F478396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 388 | 670 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300033179|Ga0307507_10000099|Ga0307507_1000009920 |
| Length | 278 |
| Sequence | LQNSLLLFSVLIPDSNILILDFNSTHTLKMKIALLGYGKMGKMIEKIALSRNHEIVLTIDQDNLHELTAQNLQKADAVIEFSMPATVLGNIQHCFNAGVPIVVGTTGWYDKLDEVKQQCEESNASLMYATNFSVGVNIFFHINRMLARVMNNYPYYDVQVEEIHHMQKLDAPSGTAITIAEGIIDNLDSKKDWLNVLTTDDRADNQNPLPDQLLIESLRIDSVPGTHTVIYDSEVDTIEFKHTAHNRSGFALGAVLAAEWIQGKKGFYTVDAMFDFKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 4 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 5 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 6 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 7 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 8 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 9 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 10 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 11 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 12 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 13 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 14 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 15 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 16 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 17 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 18 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 19 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 20 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 21 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 22 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 23 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 24 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 25 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 26 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 27 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 28 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 29 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 30 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 31 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 32 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 33 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 34 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 35 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 36 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 37 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 38 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 39 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 40 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 41 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 42 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 43 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 44 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 45 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 46 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 47 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 48 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 49 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 50 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 51 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 52 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 53 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 54 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 55 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 56 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 57 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 58 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 59 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 60 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 61 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 62 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 63 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 64 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 65 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 66 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 67 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 68 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 69 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 70 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 71 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 72 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 73 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 74 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 75 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 76 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 77 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 78 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 79 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 80 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 81 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 82 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 83 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 84 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 85 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 86 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 89 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 90 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 97 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 98 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 112 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 115 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 116 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 124 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 125 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 128 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 129 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 136 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 137 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 138 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 139 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 140 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 141 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 142 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 224 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 225 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 228 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 229 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 232 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 234 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 239 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 240 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 241 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 245 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 250 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 251 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 252 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 253 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 254 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 255 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 256 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 260 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 266 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 269 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 274 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 277 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 278 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 280 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 281 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 282 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 283 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 284 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 285 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 286 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 287 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 288 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 289 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 290 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 339 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 340 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 356 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 357 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 358 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 359 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 360 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 371 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 372 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 373 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 374 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 375 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 377 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 378 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 383 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 385 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 386 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 387 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 388 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.11 |
