
920 Ga0105240_10008344
921 Ga0105240_10024971
922 Ga0105240_10025167
923 Ga0105240_10038048
924 Ga0105240_10069900
925 Ga0105240_10359924
926 Ga0105245_10006241
927 Ga0105247_10087507
928 Ga0105243_10000032
929 Ga0105243_10000077
930 Ga0105243_10045805
931 Ga0105241_10003044
932 Ga0105241_10674168
933 Ga0105242_10000148
934 Ga0105248_10000086
935 Ga0105248_10101066
936 Ga0105237_10001230
937 Ga0105237_10001347
938 Ga0105237_10039220
939 Ga0105237_10122815
940 Ga0105238_10164534
941 Ga0105238_10209676
942 Ga0105238_10269778
943 Ga0105249_10001047
944 Ga0105249_10006483
945 Ga0105249_10047250
946 Ga0105249_10072524
947 Ga0105249_10131182
948 Ga0105239_10000113
949 Ga0105239_10004322
950 Ga0105239_10068549
951 Ga0105239_10302756
952 Ga0105246_10001422
953 Ga0157373_10057752
954 Ga0157373_10489871
955 Ga0157371_10000048
956 Ga0157371_10067695
957 Ga0157371_10158952
958 Ga0157371_10312025
959 Ga0157370_10000176
960 Ga0157369_10010454
961 Ga0157369_10053466
962 Ga0157369_10140664
963 Ga0157374_10005361
964 Ga0157374_10164712
965 Ga0157378_10005618
966 Ga0157378_10059632
967 Ga0163162_10013809
968 Ga0163162_10771050
969 Ga0157372_10003759
970 Ga0157372_10103674
971 Ga0157372_10259845
972 Ga0157372_10377717
973 Ga0157372_10511185
974 Ga0157375_10000636
975 Ga0163163_10028250
976 Ga0163163_10806620
977 Ga0157380_10000057
978 Ga0157380_10000060
979 Ga0157380_10115317
980 Ga0157377_10010382
981 Ga0157379_10108914
982 Ga0157379_10293257
983 Ga0157376_10000244
984 Ga0183363_1011
985 Ga0163161_10016808
986 Ga0206353_11472309
987 Ga0213872_10007952
988 Ga0213872_10008732
989 Ga0213872_10012664
990 Ga0213872_10031207
991 Ga0213872_10032154
992 Ga0213872_10173239
993 Ga0213872_10177789
994 Ga0209147_100263
995 Ga0209563_100047
996 Ga0207427_100436
997 Ga0207425_1000019
998 Ga0207425_1011296
999 Ga0209026_1001456
1000 Ga0209026_1015603
1001 Ga0209148_1000017
1002 Ga0209148_1000457
1003 Ga0209148_1000736
1004 Ga0209129_1000413
1005 Ga0209233_1000213
1006 Ga0209233_1000291
1007 Ga0209565_1000030
1008 Ga0209565_1000314
1009 Ga0209455_1000005
1010 Ga0209455_1001006
1011 Ga0209673_1001192
1012 Ga0209675_1014328
1013 Ga0209676_1076997
1014 Ga0209025_1000559
1015 Ga0209564_1000670
1016 Ga0209564_1004569
1017 Ga0209758_1000019
1018 Ga0209758_1000035
1019 Ga0209758_1005071
1020 Ga0209050_1000001
1021 Ga0209050_1001657
1022 Ga0209050_1007464
1023 Ga0209050_1007633
1024 Ga0209050_1057367
1025 Ga0209256_1000046
1026 Ga0209256_1010036
1027 Ga0209051_1002722
1028 Ga0209257_1000111
1029 Ga0209257_1000395
1030 Ga0209257_1010870
1031 Ga0209257_1015873
1032 Ga0207656_10005643
1033 Ga0207696_1003816