| Metatranscriptomes | 0.54 |
| Isolates | 9.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.99 |
| Nodule | 0.81 |
| Rhizoplane | 0.54 |
| Rhizosphere | 79.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_488003 | 2162886007 | Bacteria | 4900 |
| 2 | SwRhRL2b_contig_829818 | 2162886007 | Bacteria | 4778 |
| 3 | 2214746907 | 2209111006 | Bacteria | 916 |
| 4 | JGI24736J21556_1011486 | 3300001904 | Bacteria | 1441 |
| 5 | JGI24740J21852_10050454 | 3300001979 | Bacteria | 1197 |
| 6 | JGI24737J22298_10000321 | 3300001990 | Bacteria | 16053 |
| 7 | JGI24737J22298_10010511 | 3300001990 | Bacteria | 3054 |
| 8 | JGI24735J21928_10000003 | 3300002067 | Bacteria | 385983 |
| 9 | JGI24735J21928_10003137 | 3300002067 | Bacteria | 5663 |
| 10 | JGI24744J21845_10007987 | 3300002077 | Bacteria | 2184 |
| 11 | JGI25162J39368_1000203 | 3300002737 | Bacteria | 62704 |
| 12 | JGI25164J39214_1001360 | 3300002772 | Bacteria | 5927 |
| 13 | JGI25152J39213_1000697 | 3300002773 | Bacteria | 17459 |
| 14 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 15 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 16 | JGI25165J46597_1000728 | 3300003214 | Bacteria | 25784 |
| 17 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 18 | rootH1_10152788 | 3300003316 | Bacteria | 1338 |
| 19 | rootH2_10000984 | 3300003320 | Bacteria | 89440 |
| 20 | rootH2_10015381 | 3300003320 | Bacteria | 19009 |
| 21 | rootH2_10160370 | 3300003320 | Bacteria | 1383 |
| 22 | rootH2_10228453 | 3300003320 | Bacteria | 1574 |
| 23 | rootL2_10065652 | 3300003322 | Bacteria | 7156 |
| 24 | rootL2_10110563 | 3300003322 | Bacteria | 2024 |
| 25 | rootH1_10098029 | 3300003323 | Bacteria | 1285 |
| 26 | rootH1_10154754 | 3300003316 | Bacteria | 1344 |
| 27 | rootH1_10154754 | 3300003323 | Bacteria | 1743 |
| 28 | rootH1_10195403 | 3300003323 | Bacteria | 1877 |
| 29 | rootH1_10223455 | 3300003323 | Bacteria | 4540 |
| 30 | rootH1_10332970 | 3300003323 | Bacteria | 1488 |
| 31 | Ga0006562J51391_1004923 | 3300003578 | Bacteria | 5120 |
| 32 | Ga0055536_1000004 | 3300003781 | Bacteria | 411108 |
| 33 | Ga0055530_10000869 | 3300003791 | Bacteria | 24868 |
| 34 | Ga0058863_11752149 | 3300004799 | Bacteria | 893 |
| 35 | Ga0058862_12181088 | 3300004803 | Bacteria | 1002 |
| 36 | Ga0065714_10002216 | 3300005288 | Bacteria | 50392 |
| 37 | Ga0065714_10008551 | 3300005288 | Bacteria | 3953 |
| 38 | Ga0065714_10010665 | 3300005288 | Bacteria | 3861 |
| 39 | Ga0065714_10015338 | 3300005288 | Bacteria | 1840 |
| 40 | Ga0065714_10065896 | 3300005288 | Bacteria | 8166 |
| 41 | Ga0065714_10070770 | 3300005288 | Bacteria | 3762 |
| 42 | Ga0065714_10096653 | 3300005288 | Bacteria | 1755 |
| 43 | Ga0065714_10110891 | 3300005288 | Bacteria | 1476 |
| 44 | Ga0065714_10133993 | 3300005288 | Bacteria | 1225 |
| 45 | Ga0065704_10070251 | 3300005289 | Bacteria | 48366 |
| 46 | Ga0065704_10073887 | 3300005289 | Bacteria | 6700 |
| 47 | Ga0065704_10097387 | 3300005289 | Bacteria | 2397 |
| 48 | Ga0065704_10132256 | 3300005289 | Bacteria | 1614 |
| 49 | Ga0065704_10226425 | 3300005289 | Bacteria | 1057 |
| 50 | Ga0065715_10008714 | 3300005293 | Bacteria | 3341 |
| 51 | Ga0065715_10029650 | 3300005293 | Bacteria | 1457 |
| 52 | Ga0065715_10107254 | 3300005293 | Bacteria | 2781 |
| 53 | Ga0065715_10154827 | 3300005293 | Bacteria | 1689 |
| 54 | Ga0065715_10353311 | 3300005293 | Bacteria | 947 |
| 55 | Ga0070658_10000041 | 3300005327 | Bacteria | 134208 |
| 56 | Ga0070658_10067944 | 3300005327 | Bacteria | 2913 |
| 57 | Ga0070658_10401560 | 3300005327 | Bacteria | 1177 |
| 58 | Ga0070676_10000775 | 3300005328 | Bacteria | 15746 |
| 59 | Ga0070683_100018067 | 3300005329 | Bacteria | 6239 |
| 60 | Ga0070680_100060235 | 3300005336 | Bacteria | 3107 |
| 61 | Ga0070680_100143031 | 3300005336 | Bacteria | 2006 |
| 62 | Ga0070682_100599602 | 3300005337 | Bacteria | 869 |
| 63 | Ga0068868_100274731 | 3300005338 | Bacteria | 1424 |
| 64 | Ga0070660_100046270 | 3300005339 | Bacteria | 3334 |
| 65 | Ga0070660_100293353 | 3300005339 | Bacteria | 1332 |
| 66 | Ga0070660_100353903 | 3300005339 | Bacteria | 1210 |
| 67 | Ga0070692_10392937 | 3300005345 | Bacteria | 873 |
| 68 | Ga0070668_100175537 | 3300005347 | Unclassified | 1747 |
| 69 | Ga0070669_100007276 | 3300005353 | Bacteria | 7942 |
| 70 | Ga0070671_100007168 | 3300005355 | Bacteria | 8913 |
| 71 | Ga0070673_100002704 | 3300005364 | Bacteria | 10867 |
| 72 | Ga0070659_100000225 | 3300005366 | Bacteria | 43770 |
| 73 | Ga0070659_100003274 | 3300005366 | Bacteria | 11522 |
| 74 | Ga0070659_100123163 | 3300005366 | Bacteria | 2102 |
| 75 | Ga0070709_10277424 | 3300005434 | Bacteria | 1217 |
| 76 | Ga0070713_100196486 | 3300005436 | Bacteria | 1820 |
| 77 | Ga0070663_100043972 | 3300005455 | Bacteria | 3146 |
| 78 | Ga0070678_100000911 | 3300005456 | Bacteria | 15188 |
| 79 | Ga0070678_100335240 | 3300005456 | Bacteria | 1296 |
| 80 | Ga0070662_100000355 | 3300005457 | Bacteria | 27474 |
| 81 | Ga0070681_10029767 | 3300005458 | Bacteria | 5482 |
| 82 | Ga0070681_10233580 | 3300005458 | Bacteria | 1753 |
| 83 | Ga0068867_100001244 | 3300005459 | Bacteria | 17537 |
| 84 | Ga0070706_100039678 | 3300005467 | Archaea | 4346 |
| 85 | Ga0070707_100333753 | 3300005468 | Bacteria | 1473 |
| 86 | Ga0070698_100022109 | 3300005471 | Bacteria | 6658 |
| 87 | Ga0070698_100775467 | 3300005471 | Unclassified | 902 |
| 88 | Ga0070679_100122173 | 3300005530 | Bacteria | 2589 |
| 89 | Ga0070684_100080813 | 3300005535 | Bacteria | 2876 |
| 90 | Ga0068853_100100874 | 3300005539 | Bacteria | 2552 |
| 91 | Ga0070672_100037292 | 3300005543 | Bacteria | 3708 |
| 92 | Ga0070696_100000897 | 3300005546 | Bacteria | 19309 |
| 93 | Ga0070693_100131269 | 3300005547 | Bacteria | 1566 |
| 94 | Ga0070665_100000096 | 3300005548 | Bacteria | 166864 |
| 95 | Ga0068855_100000279 | 3300005563 | Bacteria | 63112 |
| 96 | Ga0068855_100002137 | 3300005563 | Bacteria | 24454 |
| 97 | Ga0068855_100005096 | 3300005563 | Bacteria | 16013 |
| 98 | Ga0068855_100034812 | 3300005563 | Bacteria | 6002 |
| 99 | Ga0068855_100053163 | 3300005563 | Bacteria | 4766 |
| 100 | Ga0068855_100089320 | 3300005563 | Bacteria | 3558 |
| 101 | Ga0068855_100257001 | 3300005563 | Bacteria | 1947 |
| 102 | Ga0068857_100105925 | 3300005577 | Bacteria | 2525 |
| 103 | Ga0068857_100300211 | 3300005577 | Unclassified | 1480 |
| 104 | Ga0068857_100390008 | 3300005577 | Bacteria | 1294 |
| 105 | Ga0068854_100209390 | 3300005578 | Bacteria | 1537 |
| 106 | Ga0068856_100000006 | 3300005614 | Bacteria | 223827 |
| 107 | Ga0068856_100012161 | 3300005614 | Bacteria | 8339 |
| 108 | Ga0068856_100014566 | 3300005614 | Bacteria | 7598 |
| 109 | Ga0068856_100019146 | 3300005614 | Bacteria | 6645 |
| 110 | Ga0068856_100023803 | 3300005614 | Bacteria | 5956 |
| 111 | Ga0068856_100049487 | 3300005614 | Bacteria | 4142 |
| 112 | Ga0068856_100144746 | 3300005614 | Unclassified | 2384 |
| 113 | Ga0068856_100695945 | 3300005614 | Unclassified | 1037 |
| 114 | Ga0068856_101018314 | 3300005614 | Bacteria | 846 |
| 115 | Ga0068852_100000920 | 3300005616 | Bacteria | 19482 |
| 116 | Ga0068852_100412117 | 3300005616 | Unclassified | 1331 |