1034 Ga0207713_1000266
1035 Ga0207713_1003594
1036 Ga0207713_1010826
1037 Ga0207710_10094100
1038 Ga0207710_10280844
1039 Ga0207647_10000068
1040 Ga0207647_10015339
1041 Ga0207647_10017721
1042 Ga0207645_10000416
1043 Ga0207705_10000583
1044 Ga0207705_10000665
1045 Ga0207705_10012795
1046 Ga0207705_10067611
1047 Ga0207654_10000587
1048 Ga0207695_10006747
1049 Ga0207695_10015458
1050 Ga0207695_10019521
1051 Ga0207695_10022134
1052 Ga0207695_10047354
1053 Ga0207695_10051781
1054 Ga0207695_10346441
1055 Ga0207671_10001107
1056 Ga0207671_10002399
1057 Ga0207671_10015428
1058 Ga0207671_10031391
1059 Ga0207693_10011415
1060 Ga0207663_10023856
1061 Ga0207657_10002418
1062 Ga0207657_10006429
1063 Ga0207657_10009661
1064 Ga0207657_10023846
1065 Ga0207657_10108096
1066 Ga0207649_10000795
1067 Ga0207649_10531344
1068 Ga0207681_10000005
1069 Ga0207681_10001728
1070 Ga0207681_10003742
1071 Ga0207681_10151488
1072 Ga0207681_10226125
1073 Ga0207681_10235331
1074 Ga0207694_10004292
1075 Ga0207694_10066780
1076 Ga0207650_10000004
1077 Ga0207650_10001292
1078 Ga0207650_10002951
1079 Ga0207650_10062646
1080 Ga0207659_10318760
1081 Ga0207687_10004279
1082 Ga0207644_10000089
1083 Ga0207644_10001935
1084 Ga0207644_10103524
1085 Ga0207690_10002864
1086 Ga0207690_10038499
1087 Ga0207706_10011382
1088 Ga0207706_10015188
1089 Ga0207706_10015296
1090 Ga0207706_10038770
1091 Ga0207686_10000743
1092 Ga0207709_10000051
1093 Ga0207709_10000110
1094 Ga0207709_10014707
1095 Ga0207669_10000015
1096 Ga0207704_10000001
1097 Ga0207665_10085984
1098 Ga0207691_10023627
1099 Ga0207711_10000460
1100 Ga0207711_10002321
1101 Ga0207689_10006900
1102 Ga0207667_10000004
1103 Ga0207667_10010934
1104 Ga0207667_10082377
1105 Ga0207667_10660806
1106 Ga0207667_10669769
1107 Ga0207651_10000006
1108 Ga0207651_10500607
1109 Ga0207712_10000754
1110 Ga0207712_10056247
1111 Ga0207712_10091446
1112 Ga0207668_10000565
1113 Ga0207668_10005073
1114 Ga0207668_10014334
1115 Ga0207668_10021629
1116 Ga0207640_10004471
1117 Ga0207640_10010286
1118 Ga0207640_10075492
1119 Ga0207658_10000002
1120 Ga0207658_10001897
1121 Ga0207658_10003845
1122 Ga0207658_10005180
1123 Ga0207658_10011727
1124 Ga0207658_10035471
1125 Ga0207677_10003122
1126 Ga0207703_10000208
1127 Ga0207703_10000686
1128 Ga0207703_10083199
1129 Ga0207639_10001247
1130 Ga0207639_10006058
1131 Ga0207639_10050993
1132 Ga0207639_10078570
1133 Ga0207639_10631413
1134 Ga0207678_10028634
1135 Ga0207678_11023084
1136 Ga0207702_10005914
1137 Ga0207702_10006519
1138 Ga0207702_10018630
1139 Ga0207702_10099834
1140 Ga0207641_10000017
1141 Ga0207641_10006143