| 117 | Ga0068852_101034905 | 3300005616 | Bacteria | 840 |
| 118 | Ga0081539_10000261 | 3300005985 | Bacteria | 121256 |
| 119 | Ga0075364_10001344 | 3300006051 | Bacteria | 13266 |
| 120 | Ga0075362_10000037 | 3300006177 | Bacteria | 48807 |
| 121 | Ga0075366_10000652 | 3300006195 | Bacteria | 16353 |
| 122 | Ga0075366_10002252 | 3300006195 | Bacteria | 9861 |
| 123 | Ga0075366_10030725 | 3300006195 | Bacteria | 3159 |
| 124 | Ga0075366_10164955 | 3300006195 | Bacteria | 1343 |
| 125 | Ga0097621_100000330 | 3300006237 | Bacteria | 32160 |
| 126 | Ga0075370_10304769 | 3300006353 | Bacteria | 948 |
| 127 | Ga0068871_100000085 | 3300006358 | Bacteria | 53374 |
| 128 | Ga0068871_100067473 | 3300006358 | Bacteria | 2935 |
| 129 | Ga0075428_100462108 | 3300006844 | Unclassified | 1359 |
| 130 | Ga0075431_100022588 | 3300006847 | Bacteria | 6431 |
| 131 | Ga0075434_100541753 | 3300006871 | Bacteria | 1184 |
| 132 | Ga0075429_100016041 | 3300006880 | Bacteria | 6489 |
| 133 | Ga0068865_100000096 | 3300006881 | Bacteria | 46186 |
| 134 | Ga0099824_1006531 | 3300006942 | Bacteria | 15947 |
| 135 | Ga0079104_1000091 | 3300006946 | Bacteria | 132682 |
| 136 | Ga0099826_10055147 | 3300006948 | Bacteria | 2634 |
| 137 | Ga0105244_10000027 | 3300009036 | Bacteria | 207569 |
| 138 | Ga0105244_10057916 | 3300009036 | Bacteria | 1957 |
| 139 | Ga0105250_10034406 | 3300009092 | Bacteria | 2033 |
| 140 | Ga0105240_10000083 | 3300009093 | Bacteria | 192934 |
| 141 | Ga0105240_10004631 | 3300009093 | Bacteria | 20858 |
| 142 | Ga0105240_10072028 | 3300009093 | Bacteria | 4272 |
| 143 | Ga0105240_10181495 | 3300009093 | Unclassified | 2483 |
| 144 | Ga0105240_10187161 | 3300009093 | Bacteria | 2437 |
| 145 | Ga0105240_10263220 | 3300009093 | Unclassified | 1988 |
| 146 | Ga0105240_10298941 | 3300009093 | Bacteria | 1842 |
| 147 | Ga0105240_10338136 | 3300009093 | Bacteria | 1711 |
| 148 | Ga0105240_10442940 | 3300009093 | Bacteria | 1455 |
| 149 | Ga0105241_10005104 | 3300009174 | Bacteria | 9685 |
| 150 | Ga0105241_10010239 | 3300009174 | Bacteria | 6887 |
| 151 | Ga0105241_10017707 | 3300009174 | Bacteria | 5238 |
| 152 | Ga0105241_10018754 | 3300009174 | Bacteria | 5097 |
| 153 | Ga0105241_10043373 | 3300009174 | Bacteria | 3407 |
| 154 | Ga0105241_10079828 | 3300009174 | Bacteria | 2559 |
| 155 | Ga0105241_10177369 | 3300009174 | Bacteria | 1765 |
| 156 | Ga0105241_10602441 | 3300009174 | Bacteria | 993 |
| 157 | Ga0105242_10010571 | 3300009176 | Bacteria | 7088 |
| 158 | Ga0105242_10195501 | 3300009176 | Bacteria | 1793 |
| 159 | Ga0105242_10703381 | 3300009176 | Unclassified | 989 |
| 160 | Ga0105237_10000198 | 3300009545 | Bacteria | 85302 |
| 161 | Ga0105237_10003401 | 3300009545 | Bacteria | 18925 |
| 162 | Ga0105237_10005210 | 3300009545 | Bacteria | 14705 |
| 163 | Ga0105237_10006711 | 3300009545 | Bacteria | 12720 |
| 164 | Ga0105237_10007709 | 3300009545 | Bacteria | 11759 |
| 165 | Ga0105237_10028356 | 3300009545 | Bacteria | 5703 |
| 166 | Ga0105237_10035356 | 3300009545 | Bacteria | 5056 |
| 167 | Ga0105237_10068325 | 3300009545 | Bacteria | 3547 |
| 168 | Ga0105237_10116024 | 3300009545 | Bacteria | 2671 |
| 169 | Ga0105237_10200734 | 3300009545 | Bacteria | 1994 |
| 170 | Ga0105237_10642815 | 3300009545 | Bacteria | 1068 |
| 171 | Ga0105238_10026895 | 3300009551 | Bacteria | 5863 |
| 172 | Ga0105238_10156656 | 3300009551 | Bacteria | 2253 |
| 173 | Ga0105238_10676786 | 3300009551 | Bacteria | 1043 |
| 174 | Ga0105239_10000011 | 3300010375 | Bacteria | 337500 |
| 175 | Ga0105239_10000115 | 3300010375 | Bacteria | 113217 |
| 176 | Ga0105239_10001867 | 3300010375 | Bacteria | 27574 |
| 177 | Ga0105239_10002632 | 3300010375 | Bacteria | 22682 |
| 178 | Ga0105239_10003144 | 3300010375 | Bacteria | 20493 |
| 179 | Ga0105239_10013222 | 3300010375 | Bacteria | 9172 |
| 180 | Ga0105239_10035070 | 3300010375 | Bacteria | 5510 |
| 181 | Ga0105239_10044847 | 3300010375 | Bacteria | 4846 |
| 182 | Ga0105239_10055411 | 3300010375 | Bacteria | 4348 |
| 183 | Ga0105239_10272698 | 3300010375 | Bacteria | 1903 |
| 184 | Ga0105246_10530160 | 3300011119 | Bacteria | 1005 |
| 185 | Ga0157373_10000007 | 3300013100 | Bacteria | 216734 |
| 186 | Ga0157373_10000050 | 3300013100 | Bacteria | 106011 |
| 187 | Ga0157373_10000601 | 3300013100 | Bacteria | 27966 |
| 188 | Ga0157373_10009093 | 3300013100 | Bacteria | 7350 |
| 189 | Ga0157373_10009649 | 3300013100 | Bacteria | 7124 |
| 190 | Ga0157373_10225155 | 3300013100 | Bacteria | 1324 |
| 191 | Ga0157371_10000074 | 3300013102 | Bacteria | 162988 |
| 192 | Ga0157371_10000164 | 3300013102 | Bacteria | 96408 |
| 193 | Ga0157371_10000486 | 3300013102 | Bacteria | 48340 |
| 194 | Ga0157371_10001622 | 3300013102 | Bacteria | 23008 |
| 195 | Ga0157371_10002408 | 3300013102 | Bacteria | 17899 |
| 196 | Ga0157371_10012774 | 3300013102 | Bacteria | 6402 |
| 197 | Ga0157371_10065206 | 3300013102 | Bacteria | 2579 |
| 198 | Ga0157371_10132533 | 3300013102 | Bacteria | 1774 |
| 199 | Ga0157370_10000192 | 3300013104 | Bacteria | 76389 |
| 200 | Ga0157370_10000303 | 3300013104 | Bacteria | 61868 |
| 201 | Ga0157370_10001177 | 3300013104 | Bacteria | 32660 |
| 202 | Ga0157370_10001475 | 3300013104 | Bacteria | 29107 |
| 203 | Ga0157370_10001760 | 3300013104 | Bacteria | 26710 |
| 204 | Ga0157370_10008143 | 3300013104 | Bacteria | 11342 |
| 205 | Ga0157370_10012581 | 3300013104 | Bacteria | 8770 |
| 206 | Ga0157370_10025011 | 3300013104 | Bacteria | 5909 |
| 207 | Ga0157370_10033538 | 3300013104 | Bacteria | 5006 |
| 208 | Ga0157370_10071406 | 3300013104 | Bacteria | 3275 |
| 209 | Ga0157370_10094687 | 3300013104 | Bacteria | 2802 |
| 210 | Ga0157370_10135508 | 3300013104 | Bacteria | 2295 |
| 211 | Ga0157370_10183764 | 3300013104 | Bacteria | 1942 |
| 212 | Ga0157369_10000031 | 3300013105 | Bacteria | 203214 |
| 213 | Ga0157369_10000494 | 3300013105 | Bacteria | 52196 |
| 214 | Ga0157369_10004306 | 3300013105 | Bacteria | 16809 |
| 215 | Ga0157369_10030017 | 3300013105 | Bacteria | 5999 |
| 216 | Ga0157369_10031116 | 3300013105 | Bacteria | 5880 |
| 217 | Ga0157369_10056415 | 3300013105 | Bacteria | 4239 |
| 218 | Ga0157369_10169603 | 3300013105 | Bacteria | 2300 |
| 219 | Ga0157369_10330982 | 3300013105 | Bacteria | 1583 |
| 220 | Ga0157369_10496389 | 3300013105 | Bacteria | 1263 |
| 221 | Ga0157374_10000536 | 3300013296 | Bacteria | 34007 |
| 222 | Ga0157374_10000967 | 3300013296 | Bacteria | 24929 |
| 223 | Ga0157374_10045908 | 3300013296 | Bacteria | 4044 |
| 224 | Ga0157374_10085876 | 3300013296 | Bacteria | 2993 |
| 225 | Ga0157378_10093511 | 3300013297 | Bacteria | 2737 |
| 226 | Ga0157378_10095349 | 3300013297 | Bacteria | 2710 |
| 227 | Ga0157378_10104066 | 3300013297 | Bacteria | 2595 |
| 228 | Ga0157378_10121436 | 3300013297 | Bacteria | 2409 |
| 229 | Ga0163162_10000005 | 3300013306 | Bacteria | 447195 |
| 230 | Ga0163162_10001421 | 3300013306 | Bacteria | 22260 |
| 231 | Ga0163162_10001734 | 3300013306 | Bacteria | 20435 |
| 232 | Ga0163162_10078628 | 3300013306 | Bacteria | 3364 |
| 233 | Ga0163162_10227865 | 3300013306 | Bacteria | 1994 |
| 234 | Ga0163162_10761407 | 3300013306 | Bacteria | 1087 |
| 235 | Ga0157372_10000042 | 3300013307 | Bacteria | 157651 |
| 236 | Ga0157372_10000249 | 3300013307 | Bacteria | 59656 |
| 237 | Ga0157372_10002322 | 3300013307 | Bacteria | 20604 |
| 238 | Ga0157372_10006765 | 3300013307 | Bacteria | 12189 |
| 239 | Ga0157372_10037629 | 3300013307 | Bacteria | 5339 |
| 240 | Ga0157372_10059286 | 3300013307 | Bacteria | 4281 |
| 241 | Ga0157372_10073868 | 3300013307 | Bacteria | 3844 |
| 242 | Ga0157372_10123248 | 3300013307 | Bacteria | 2979 |
| 243 | Ga0157372_10187213 | 3300013307 | Bacteria | 2397 |
| 244 | Ga0157372_10249421 | 3300013307 | Bacteria | 2060 |
| 245 | Ga0157372_10453972 | 3300013307 | Bacteria | 1494 |
| 246 | Ga0157372_11011737 | 3300013307 | Bacteria | 962 |
| 247 | Ga0157375_10041062 | 3300013308 | Bacteria | 4465 |
| 248 | Ga0157375_10087622 | 3300013308 | Bacteria | 3166 |
| 249 | Ga0157375_10327528 | 3300013308 | Bacteria | 1697 |
| 250 | Ga0157375_10351530 | 3300013308 | Bacteria | 1640 |
| 251 | Ga0157375_10443929 | 3300013308 | Bacteria | 1463 |
| 252 | Ga0182008_10000014 | 3300014497 | Bacteria | 263844 |