1142 Ga0207641_10017027
1143 Ga0207641_10047342
1144 Ga0207641_10065623
1145 Ga0207641_10081182
1146 Ga0207648_10000022
1147 Ga0207648_10140015
1148 Ga0207676_10000006
1149 Ga0207676_10000037
1150 Ga0207674_10006117
1151 Ga0207674_10013572
1152 Ga0207674_10022656
1153 Ga0207674_10070699
1154 Ga0207674_10107392
1155 Ga0207674_10130694
1156 Ga0207675_100000195
1157 Ga0207675_100111626
1158 Ga0207683_10000954
1159 Ga0207698_10001904
1160 Ga0207698_10112272
1161 Ga0207698_11065545
1162 Ga0209813_10000102
1163 Ga0209813_10000375
1164 Ga0268266_10000338
1165 Ga0268266_10017809
1166 Ga0268266_10022870
1167 Ga0268265_10000001
1168 Ga0268265_10000673
1169 Ga0268265_10000863
1170 Ga0268265_10003220
1171 Ga0268265_10010725
1172 Ga0268265_10083823
1173 Ga0268265_10910722
1174 Ga0268264_10000001
1175 Ga0268264_10001067
1176 Ga0268264_10005380
1177 Ga0268264_10019007
1178 Ga0268264_10652556
1179 Ga0307515_10012945
1180 Ga0307408_100020416
1181 Ga0307408_100034108
1182 Ga0307405_10017441
1183 Ga0307405_10126432
1184 Ga0307413_10068780
1185 Ga0307413_10141758
1186 Ga0307413_10209837
1187 Ga0307410_10003830
1188 Ga0307410_10092451
1189 Ga0307406_10020393
1190 Ga0307406_10062514
1191 Ga0307407_10041308
1192 Ga0307412_10003194
1193 Ga0307412_10003934
1194 Ga0307412_10010732
1195 Ga0307412_10086032
1196 Ga0307409_100181713
1197 Ga0307409_100959967
1198 Ga0307416_101743361
1199 Ga0307414_10056562
1200 Ga0307414_10298234
1201 Ga0307414_10593998
1202 Ga0307510_10156800
1203 Ga0395899_0006882
1204 Ga0395899_0275288
1205 Ga0395905_0029762
1206 Ga0395901_0051879
1207 Ga0237819_02847
1208 Ga0237816_01980
1209 Ga0436361_0054467
1210 Ga0436361_0101796
1211 Ga0436361_0294799
1212 Ga0436361_0377188
1213 Ga0436361_0470588
1214 Ga0436361_0578054
1215 Ga0436361_0607077
1216 Ga0436361_0608675
1217 Ga0436361_0854789
1218 Ga0436361_1023646
1219 Ga0436361_1202216
1220 Ga0451833_0136820
1221 Ga0439448_0029509
1222 Ga0439455_0007153
1223 Ga0439458_0000470
1224 Ga0466966_0172887
1225 Ga0466971_0032564
1226 Ga0466957_0261871
1227 Ga0466967_0029645
1228 Ga0495617_021739
1229 Ga0495617_045276
1230 Ga0495627_002167
1231 Ga0495638_0000336
1232 Ga0495638_0003765
1233 Ga0495638_0223637
1234 Ga0495650_0000302
1235 Ga0495584_0044514
1236 Ga0495585_0004581
1237 Ga0495596_0001091
1238 Ga0495596_0007393
1239 Ga0495607_0008994
1240 Ga0495583_0000023
1241 Ga0495583_0002372
1242 Ga0495583_0005352
1243 Ga0495606_0000809
1244 Ga0495606_0009634
1245 Ga0495606_0016375
1246 Ga0495606_0278950
1247 Ga0495610_0003133
1248 Ga0495610_0009533
1249 Ga0495610_0069738
1250 Ga0495616_0000013
1251 Ga0495616_0077953
1252 Ga0495632_0301278