| 253 | Ga0182008_10000632 | 3300014497 | Bacteria | 25744 |
| 254 | Ga0182008_10000876 | 3300014497 | Bacteria | 20916 |
| 255 | Ga0182008_10010960 | 3300014497 | Bacteria | 4834 |
| 256 | Ga0182008_10034731 | 3300014497 | Bacteria | 2528 |
| 257 | Ga0157377_10141300 | 3300014745 | Bacteria | 1480 |
| 258 | Ga0182006_1000159 | 3300015261 | Bacteria | 72265 |
| 259 | Ga0182006_1000697 | 3300015261 | Bacteria | 23266 |
| 260 | Ga0182006_1001331 | 3300015261 | Bacteria | 15112 |
| 261 | Ga0182006_1003054 | 3300015261 | Bacteria | 8781 |
| 262 | Ga0182006_1005766 | 3300015261 | Bacteria | 5843 |
| 263 | Ga0182006_1055073 | 3300015261 | Bacteria | 1519 |
| 264 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 265 | Ga0182007_10007341 | 3300015262 | Bacteria | 4628 |
| 266 | Ga0182007_10007397 | 3300015262 | Bacteria | 4608 |
| 267 | Ga0182007_10029643 | 3300015262 | Bacteria | 1873 |
| 268 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 269 | Ga0163161_10000055 | 3300017792 | Bacteria | 114949 |
| 270 | Ga0163161_10000310 | 3300017792 | Bacteria | 42437 |
| 271 | Ga0163161_10000406 | 3300017792 | Bacteria | 36130 |
| 272 | Ga0163161_10001060 | 3300017792 | Bacteria | 20831 |
| 273 | Ga0163161_10001090 | 3300017792 | Bacteria | 20550 |
| 274 | Ga0163161_10001258 | 3300017792 | Bacteria | 18924 |
| 275 | Ga0163161_10007129 | 3300017792 | Bacteria | 7727 |
| 276 | Ga0163161_10491402 | 3300017792 | Bacteria | 998 |
| 277 | Ga0209563_116204 | 3300025230 | Bacteria | 921 |
| 278 | Ga0207427_100210 | 3300025231 | Bacteria | 53314 |
| 279 | Ga0209437_100021 | 3300025233 | Bacteria | 646400 |
| 280 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 281 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 282 | Ga0209646_1001716 | 3300025246 | Bacteria | 5540 |
| 283 | Ga0209026_1000287 | 3300025250 | Bacteria | 57255 |
| 284 | Ga0209026_1002893 | 3300025250 | Bacteria | 6037 |
| 285 | Ga0209026_1004025 | 3300025250 | Bacteria | 4555 |
| 286 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 287 | Ga0209129_1009030 | 3300025258 | Bacteria | 2685 |
| 288 | Ga0209233_1000035 | 3300025261 | Bacteria | 568478 |
| 289 | Ga0209233_1002196 | 3300025261 | Bacteria | 7314 |
| 290 | Ga0209233_1018239 | 3300025261 | Bacteria | 1893 |
| 291 | Ga0209455_1001657 | 3300025272 | Bacteria | 9647 |
| 292 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 293 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 294 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 295 | Ga0209050_1000094 | 3300025298 | Bacteria | 242893 |
| 296 | Ga0207655_1000038 | 3300025728 | Bacteria | 348340 |
| 297 | Ga0207647_10000392 | 3300025904 | Bacteria | 35883 |
| 298 | Ga0207647_10001469 | 3300025904 | Bacteria | 18105 |
| 299 | Ga0207647_10040765 | 3300025904 | Unclassified | 2922 |
| 300 | Ga0207645_10002377 | 3300025907 | Bacteria | 14823 |
| 301 | Ga0207705_10000068 | 3300025909 | Bacteria | 134316 |
| 302 | Ga0207654_10001514 | 3300025911 | Bacteria | 12236 |
| 303 | Ga0207654_10002658 | 3300025911 | Bacteria | 9074 |
| 304 | Ga0207654_10331039 | 3300025911 | Unclassified | 1044 |
| 305 | Ga0207654_10369331 | 3300025911 | Bacteria | 991 |
| 306 | Ga0207707_10031734 | 3300025912 | Bacteria | 4624 |
| 307 | Ga0207695_10000127 | 3300025913 | Bacteria | 227338 |
| 308 | Ga0207695_10023140 | 3300025913 | Bacteria | 7030 |
| 309 | Ga0207695_10292833 | 3300025913 | Bacteria | 1520 |
| 310 | Ga0207695_10398082 | 3300025913 | Bacteria | 1262 |
| 311 | Ga0207671_10000254 | 3300025914 | Bacteria | 79974 |
| 312 | Ga0207671_10002928 | 3300025914 | Bacteria | 17594 |
| 313 | Ga0207671_10004909 | 3300025914 | Bacteria | 12565 |
| 314 | Ga0207671_10009249 | 3300025914 | Bacteria | 8255 |
| 315 | Ga0207671_10020184 | 3300025914 | Bacteria | 5077 |
| 316 | Ga0207671_10029553 | 3300025914 | Bacteria | 4092 |
| 317 | Ga0207671_10048573 | 3300025914 | Bacteria | 3141 |
| 318 | Ga0207671_10068431 | 3300025914 | Bacteria | 2646 |
| 319 | Ga0207671_10416765 | 3300025914 | Bacteria | 1068 |
| 320 | Ga0207660_10010300 | 3300025917 | Bacteria | 6063 |
| 321 | Ga0207657_10063373 | 3300025919 | Bacteria | 3161 |
| 322 | Ga0207657_10210208 | 3300025919 | Bacteria | 1562 |
| 323 | Ga0207657_10375848 | 3300025919 | Bacteria | 1119 |
| 324 | Ga0207652_10004808 | 3300025921 | Bacteria | 10938 |
| 325 | Ga0207646_10229153 | 3300025922 | Bacteria | 1679 |
| 326 | Ga0207681_10012016 | 3300025923 | Bacteria | 5333 |
| 327 | Ga0207694_10077753 | 3300025924 | Bacteria | 2600 |
| 328 | Ga0207644_10002294 | 3300025931 | Bacteria | 12410 |
| 329 | Ga0207690_10001830 | 3300025932 | Bacteria | 13053 |
| 330 | Ga0207690_10014966 | 3300025932 | Bacteria | 4697 |
| 331 | Ga0207690_10050045 | 3300025932 | Bacteria | 2788 |
| 332 | Ga0207706_10000738 | 3300025933 | Bacteria | 34077 |
| 333 | Ga0207686_10183943 | 3300025934 | Bacteria | 1484 |
| 334 | Ga0207704_10000893 | 3300025938 | Bacteria | 13239 |
| 335 | Ga0207661_10012203 | 3300025944 | Bacteria | 6240 |
| 336 | Ga0207667_10000346 | 3300025949 | Bacteria | 63247 |
| 337 | Ga0207667_10003692 | 3300025949 | Bacteria | 18873 |
| 338 | Ga0207667_10011446 | 3300025949 | Bacteria | 10310 |
| 339 | Ga0207667_10013817 | 3300025949 | Bacteria | 9224 |
| 340 | Ga0207667_10035066 | 3300025949 | Bacteria | 5384 |
| 341 | Ga0207667_10136813 | 3300025949 | Bacteria | 2522 |
| 342 | Ga0207667_10162511 | 3300025949 | Bacteria | 2297 |
| 343 | Ga0207651_10031651 | 3300025960 | Bacteria | 3385 |
| 344 | Ga0207677_10072866 | 3300026023 | Bacteria | 2430 |
| 345 | Ga0207677_10087395 | 3300026023 | Bacteria | 2257 |
| 346 | Ga0207639_10387559 | 3300026041 | Unclassified | 1256 |
| 347 | Ga0207678_10051696 | 3300026067 | Bacteria | 3547 |
| 348 | Ga0207702_10000023 | 3300026078 | Bacteria | 189234 |
| 349 | Ga0207702_10012955 | 3300026078 | Bacteria | 6937 |
| 350 | Ga0207702_10013701 | 3300026078 | Bacteria | 6735 |
| 351 | Ga0207702_10021352 | 3300026078 | Bacteria | 5360 |
| 352 | Ga0207702_10035373 | 3300026078 | Bacteria | 4177 |
| 353 | Ga0207702_10687211 | 3300026078 | Unclassified | 1008 |
| 354 | Ga0207648_10001082 | 3300026089 | Bacteria | 30521 |
| 355 | Ga0207674_10107292 | 3300026116 | Bacteria | 2769 |
| 356 | Ga0207683_10002826 | 3300026121 | Bacteria | 15171 |
| 357 | Ga0207698_10003197 | 3300026142 | Bacteria | 9833 |
| 358 | Ga0207698_10384700 | 3300026142 | Unclassified | 1336 |
| 359 | Ga0207698_10862189 | 3300026142 | Bacteria | 911 |
| 360 | Ga0209281_1000311 | 3300027111 | Bacteria | 86930 |
| 361 | Ga0209489_112096 | 3300027361 | Bacteria | 8182 |
| 362 | Ga0209282_1087910 | 3300027666 | Bacteria | 1637 |
| 363 | Ga0209974_10014312 | 3300027876 | Bacteria | 2641 |
| 364 | Ga0268266_10000185 | 3300028379 | Bacteria | 110685 |
| 365 | Ga0268264_10767522 | 3300028381 | Bacteria | 961 |
| 366 | Ga0265337_1000781 | 3300028556 | Bacteria | 16785 |
| 367 | Ga0265326_10001730 | 3300028558 | Bacteria | 7555 |
| 368 | Ga0265319_1000096 | 3300028563 | Bacteria | 67662 |
| 369 | Ga0265319_1000553 | 3300028563 | Bacteria | 25349 |
| 370 | Ga0265334_10000816 | 3300028573 | Bacteria | 15578 |
| 371 | Ga0265318_10006692 | 3300028577 | Bacteria | 5279 |
| 372 | Ga0265318_10057898 | 3300028577 | Bacteria | 1447 |
| 373 | Ga0265323_10000359 | 3300028653 | Bacteria | 26221 |
| 374 | Ga0265322_10000310 | 3300028654 | Bacteria | 20562 |
| 375 | Ga0265322_10007804 | 3300028654 | Bacteria | 3119 |
| 376 | Ga0265336_10000488 | 3300028666 | Bacteria | 23335 |
| 377 | Ga0307517_10000408 | 3300028786 | Bacteria | 73511 |
| 378 | Ga0307515_10000316 | 3300028794 | Bacteria | 119243 |
| 379 | Ga0307515_10000676 | 3300028794 | Bacteria | 78539 |
| 380 | Ga0307515_10055079 | 3300028794 | Bacteria | 5821 |
| 381 | Ga0265338_10000493 | 3300028800 | Bacteria | 70460 |
| 382 | Ga0265338_10000597 | 3300028800 | Bacteria | 63672 |
| 383 | Ga0265338_10028183 | 3300028800 | Bacteria | 5607 |
| 384 | Ga0265338_10058171 | 3300028800 | Bacteria | 3414 |
| 385 | Ga0265324_10000306 | 3300029957 | Bacteria | 36178 |
| 386 | Ga0265324_10003218 | 3300029957 | Bacteria | 7897 |
| 387 | Ga0316183_1171692 | 3300030742 | Bacteria | 16840 |
| 388 | Ga0316181_1145183 | 3300030744 | Bacteria | 1902 |
| 389 | Ga0265330_10000356 | 3300031235 | Bacteria | 32258 |
| 390 | Ga0265332_10000479 | 3300031238 | Bacteria | 27656 |