1253 Ga0495637_0103624
1254 Ga0495643_0001684
1255 Ga0495643_0005282
1256 Ga0495643_0021178
1257 Ga0495643_0161224
1258 Ga0495648_0000088
1259 Ga0495652_0257817
1260 Ga0495587_0064229
1261 Ga0495622_0001921
1262 Ga0495633_0022857
1263 Ga0495633_0092264
1264 Ga0495668_0028309
1265 Ga0495668_0210047
1266 Ga0495611_0071050
1267 Ga0495625_0001696
1268 Ga0495625_0018082
1269 Ga0495661_0018024
1270 Ga0495661_0052699
1271 Ga0495670_0000003
1272 Ga0495670_0024660
1273 Ga0495600_0048688
1274 Ga0495687_000192
1275 Ga0495687_003523
1276 Ga0495687_103589
1277 Ga0495677_0003309
1278 Ga0495673_0017400
1279 Ga0495673_0068295
1280 Ga0495681_0000003
1281 Ga0495681_0152612
1282 Ga0495686_0000124
1283 Ga0495686_0000383
1284 Ga0495686_0000550
1285 Ga0495686_0002025
1286 Ga0495686_0002694
1287 Ga0495686_0003151
1288 Ga0495686_0003367
1289 Ga0495686_0004993
1290 Ga0495686_0046677
1291 Ga0495686_0079422
1292 Ga0495626_0000890
1293 Ga0496100_0081646
1294 Ga0496101_0243480
1295 Ga0496102_0000125
1296 Ga0496102_0000555
1297 Ga0496102_0001484
1298 Ga0496103_0000111
1299 Ga0496103_0000322
1300 Ga0496103_0000557
1301 Ga0496103_0020230
1302 Ga0496103_0111519
1303 Ga0496104_0005088
1304 Ga0496104_0012726
1305 Ga0496105_0000261
1306 Ga0496105_0006966
1307 Ga0496105_0036203
1308 Ga0496107_0080966
1309 Ga0496108_0003893
1310 Ga0496109_0251953
1311 Ga0496110_0041185
1312 Ga0496110_0343671
1313 Ga0496112_0006155
1314 Ga0496113_0000042
1315 Ga0496114_0001428
1316 Ga0496115_0000142
1317 Ga0496115_0101045
1318 Ga0496116_0001007
1319 Ga0496116_0001035
1320 Ga0496116_0002161
1321 Ga0496116_0040950
1322 Ga0496116_0044255
1323 Ga0496116_0059986
1324 Ga0496117_0000414
1325 Ga0496117_0001978
1326 Ga0496117_0002434
1327 Ga0496117_0012452
1328 Ga0496117_0023551
1329 Ga0496117_0027433
1330 Ga0496117_0034236
1331 Ga0496117_0057092
1332 Ga0496117_0111376
1333 Ga0496117_0128328
1334 Ga0496118_0000285
1335 Ga0496118_0000901
1336 Ga0496118_0005641
1337 Ga0496118_0006842
1338 Ga0496118_0011088
1339 Ga0496118_0024301
1340 Ga0496118_0040516
1341 Ga0496118_0042672
1342 Ga0496118_0125479
1343 Ga0496118_0263748
1344 Ga0496119_0000232
1345 Ga0496119_0000838
1346 Ga0496119_0008828
1347 Ga0496119_0141335
1348 Ga0496120_0000061
1349 Ga0496120_0005812
1350 Ga0496120_0030913
1351 Ga0496121_0000072
1352 Ga0496121_0000356
1353 Ga0496121_0000512
1354 Ga0496121_0000653
1355 Ga0496121_0001101
1356 Ga0496121_0002248
1357 Ga0496121_0003957
1358 Ga0496121_0008027
1359 Ga0496121_0012732
1360 Ga0496121_0018515
1361 Ga0496121_0022798
1362 Ga0496121_0162779
1363 Ga0496122_0000269
1364 Ga0496122_0001374
1365 Ga0496122_0005977
1366 Ga0496122_0006100
1367 Ga0496122_0008406
1368 Ga0496122_0014497
1369 Ga0496122_0081914
1370 Ga0496122_0168932
1371 Ga0496122_0208372
1372 Ga0496123_0000712
1373 Ga0496123_0000858
1374 Ga0496123_0001146
1375 Ga0496123_0017870
1376 Ga0496123_0024155
1377 Ga0496123_0026785
1378 Ga0496123_0033685
1379 Ga0496123_0185333
1380 Ga0496124_0000110
1381 Ga0496124_0000306
1382 Ga0496124_0000320
1383 Ga0496124_0001208
1384 Ga0496124_0001811
1385 Ga0496124_0002707
1386 Ga0496124_0006398
1387 Ga0496124_0007499
1388 Ga0496124_0034267
1389 Ga0496124_0180787
1390 Ga0496124_0192750
1391 Ga0496124_0272229
1392 Ga0496124_0389584
1393 Ga0496124_0675665
1394 Ga0496125_0002079
1395 Ga0496125_0002282
1396 Ga0496125_0006415
1397 Ga0496125_0007599
1398 Ga0496125_0016849
1399 Ga0496125_0027074
1400 Ga0496125_0027965
1401 Ga0496125_0056267
1402 Ga0496125_0244594
1403 Ga0496125_0307452
1404 Ga0496125_0323857
1405 Ga0496125_0331907
1406 Ga0496125_0496916
1407 Ga0496126_0000219
1408 Ga0496126_0000655
1409 Ga0496126_0001930
1410 Ga0496126_0002197
1411 Ga0496126_0014860
1412 Ga0496126_0015060
1413 Ga0496126_0015817
1414 Ga0496126_0036932
1415 Ga0495682_0005648
1416 Ga0501033_0089759
1417 Ga0501034_0614122
1418 Ga0501043_0059375
1419 Ga0501043_0278559
1420 Ga0501047_0703660
1421 Ga0501044_0030400
1422 Ga0501044_0421919
1423 nmdc:mga03n38_5604_c1
1424 nmdc:mga03n38_5774_c1
1425 nmdc:mga06z11_352_c1
1426 nmdc:mga06z11_841_c1
1427 nmdc:mga04h51_185_c1
1428 nmdc:mga04h51_361_c1
1429 nmdc:mga07m45_1668_c1
1430 nmdc:mga0n895_200008_c1
1431 nmdc:mga0rr50_119420_c1
1432 nmdc:mga08x19_12208_c1
1433 nmdc:mga0sz30_14580_c1
1434 Ga0500610_0000059
1435 Ga0500583_0049662
1436 Ga0500583_0055735
1437 Ga0500641_0045965
1438 Ga0500555_000209
1439 Ga0500595_000530
1440 Ga0500607_162406
1441 Ga0500608_059233
1442 Ga0500652_088265
1443 Ga0500658_0001200
1444 Ga0500559_0011287
1445 Ga0500559_0066765
1446 Ga0500568_0012470
1447 Ga0500568_0021691
1448 Ga0500590_000472
1449 Ga0500604_0082088
1450 Ga0500616_0101838
1451 Ga0500616_0140209
1452 Ga0500619_015417
1453 Ga0500627_0000195
1454 Ga0500637_0040459
1455 Ga0500596_000155
1456 Ga0466962_0009728
1457 2512644750
1458 2600226713
1459 2643729220
1460 2644037770
1461 2644045696
1462 2644393273
1463 2738712368
1464 2738850793
1465 2738866522
1466 2739299040
1467 2739360718
1468 2792462218
1469 2809065460
1470 2809081481
1471 2809085792
1472 2819712316
1473 2879165523
1474 2880523571
1475 2928526831
1476 2928963313
1477 2928969620
1478 8057104116

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06532

NrsF

Negative regulator of sigma F

11

212

0.99

Map