| 391 | Ga0265332_10014947 | 3300031238 | Bacteria | 3431 |
| 392 | Ga0265328_10019230 | 3300031239 | Bacteria | 2626 |
| 393 | Ga0265320_10008237 | 3300031240 | Bacteria | 6394 |
| 394 | Ga0265320_10011764 | 3300031240 | Bacteria | 5133 |
| 395 | Ga0265325_10011238 | 3300031241 | Bacteria | 5148 |
| 396 | Ga0265325_10016833 | 3300031241 | Bacteria | 4078 |
| 397 | Ga0265325_10070946 | 3300031241 | Bacteria | 1749 |
| 398 | Ga0265329_10000468 | 3300031242 | Bacteria | 21094 |
| 399 | Ga0265340_10019677 | 3300031247 | Bacteria | 3475 |
| 400 | Ga0265339_10002212 | 3300031249 | Bacteria | 14105 |
| 401 | Ga0265339_10159354 | 3300031249 | Bacteria | 1136 |
| 402 | Ga0265331_10001743 | 3300031250 | Bacteria | 15636 |
| 403 | Ga0265327_10000896 | 3300031251 | Bacteria | 43961 |
| 404 | Ga0265327_10019230 | 3300031251 | Bacteria | 4207 |
| 405 | Ga0265316_10004433 | 3300031344 | Bacteria | 13989 |
| 406 | Ga0265316_10021616 | 3300031344 | Bacteria | 5444 |
| 407 | Ga0265316_10162854 | 3300031344 | Unclassified | 1667 |
| 408 | Ga0307408_100000561 | 3300031548 | Bacteria | 32112 |
| 409 | Ga0307408_100000566 | 3300031548 | Bacteria | 31917 |
| 410 | Ga0307408_100000736 | 3300031548 | Bacteria | 26464 |
| 411 | Ga0307408_100000824 | 3300031548 | Bacteria | 24639 |
| 412 | Ga0307408_100004742 | 3300031548 | Bacteria | 9176 |
| 413 | Ga0265313_10001526 | 3300031595 | Bacteria | 21525 |
| 414 | Ga0265313_10071979 | 3300031595 | Bacteria | 1590 |
| 415 | Ga0265314_10001494 | 3300031711 | Bacteria | 25965 |
| 416 | Ga0265342_10003626 | 3300031712 | Bacteria | 12570 |
| 417 | Ga0265342_10071778 | 3300031712 | Bacteria | 2016 |
| 418 | Ga0316576_10092761 | 3300031727 | Bacteria | 2250 |
| 419 | Ga0307516_10073865 | 3300031730 | Bacteria | 3267 |
| 420 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 421 | Ga0307405_10000006 | 3300031731 | Bacteria | 361477 |
| 422 | Ga0316577_10039680 | 3300031733 | Unclassified | 2634 |
| 423 | Ga0307413_10000039 | 3300031824 | Bacteria | 33762 |
| 424 | Ga0307413_10413148 | 3300031824 | Bacteria | 1061 |
| 425 | Ga0307410_10000363 | 3300031852 | Bacteria | 17675 |
| 426 | Ga0307406_10000950 | 3300031901 | Bacteria | 16237 |
| 427 | Ga0307406_10072243 | 3300031901 | Bacteria | 2264 |
| 428 | Ga0307407_10000031 | 3300031903 | Bacteria | 87995 |
| 429 | Ga0307412_10000043 | 3300031911 | Bacteria | 166562 |
| 430 | Ga0307412_10002048 | 3300031911 | Bacteria | 11186 |
| 431 | Ga0307412_10047998 | 3300031911 | Bacteria | 2806 |
| 432 | Ga0307412_10290256 | 3300031911 | Bacteria | 1288 |
| 433 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 434 | Ga0307416_100000179 | 3300032002 | Bacteria | 34391 |
| 435 | Ga0307416_101109809 | 3300032002 | Bacteria | 896 |
| 436 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 437 | Ga0307414_10000713 | 3300032004 | Bacteria | 16976 |
| 438 | Ga0307414_10003845 | 3300032004 | Bacteria | 8076 |
| 439 | Ga0307414_10010702 | 3300032004 | Bacteria | 5341 |
| 440 | Ga0307414_10047200 | 3300032004 | Bacteria | 2962 |
| 441 | Ga0307414_10052340 | 3300032004 | Bacteria | 2841 |
| 442 | Ga0307414_10058091 | 3300032004 | Bacteria | 2724 |
| 443 | Ga0307414_10098436 | 3300032004 | Bacteria | 2194 |
| 444 | Ga0307414_10120713 | 3300032004 | Bacteria | 2014 |
| 445 | Ga0307414_10326961 | 3300032004 | Bacteria | 1307 |
| 446 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 447 | Ga0307411_10132693 | 3300032005 | Bacteria | 1823 |
| 448 | Ga0307507_10000099 | 3300033179 | Bacteria | 139532 |
| 449 | Ga0307510_10001986 | 3300033180 | Bacteria | 23038 |
| 450 | Ga0307510_10039095 | 3300033180 | Bacteria | 5234 |
| 451 | Ga0373926_0030749 | 3300035083 | Bacteria | 1892 |
| 452 | Ga0373944_0003206 | 3300035089 | Bacteria | 4202 |
| 453 | Ga0373943_0007974 | 3300035170 | Unclassified | 4754 |
| 454 | Ga0373946_0004828 | 3300035171 | Bacteria | 4852 |
| 455 | Ga0316574_0118220 | 3300035398 | Bacteria | 1701 |
| 456 | Ga0373927_0016628 | 3300035695 | Bacteria | 4853 |
| 457 | Ga0373947_0004258 | 3300035725 | Bacteria | 8397 |
| 458 | Ga0316582_0595160 | 3300036647 | Unclassified | 761 |
| 459 | Ga0316584_0002834 | 3300036712 | Bacteria | 11117 |
| 460 | Ga0316584_0530281 | 3300036712 | Bacteria | 824 |
| 461 | Ga0373925_0002642 | 3300037068 | Bacteria | 14220 |
| 462 | Ga0395899_0000173 | 3300037312 | Bacteria | 96904 |
| 463 | Ga0395899_0000177 | 3300037312 | Bacteria | 94226 |
| 464 | Ga0395899_0000238 | 3300037312 | Bacteria | 74240 |
| 465 | Ga0395899_0006897 | 3300037312 | Bacteria | 8797 |
| 466 | Ga0395899_0010845 | 3300037312 | Bacteria | 6985 |
| 467 | Ga0395900_0000139 | 3300037418 | Bacteria | 122708 |
| 468 | Ga0395900_0001986 | 3300037418 | Bacteria | 23094 |
| 469 | Ga0395900_0114314 | 3300037418 | Bacteria | 2770 |
| 470 | Ga0395900_0164466 | 3300037418 | Bacteria | 2262 |
| 471 | Ga0395900_0225301 | 3300037418 | Bacteria | 1888 |
| 472 | Ga0395900_0344081 | 3300037418 | Bacteria | 1466 |
| 473 | Ga0395898_0152481 | 3300037466 | Bacteria | 2211 |
| 474 | Ga0395905_0000169 | 3300037471 | Bacteria | 106579 |
| 475 | Ga0395905_0009042 | 3300037471 | Bacteria | 9772 |
| 476 | Ga0395905_0013551 | 3300037471 | Bacteria | 7811 |
| 477 | Ga0395905_0228117 | 3300037471 | Bacteria | 1742 |
| 478 | Ga0395901_0000838 | 3300038443 | Bacteria | 33913 |
| 479 | Ga0395901_0105660 | 3300038443 | Bacteria | 2955 |
| 480 | Ga0395901_0216416 | 3300038443 | Bacteria | 2004 |
| 481 | Ga0395901_0529518 | 3300038443 | Bacteria | 1196 |
| 482 | Ga0395901_0892942 | 3300038443 | Bacteria | 871 |
| 483 | Ga0400483_129034 | 3300039062 | Bacteria | 10301 |
| 484 | Ga0400483_246494 | 3300039062 | Bacteria | 22387 |
| 485 | Ga0400489_29524 | 3300039093 | Bacteria | 3407 |
| 486 | Ga0436361_0616042 | 3300039447 | Bacteria | 10564 |
| 487 | Ga0439436_0010741 | 3300041404 | Bacteria | 2790 |
| 488 | Ga0439447_000262 | 3300041407 | Bacteria | 18516 |
| 489 | Ga0451807_1497265 | 3300041486 | Bacteria | 1009 |
| 490 | Ga0451807_2107158 | 3300041486 | Bacteria | 1501 |
| 491 | Ga0451843_0848344 | 3300041509 | Bacteria | 2289 |
| 492 | Ga0451855_0315542 | 3300041511 | Bacteria | 4988 |
| 493 | Ga0451855_1357253 | 3300041511 | Unclassified | 2154 |
| 494 | Ga0439448_0006422 | 3300042005 | Bacteria | 3381 |
| 495 | Ga0439457_000014 | 3300042014 | Bacteria | 36364 |
| 496 | Ga0439457_018034 | 3300042014 | Bacteria | 1567 |
| 497 | Ga0439462_0003017 | 3300042015 | Bacteria | 3997 |
| 498 | Ga0451577_0000250 | 3300042876 | Bacteria | 105934 |
| 499 | Ga0451577_0119839 | 3300042876 | Bacteria | 2357 |
| 500 | Ga0451577_0153015 | 3300042876 | Bacteria | 2076 |
| 501 | Ga0451577_0299081 | 3300042876 | Unclassified | 1458 |
| 502 | Ga0453683_0000418 | 3300044673 | Bacteria | 49409 |
| 503 | Ga0453683_0500574 | 3300044673 | Unclassified | 788 |
| 504 | Ga0466965_0188134 | 3300044683 | Bacteria | 1091 |
| 505 | Ga0466966_0011391 | 3300044684 | Bacteria | 5897 |
| 506 | Ga0466961_0023410 | 3300044693 | Bacteria | 3974 |
| 507 | Ga0453684_0000148 | 3300044712 | Bacteria | 308453 |
| 508 | Ga0453684_0000542 | 3300044712 | Bacteria | 143132 |
| 509 | Ga0453684_0000771 | 3300044712 | Bacteria | 110664 |
| 510 | Ga0453684_0083110 | 3300044712 | Bacteria | 3986 |
| 511 | Ga0453684_0098119 | 3300044712 | Bacteria | 3593 |
| 512 | Ga0453684_0158115 | 3300044712 | Bacteria | 2684 |
| 513 | Ga0453684_0213492 | 3300044712 | Bacteria | 2241 |
| 514 | Ga0453684_0306036 | 3300044712 | Bacteria | 1805 |
| 515 | Ga0453684_0376823 | 3300044712 | Unclassified | 1594 |
| 516 | Ga0466968_0162906 | 3300044735 | Bacteria | 1030 |
| 517 | Ga0466957_0029802 | 3300044842 | Bacteria | 3256 |
| 518 | Ga0466959_0057164 | 3300045049 | Bacteria | 2845 |
| 519 | Ga0451576_0000020 | 3300045051 | Bacteria | 529568 |
| 520 | Ga0451576_0000216 | 3300045051 | Bacteria | 142333 |
| 521 | Ga0451576_0091205 | 3300045051 | Bacteria | 3170 |
| 522 | Ga0495603_0011823 | 3300046455 | Bacteria | 5283 |
| 523 | Ga0495638_0156087 | 3300046460 | Bacteria | 1320 |
| 524 | Ga0495651_0314471 | 3300046462 | Bacteria | 1046 |
| 525 | Ga0495650_0000107 | 3300046471 | Bacteria | 200864 |
| 526 | Ga0495650_0011966 | 3300046471 | Bacteria | 4699 |
| 527 | Ga0495580_0010779 | 3300046472 | Bacteria | 7099 |
| 528 | Ga0495582_0051700 | 3300046473 | Bacteria | 2265 |
| 529 | Ga0495639_0000789 | 3300046475 | Bacteria | 14448 |
| 530 | Ga0495639_0167731 | 3300046475 | Bacteria | 1065 |
| 531 | Ga0495585_0000116 | 3300046492 | Bacteria | 86272 |
| 532 | Ga0495585_0000170 | 3300046492 | Bacteria | 70224 |
| 533 | Ga0495606_0002103 | 3300046507 | Bacteria | 24231 |
| 534 | Ga0495606_0012971 | 3300046507 | Bacteria | 6630 |
| 535 | Ga0495606_0032101 | 3300046507 | Bacteria | 3642 |
| 536 | Ga0495606_0051259 | 3300046507 | Bacteria | 2693 |
| 537 | Ga0495606_0055915 | 3300046507 | Bacteria | 2549 |
| 538 | Ga0495606_0078485 | 3300046507 | Bacteria | 2059 |
| 539 | Ga0495610_0000724 | 3300046512 | Bacteria | 31376 |
| 540 | Ga0495610_0000784 | 3300046512 | Bacteria | 29827 |
| 541 | Ga0495610_0056619 | 3300046512 | Bacteria | 1884 |
| 542 | Ga0495616_0000882 | 3300046513 | Bacteria | 21777 |
| 543 | Ga0495616_0006658 | 3300046513 | Bacteria | 6974 |
| 544 | Ga0495616_0018662 | 3300046513 | Bacteria | 3802 |
| 545 | Ga0495620_0084640 | 3300046515 | Bacteria | 1279 |
| 546 | Ga0495630_0019994 | 3300046517 | Bacteria | 4930 |
| 547 | Ga0495637_0028231 | 3300046520 | Bacteria | 2507 |
| 548 | Ga0495643_0002717 | 3300046522 | Bacteria | 13619 |
| 549 | Ga0495648_0165233 | 3300046524 | Bacteria | 1140 |
| 550 | Ga0495663_0035203 | 3300046525 | Bacteria | 1503 |
| 551 | Ga0495652_0187976 | 3300046529 | Bacteria | 1579 |
| 552 | Ga0495652_0359872 | 3300046529 | Bacteria | 1040 |
| 553 | Ga0495654_0034318 | 3300046530 | Bacteria | 2561 |
| 554 | Ga0495665_0001769 | 3300046531 | Bacteria | 11640 |
| 555 | Ga0495609_0001895 | 3300046538 | Bacteria | 13334 |
| 556 | Ga0495609_0028800 | 3300046538 | Bacteria | 2533 |
| 557 | Ga0495622_0015212 | 3300046557 | Bacteria | 3576 |
| 558 | Ga0495633_0000006 | 3300046558 | Bacteria | 326774 |
| 559 | Ga0495633_0006149 | 3300046558 | Bacteria | 7181 |
| 560 | Ga0495633_0101684 | 3300046558 | Bacteria | 1334 |
| 561 | Ga0495668_0000011 | 3300046616 | Bacteria | 472186 |
| 562 | Ga0495668_0110833 | 3300046616 | Bacteria | 1501 |
| 563 | Ga0495668_0119227 | 3300046616 | Bacteria | 1443 |
| 564 | Ga0495625_0000021 | 3300046660 | Bacteria | 282133 |
| 565 | Ga0495625_0000344 | 3300046660 | Bacteria | 71298 |
| 566 | Ga0495625_0001450 | 3300046660 | Bacteria | 28784 |
| 567 | Ga0495625_0014051 | 3300046660 | Bacteria | 6410 |
| 568 | Ga0495625_0014342 | 3300046660 | Bacteria | 6331 |
| 569 | Ga0495625_0052836 | 3300046660 | Bacteria | 2908 |
| 570 | Ga0495625_0077428 | 3300046660 | Bacteria | 2323 |
| 571 | Ga0495625_0241358 | 3300046660 | Bacteria | 1176 |
| 572 | Ga0495625_0377360 | 3300046660 | Bacteria | 890 |
| 573 | Ga0495661_0003287 | 3300046665 | Bacteria | 12000 |
| 574 | Ga0495661_0011479 | 3300046665 | Bacteria | 6010 |
| 575 | Ga0495588_0021304 | 3300046674 | Bacteria | 3193 |
| 576 | Ga0495658_0078696 | 3300046683 | Bacteria | 1930 |
| 577 | Ga0495671_0035629 | 3300046692 | Bacteria | 2526 |
| 578 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 579 | Ga0495660_0001836 | 3300046810 | Bacteria | 13932 |
| 580 | Ga0495660_0059145 | 3300046810 | Bacteria | 2062 |
| 581 | Ga0495581_0013370 | 3300047315 | Unclassified | 4759 |
| 582 | Ga0495683_0173691 | 3300047323 | Bacteria | 989 |
| 583 | Ga0495687_000356 | 3300047443 | Bacteria | 57396 |
| 584 | Ga0495687_002785 | 3300047443 | Bacteria | 13508 |
| 585 | Ga0495673_0009304 | 3300047469 | Bacteria | 5446 |
| 586 | Ga0495686_0000107 | 3300047472 | Bacteria | 174386 |
| 587 | Ga0495686_0000673 | 3300047472 | Bacteria | 46191 |
| 588 | Ga0495686_0054572 | 3300047472 | Bacteria | 2502 |
| 589 | Ga0495686_0087020 | 3300047472 | Bacteria | 1901 |
| 590 | Ga0495593_0002299 | 3300047673 | Bacteria | 11458 |
| 591 | Ga0495614_0002616 | 3300048089 | Bacteria | 8001 |
| 592 | Ga0496115_0031776 | 3300048918 | Bacteria | 4162 |
| 593 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 594 | Ga0496117_0005463 | 3300048920 | Bacteria | 13327 |
| 595 | Ga0496118_0029437 | 3300048921 | Bacteria | 4605 |
| 596 | Ga0496118_0072993 | 3300048921 | Bacteria | 2461 |
| 597 | Ga0496121_0090261 | 3300048924 | Bacteria | 2396 |
| 598 | Ga0496121_0118226 | 3300048924 | Bacteria | 2007 |
| 599 | Ga0496121_0119604 | 3300048924 | Bacteria | 1992 |
| 600 | Ga0496122_0005019 | 3300048925 | Bacteria | 16009 |
| 601 | Ga0496123_0006462 | 3300048926 | Bacteria | 11343 |
| 602 | Ga0496123_0010972 | 3300048926 | Bacteria | 7924 |
| 603 | Ga0496124_0020328 | 3300048927 | Bacteria | 6140 |
| 604 | Ga0496124_0053507 | 3300048927 | Bacteria | 3421 |
| 605 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 606 | Ga0496125_0000452 | 3300048928 | Bacteria | 74236 |
| 607 | Ga0496125_0153492 | 3300048928 | Bacteria | 1577 |
| 608 | Ga0496126_0023580 | 3300048929 | Bacteria | 5961 |
| 609 | Ga0495682_0041665 | 3300049460 | Bacteria | 1683 |
| 610 | Ga0501323_000375 | 3300049539 | Bacteria | 3202 |
| 611 | Ga0501031_0004782 | 3300049568 | Bacteria | 8794 |
| 612 | Ga0501032_0003573 | 3300049569 | Bacteria | 11854 |
| 613 | Ga0501032_0016210 | 3300049569 | Bacteria | 5242 |
| 614 | Ga0501033_0000005 | 3300049570 | Bacteria | 379089 |
| 615 | Ga0501034_0000259 | 3300049571 | Bacteria | 95584 |
| 616 | Ga0501034_0035621 | 3300049571 | Bacteria | 5045 |
| 617 | Ga0501034_0255490 | 3300049571 | Bacteria | 1696 |
| 618 | Ga0501036_0014746 | 3300049572 | Bacteria | 6517 |
| 619 | Ga0501036_0169703 | 3300049572 | Bacteria | 1838 |
| 620 | Ga0501038_0012276 | 3300049574 | Bacteria | 7824 |
| 621 | Ga0501039_0023363 | 3300049575 | Bacteria | 4746 |
| 622 | Ga0501040_0376781 | 3300049576 | Bacteria | 1018 |
| 623 | Ga0501043_0017878 | 3300049579 | Bacteria | 5560 |
| 624 | Ga0501047_0193119 | 3300049581 | Bacteria | 1899 |
| 625 | Ga0501070_0304069 | 3300049586 | Unclassified | 1299 |
| 626 | Ga0501249_000012 | 3300049679 | Bacteria | 153759 |
| 627 | Ga0501249_001078 | 3300049679 | Bacteria | 5790 |
| 628 | Ga0501241_007429 | 3300049758 | Bacteria | 2006 |
| 629 | Ga0501241_013856 | 3300049758 | Unclassified | 1464 |
| 630 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 631 | Ga0501269_006526 | 3300049766 | Bacteria | 1407 |
| 632 | Ga0501280_001973 | 3300049776 | Bacteria | 3571 |
| 633 | Ga0501280_004479 | 3300049776 | Bacteria | 2052 |
| 634 | Ga0501035_0023485 | 3300049822 | Bacteria | 5656 |
| 635 | Ga0501035_0165986 | 3300049822 | Bacteria | 1909 |
| 636 | Ga0501044_0011700 | 3300049823 | Bacteria | 9506 |
| 637 | Ga0501044_0145228 | 3300049823 | Bacteria | 2358 |
| 638 | Ga0501044_0236580 | 3300049823 | Bacteria | 1772 |
| 639 | Ga0501045_0000184 | 3300049824 | Bacteria | 34854 |
| 640 | nmdc:mga03683_29_c1 | 3300050489 | Bacteria | 74308 |
| 641 | nmdc:mga00v17_285_c1 | 3300050491 | Bacteria | 29912 |
| 642 | nmdc:mga0k408_141042_c1 | 3300050493 | Bacteria | 1434 |
| 643 | nmdc:mga0k408_534_c1 | 3300050493 | Bacteria | 20938 |
| 644 | nmdc:mga0k408_88770_c1 | 3300050493 | Bacteria | 1815 |
| 645 | nmdc:mga07m45_99320_c1 | 3300050496 | Bacteria | 948 |
| 646 | nmdc:mga09592_45525_c1 | 3300050508 | Bacteria | 3696 |
| 647 | nmdc:mga06r32_137909_c1 | 3300050510 | Bacteria | 2414 |
| 648 | nmdc:mga0a205_131170_c1 | 3300050515 | Bacteria | 2406 |
| 649 | Ga0500635_0000417 | 3300053080 | Bacteria | 12581 |
| 650 | Ga0500646_0002249 | 3300053090 | Bacteria | 5022 |
| 651 | Ga0500646_0010716 | 3300053090 | Bacteria | 2353 |
| 652 | Ga0500646_0015810 | 3300053090 | Bacteria | 1967 |
| 653 | Ga0500647_0076489 | 3300053091 | Bacteria | 1606 |
| 654 | Ga0500583_0000060 | 3300053092 | Bacteria | 68112 |
| 655 | Ga0500651_0001777 | 3300053093 | Bacteria | 11046 |
| 656 | Ga0500651_0183900 | 3300053093 | Bacteria | 1240 |
| 657 | Ga0500641_0000010 | 3300053096 | Bacteria | 171383 |
| 658 | Ga0500641_0000275 | 3300053096 | Bacteria | 19089 |
| 659 | Ga0500641_0001720 | 3300053096 | Bacteria | 7784 |
| 660 | Ga0500641_0079603 | 3300053096 | Bacteria | 1389 |
| 661 | Ga0500650_0151774 | 3300053098 | Bacteria | 1071 |
| 662 | Ga0500594_0006680 | 3300053118 | Bacteria | 2599 |
| 663 | Ga0500618_000016 | 3300053125 | Bacteria | 164049 |
| 664 | Ga0500642_0201332 | 3300053130 | Bacteria | 926 |
| 665 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 666 | Ga0500658_0197147 | 3300053134 | Unclassified | 920 |
| 667 | Ga0500559_0040733 | 3300053136 | Bacteria | 2024 |
| 668 | Ga0500624_000265 | 3300053157 | Bacteria | 18286 |
| 669 | Ga0500636_0200309 | 3300053177 | Bacteria | 1057 |
| 670 | Ga0500584_049348 | 3300053726 | Bacteria | 1909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003320 | rootH2_10228453 | rootH2_102284532 | 199 |
| 2 | 3300025913 | Ga0207695_10398082 | Ga0207695_103980822 | 199 |
| 3 | 3300002772 | JGI25164J39214_1001360 | JGI25164J39214_10013605 | 206 |
| 4 | 3300003214 | JGI25165J46597_1000728 | JGI25165J46597_100072811 | 206 |
| 5 | 3300025230 | Ga0209563_116204 | Ga0209563_1162041 | 206 |
| 6 | 3300025231 | Ga0207427_100210 | Ga0207427_10021035 | 206 |
| 7 | 3300025233 | Ga0209437_100021 | Ga0209437_100021620 | 206 |
| 8 | 3300025261 | Ga0209233_1000035 | Ga0209233_100003517 | 206 |
| 9 | 3300025914 | Ga0207671_10029553 | Ga0207671_100295534 | 207 |
| 10 | 3300025246 | Ga0209646_1001716 | Ga0209646_10017166 | 209 |
| 11 | 3300009545 | Ga0105237_10028356 | Ga0105237_100283563 | 210 |
| 12 | 3300010375 | Ga0105239_10002632 | Ga0105239_100026323 | 210 |
| 13 | 3300026142 | Ga0207698_10862189 | Ga0207698_108621892 | 211 |
| 14 | 3300003323 | rootH1_10098029 | rootH1_100980291 | 212 |
| 15 | 3300005616 | Ga0068852_101034905 | Ga0068852_1010349052 | 212 |
| 16 | 3300013307 | Ga0157372_10453972 | Ga0157372_104539722 | 215 |
| 17 | 3300005353 | Ga0070669_100007276 | Ga0070669_1000072766 | 217 |
| 18 | 3300013102 | Ga0157371_10132533 | Ga0157371_101325332 | 217 |
| 19 | 3300025923 | Ga0207681_10012016 | Ga0207681_100120163 | 217 |
| 20 | 3300041404 | Ga0439436_0010741 | Ga0439436_0010741_576_1292 | 217 |
| 21 | 3300042014 | Ga0439457_000014 | Ga0439457_000014_24493_25209 | 217 |
| 22 | 3300042015 | Ga0439462_0003017 | Ga0439462_0003017_1748_2464 | 217 |
| 23 | 3300005329 | Ga0070683_100018067 | Ga0070683_1000180672 | 218 |
| 24 | 3300005535 | Ga0070684_100080813 | Ga0070684_1000808134 | 218 |
| 25 | 3300013100 | Ga0157373_10000050 | Ga0157373_10000050108 | 218 |
| 26 | 3300013307 | Ga0157372_10002322 | Ga0157372_100023224 | 218 |
| 27 | 3300025944 | Ga0207661_10012203 | Ga0207661_100122036 | 218 |
| 28 | 3300050515 | nmdc:mga0a205_131170_c1 | nmdc:mga0a205_131170_c1_10_681 | 218 |
| 29 | 3300053134 | Ga0500658_0197147 | Ga0500658_0197147_55_771 | 218 |
| 30 | 3300042014 | Ga0439457_018034 | Ga0439457_018034_771_1487 | 219 |
| 31 | 3300044842 | Ga0466957_0029802 | Ga0466957_0029802_167_883 | 219 |
| 32 | 3300053177 | Ga0500636_0200309 | Ga0500636_0200309_312_1028 | 219 |
| 33 | 3300006195 | Ga0075366_10164955 | Ga0075366_101649552 | 220 |
| 34 | 3300028381 | Ga0268264_10767522 | Ga0268264_107675221 | 220 |
| 35 | 3300005458 | Ga0070681_10233580 | Ga0070681_102335802 | 221 |
| 36 | 3300015261 | Ga0182006_1005766 | Ga0182006_10057667 | 221 |
| 37 | 3300013296 | Ga0157374_10085876 | Ga0157374_100858762 | 222 |
| 38 | 3300046616 | Ga0495668_0110833 | Ga0495668_0110833_216_974 | 222 |
| 39 | 3300005338 | Ga0068868_100274731 | Ga0068868_1002747311 | 223 |
| 40 | 3300005614 | Ga0068856_100695945 | Ga0068856_1006959451 | 223 |
| 41 | 3300026078 | Ga0207702_10687211 | Ga0207702_106872111 | 223 |
| 42 | 2209111006 | 2214746907 | 2213757316 | 224 |
| 43 | 3300005468 | Ga0070707_100333753 | Ga0070707_1003337532 | 224 |
| 44 | 3300005471 | Ga0070698_100775467 | Ga0070698_1007754672 | 224 |
| 45 | 3300005547 | Ga0070693_100131269 | Ga0070693_1001312692 | 224 |
| 46 | 3300013105 | Ga0157369_10169603 | Ga0157369_101696032 | 224 |
| 47 | 3300013307 | Ga0157372_10037629 | Ga0157372_100376296 | 224 |
| 48 | 3300025922 | Ga0207646_10229153 | Ga0207646_102291532 | 224 |
| 49 | 3300005336 | Ga0070680_100143031 | Ga0070680_1001430312 | 225 |
| 50 | 3300005345 | Ga0070692_10392937 | Ga0070692_103929371 | 225 |
| 51 | 3300005467 | Ga0070706_100039678 | Ga0070706_1000396784 | 225 |
| 52 | 3300005471 | Ga0070698_100022109 | Ga0070698_1000221092 | 225 |
| 53 | 3300005577 | Ga0068857_100390008 | Ga0068857_1003900082 | 225 |
| 54 | 3300005614 | Ga0068856_100023803 | Ga0068856_1000238034 | 225 |
| 55 | 3300005985 | Ga0081539_10000261 | Ga0081539_1000026126 | 225 |
| 56 | 3300013307 | Ga0157372_10059286 | Ga0157372_100592864 | 225 |
| 57 | 3300026078 | Ga0207702_10035373 | Ga0207702_100353734 | 225 |
| 58 | 3300005546 | Ga0070696_100000897 | Ga0070696_10000089711 | 226 |
| 59 | 3300006051 | Ga0075364_10001344 | Ga0075364_100013443 | 226 |
| 60 | 3300006177 | Ga0075362_10000037 | Ga0075362_1000003753 | 226 |
| 61 | 3300009093 | Ga0105240_10187161 | Ga0105240_101871612 | 226 |
| 62 | 3300010375 | Ga0105239_10000011 | Ga0105239_10000011302 | 226 |
| 63 | 3300046475 | Ga0495639_0167731 | Ga0495639_0167731_108_857 | 226 |
| 64 | 3300046492 | Ga0495585_0000170 | Ga0495585_0000170_28021_28770 | 226 |
| 65 | 3300046530 | Ga0495654_0034318 | Ga0495654_0034318_1592_2341 | 226 |
| 66 | 3300046538 | Ga0495609_0001895 | Ga0495609_0001895_6641_7390 | 226 |
| 67 | 3300046557 | Ga0495622_0015212 | Ga0495622_0015212_2657_3406 | 226 |
| 68 | 3300046558 | Ga0495633_0000006 | Ga0495633_0000006_155684_156433 | 226 |
| 69 | 3300046616 | Ga0495668_0000011 | Ga0495668_0000011_17685_18434 | 226 |
| 70 | 3300046660 | Ga0495625_0001450 | Ga0495625_0001450_2929_3678 | 226 |
| 71 | 3300046683 | Ga0495658_0078696 | Ga0495658_0078696_998_1747 | 226 |
| 72 | 3300046810 | Ga0495660_0059145 | Ga0495660_0059145_357_1106 | 226 |
| 73 | 3300049460 | Ga0495682_0041665 | Ga0495682_0041665_792_1541 | 226 |
| 74 | 3300050489 | nmdc:mga03683_29_c1 | nmdc:mga03683_29_c1_60618_61307 | 226 |
| 75 | 3300050491 | nmdc:mga00v17_285_c1 | nmdc:mga00v17_285_c1_26909_27598 | 226 |
| 76 | 3300005614 | Ga0068856_100014566 | Ga0068856_1000145664 | 227 |
| 77 | 3300009174 | Ga0105241_10043373 | Ga0105241_100433733 | 227 |
| 78 | 3300025250 | Ga0209026_1000287 | Ga0209026_100028727 | 227 |
| 79 | 3300026078 | Ga0207702_10012955 | Ga0207702_100129555 | 227 |
| 80 | 3300041511 | Ga0451855_1357253 | Ga0451855_1357253_845_1555 | 227 |
| 81 | 3300046507 | Ga0495606_0078485 | Ga0495606_0078485_1010_1759 | 227 |
| 82 | 3300046810 | Ga0495660_0001836 | Ga0495660_0001836_233_982 | 227 |
| 83 | 3300004799 | Ga0058863_11752149 | Ga0058863_117521491 | 228 |
| 84 | 3300004803 | Ga0058862_12181088 | Ga0058862_121810881 | 228 |
| 85 | 3300005336 | Ga0070680_100060235 | Ga0070680_1000602351 | 228 |
| 86 | 3300005458 | Ga0070681_10029767 | Ga0070681_100297674 | 228 |
| 87 | 3300005530 | Ga0070679_100122173 | Ga0070679_1001221732 | 228 |
| 88 | 3300006847 | Ga0075431_100022588 | Ga0075431_1000225884 | 228 |
| 89 | 3300025912 | Ga0207707_10031734 | Ga0207707_100317344 | 228 |
| 90 | 3300025917 | Ga0207660_10010300 | Ga0207660_100103003 | 228 |
| 91 | 3300042876 | Ga0451577_0153015 | Ga0451577_0153015_330_1025 | 228 |
| 92 | 3300050510 | nmdc:mga06r32_137909_c1 | nmdc:mga06r32_137909_c1_1463_2179 | 228 |
| 93 | iso_pu_bacteria | 2958512119 | 2958515966 | 228 |
| 94 | iso_pu_bacteria | 2965320100 | 2965322125 | 228 |
| 95 | 3300005347 | Ga0070668_100175537 | Ga0070668_1001755372 | 229 |
| 96 | 3300005456 | Ga0070678_100335240 | Ga0070678_1003352402 | 229 |
| 97 | 3300006844 | Ga0075428_100462108 | Ga0075428_1004621081 | 229 |
| 98 | 3300025272 | Ga0209455_1001657 | Ga0209455_10016572 | 229 |
| 99 | 3300046515 | Ga0495620_0084640 | Ga0495620_0084640_61_774 | 229 |
| 100 | 3300046525 | Ga0495663_0035203 | Ga0495663_0035203_93_806 | 229 |
| 101 | 3300049571 | Ga0501034_0035621 | Ga0501034_0035621_172_879 | 229 |
| 102 | iso_pu_bacteria | 2519899754 | 2520879710 | 229 |
| 103 | iso_pu_bacteria | 2643221600 | 2644009373 | 229 |
| 104 | iso_pu_bacteria | 2643221667 | 2644374117 | 229 |
| 105 | iso_pu_bacteria | 2643221716 | 2644643762 | 229 |
| 106 | iso_pu_bacteria | 2643221725 | 2644681652 | 229 |
| 107 | iso_pu_bacteria | 2738541279 | 2738732877 | 229 |
| 108 | iso_pu_bacteria | 2738541285 | 2738765415 | 229 |
| 109 | iso_pu_bacteria | 2738543007 | 2739214458 | 229 |
| 110 | iso_pu_bacteria | 2739367857 | 2740003034 | 229 |
| 111 | iso_pu_bacteria | 2739367858 | 2740007851 | 229 |
| 112 | iso_pu_bacteria | 2802428842 | 2802654721 | 229 |
| 113 | iso_pu_bacteria | 2816332280 | 2817413359 | 229 |
| 114 | iso_pu_bacteria | 2857613821 | 2857617227 | 229 |
| 115 | iso_pu_bacteria | 2857618242 | 2857619917 | 229 |
| 116 | iso_pu_bacteria | 2881247448 | 2881250034 | 229 |
| 117 | iso_pu_bacteria | 2881359912 | 2881360162 | 229 |
| 118 | iso_pu_bacteria | 2903895155 | 2903898838 | 229 |
| 119 | iso_pu_bacteria | 2904419702 | 2904423128 | 229 |
| 120 | iso_pu_bacteria | 2904555929 | 2904558684 | 229 |
| 121 | iso_pu_bacteria | 2919191525 | 2919194407 | 229 |
| 122 | iso_pu_bacteria | 2919509842 | 2919512838 | 229 |
| 123 | iso_pu_bacteria | 2929150217 | 2929150431 | 229 |
| 124 | iso_pu_bacteria | 2958458903 | 2958463142 | 229 |
| 125 | iso_pu_bacteria | 2977268062 | 2977271893 | 229 |
| 126 | iso_pu_bacteria | 8054307821 | 8054311604 | 229 |
| 127 | iso_pu_bacteria | 8055419101 | 8055423390 | 229 |
| 128 | iso_pu_bacteria | 8055592153 | 8055595246 | 229 |
| 129 | 3300009093 | Ga0105240_10263220 | Ga0105240_102632202 | 230 |
| 130 | 3300009551 | Ga0105238_10676786 | Ga0105238_106767862 | 230 |
| 131 | 3300013306 | Ga0163162_10001421 | Ga0163162_1000142114 | 230 |
| 132 | 3300036647 | Ga0316582_0595160 | Ga0316582_0595160_30_725 | 230 |
| 133 | iso_pu_bacteria | 2513020052 | 2513232557 | 230 |
| 134 | iso_pu_bacteria | 2919683626 | 2919684421 | 230 |
| 135 | iso_pu_bacteria | 8056440228 | 8056443337 | 230 |
| 136 | 3300005434 | Ga0070709_10277424 | Ga0070709_102774242 | 231 |
| 137 | 3300005436 | Ga0070713_100196486 | Ga0070713_1001964862 | 231 |
| 138 | 3300006871 | Ga0075434_100541753 | Ga0075434_1005417532 | 231 |
| 139 | 3300009093 | Ga0105240_10338136 | Ga0105240_103381362 | 231 |
| 140 | 3300009093 | Ga0105240_10442940 | Ga0105240_104429402 | 231 |
| 141 | 3300035083 | Ga0373926_0030749 | Ga0373926_0030749_425_1144 | 231 |
| 142 | 3300035089 | Ga0373944_0003206 | Ga0373944_0003206_462_1181 | 231 |
| 143 | 3300035170 | Ga0373943_0007974 | Ga0373943_0007974_137_856 | 231 |
| 144 | 3300035171 | Ga0373946_0004828 | Ga0373946_0004828_1712_2431 | 231 |
| 145 | 3300035695 | Ga0373927_0016628 | Ga0373927_0016628_3619_4338 | 231 |
| 146 | 3300035725 | Ga0373947_0004258 | Ga0373947_0004258_4154_4873 | 231 |
| 147 | 3300037068 | Ga0373925_0002642 | Ga0373925_0002642_10188_10907 | 231 |
| 148 | 3300046455 | Ga0495603_0011823 | Ga0495603_0011823_942_1661 | 231 |
| 149 | 3300046472 | Ga0495580_0010779 | Ga0495580_0010779_3561_4280 | 231 |
| 150 | 3300046473 | Ga0495582_0051700 | Ga0495582_0051700_1359_2078 | 231 |
| 151 | 3300046475 | Ga0495639_0000789 | Ga0495639_0000789_13482_14201 | 231 |
| 152 | 3300046517 | Ga0495630_0019994 | Ga0495630_0019994_495_1214 | 231 |
| 153 | 3300046531 | Ga0495665_0001769 | Ga0495665_0001769_3802_4521 | 231 |
| 154 | 3300046674 | Ga0495588_0021304 | Ga0495588_0021304_578_1297 | 231 |
| 155 | 3300047315 | Ga0495581_0013370 | Ga0495581_0013370_3814_4536 | 231 |
| 156 | 3300047673 | Ga0495593_0002299 | Ga0495593_0002299_7077_7796 | 231 |
| 157 | 3300048089 | Ga0495614_0002616 | Ga0495614_0002616_220_939 | 231 |
| 158 | 3300053080 | Ga0500635_0000417 | Ga0500635_0000417_10201_10947 | 231 |
| 159 | 3300002737 | JGI25162J39368_1000203 | JGI25162J39368_100020313 | 232 |
| 160 | 3300005563 | Ga0068855_100000279 | Ga0068855_10000027935 | 232 |
| 161 | 3300010375 | Ga0105239_10001867 | Ga0105239_1000186716 | 232 |
| 162 | 3300013104 | Ga0157370_10001760 | Ga0157370_1000176010 | 232 |
| 163 | 3300013297 | Ga0157378_10121436 | Ga0157378_101214362 | 232 |
| 164 | 3300013306 | Ga0163162_10078628 | Ga0163162_100786282 | 232 |
| 165 | 3300017792 | Ga0163161_10001060 | Ga0163161_100010608 | 232 |
| 166 | 3300025233 | Ga0209437_100102 | Ga0209437_10010250 | 232 |
| 167 | 3300025258 | Ga0209129_1009030 | Ga0209129_10090303 | 232 |
| 168 | 3300025921 | Ga0207652_10004808 | Ga0207652_100048082 | 232 |
| 169 | 3300025949 | Ga0207667_10000346 | Ga0207667_1000034629 | 232 |
| 170 | 3300031241 | Ga0265325_10016833 | Ga0265325_100168332 | 232 |
| 171 | 3300035398 | Ga0316574_0118220 | Ga0316574_0118220_172_870 | 232 |
| 172 | 3300036712 | Ga0316584_0530281 | Ga0316584_0530281_114_812 | 232 |
| 173 | 3300037312 | Ga0395899_0000173 | Ga0395899_0000173_24422_25123 | 232 |
| 174 | 3300037418 | Ga0395900_0344081 | Ga0395900_0344081_465_1166 | 232 |
| 175 | 3300046507 | Ga0495606_0051259 | Ga0495606_0051259_1762_2460 | 232 |
| 176 | 3300046513 | Ga0495616_0018662 | Ga0495616_0018662_2096_2794 | 232 |
| 177 | 3300046522 | Ga0495643_0002717 | Ga0495643_0002717_3824_4522 | 232 |
| 178 | 3300046660 | Ga0495625_0014342 | Ga0495625_0014342_1050_1748 | 232 |
| 179 | 3300048918 | Ga0496115_0031776 | Ga0496115_0031776_1389_2087 | 232 |
| 180 | 3300048924 | Ga0496121_0090261 | Ga0496121_0090261_1275_1973 | 232 |
| 181 | 3300048928 | Ga0496125_0000452 | Ga0496125_0000452_14321_15019 | 232 |
| 182 | 3300048929 | Ga0496126_0023580 | Ga0496126_0023580_814_1512 | 232 |
| 183 | 3300049569 | Ga0501032_0003573 | Ga0501032_0003573_9863_10594 | 232 |
| 184 | 3300053090 | Ga0500646_0002249 | Ga0500646_0002249_4221_4919 | 232 |
| 185 | 3300053096 | Ga0500641_0000275 | Ga0500641_0000275_13040_13738 | 232 |
| 186 | 3300003320 | rootH2_10015381 | rootH2_100153817 | 233 |
| 187 | 3300003578 | Ga0006562J51391_1004923 | Ga0006562J51391_10049235 | 233 |
| 188 | 3300005288 | Ga0065714_10008551 | Ga0065714_100085514 | 233 |
| 189 | 3300005288 | Ga0065714_10065896 | Ga0065714_100658963 | 233 |
| 190 | 3300005288 | Ga0065714_10096653 | Ga0065714_100966532 | 233 |
| 191 | 3300005288 | Ga0065714_10110891 | Ga0065714_101108911 | 233 |
| 192 | 3300005289 | Ga0065704_10097387 | Ga0065704_100973873 | 233 |
| 193 | 3300005289 | Ga0065704_10132256 | Ga0065704_101322562 | 233 |
| 194 | 3300005293 | Ga0065715_10008714 | Ga0065715_100087142 | 233 |
| 195 | 3300005293 | Ga0065715_10107254 | Ga0065715_101072543 | 233 |
| 196 | 3300005293 | Ga0065715_10154827 | Ga0065715_101548272 | 233 |
| 197 | 3300005293 | Ga0065715_10353311 | Ga0065715_103533112 | 233 |
| 198 | 3300005337 | Ga0070682_100599602 | Ga0070682_1005996021 | 233 |
| 199 | 3300006942 | Ga0099824_1006531 | Ga0099824_10065318 | 233 |
| 200 | 3300006946 | Ga0079104_1000091 | Ga0079104_10000916 | 233 |
| 201 | 3300006948 | Ga0099826_10055147 | Ga0099826_100551472 | 233 |
| 202 | 3300009036 | Ga0105244_10000027 | Ga0105244_100000276 | 233 |
| 203 | 3300009036 | Ga0105244_10057916 | Ga0105244_100579162 | 233 |
| 204 | 3300009092 | Ga0105250_10034406 | Ga0105250_100344062 | 233 |
| 205 | 3300013100 | Ga0157373_10000007 | Ga0157373_1000000736 | 233 |
| 206 | 3300013104 | Ga0157370_10000192 | Ga0157370_1000019224 | 233 |
| 207 | 3300013104 | Ga0157370_10001177 | Ga0157370_100011774 | 233 |
| 208 | 3300013104 | Ga0157370_10012581 | Ga0157370_100125817 | 233 |
| 209 | 3300013104 | Ga0157370_10025011 | Ga0157370_100250113 | 233 |
| 210 | 3300013105 | Ga0157369_10004306 | Ga0157369_100043066 | 233 |
| 211 | 3300015261 | Ga0182006_1003054 | Ga0182006_10030548 | 233 |
| 212 | 3300015261 | Ga0182006_1055073 | Ga0182006_10550733 | 233 |
| 213 | 3300017792 | Ga0163161_10000055 | Ga0163161_1000005552 | 233 |
| 214 | 3300017792 | Ga0163161_10491402 | Ga0163161_104914022 | 233 |
| 215 | 3300025728 | Ga0207655_1000038 | Ga0207655_10000387 | 233 |
| 216 | 3300025914 | Ga0207671_10000254 | Ga0207671_1000025449 | 233 |
| 217 | 3300027111 | Ga0209281_1000311 | Ga0209281_100031121 | 233 |
| 218 | 3300027361 | Ga0209489_112096 | Ga0209489_1120967 | 233 |
| 219 | 3300027666 | Ga0209282_1087910 | Ga0209282_10879103 | 233 |
| 220 | 3300028794 | Ga0307515_10000316 | Ga0307515_100003164 | 233 |
| 221 | 3300031548 | Ga0307408_100000824 | Ga0307408_10000082426 | 233 |
| 222 | 3300031731 | Ga0307405_10000001 | Ga0307405_10000001987 | 233 |
| 223 | 3300031824 | Ga0307413_10000039 | Ga0307413_100000396 | 233 |
| 224 | 3300031852 | Ga0307410_10000363 | Ga0307410_1000036315 | 233 |
| 225 | 3300031901 | Ga0307406_10000950 | Ga0307406_1000095010 | 233 |
| 226 | 3300031901 | Ga0307406_10072243 | Ga0307406_100722432 | 233 |
| 227 | 3300032002 | Ga0307416_100000179 | Ga0307416_1000001797 | 233 |
| 228 | 3300032004 | Ga0307414_10000011 | Ga0307414_10000011162 | 233 |
| 229 | 3300032004 | Ga0307414_10120713 | Ga0307414_101207132 | 233 |
| 230 | 3300032005 | Ga0307411_10000004 | Ga0307411_10000004192 | 233 |
| 231 | 3300032005 | Ga0307411_10132693 | Ga0307411_101326932 | 233 |
| 232 | 3300041407 | Ga0439447_000262 | Ga0439447_000262_5966_6667 | 233 |
| 233 | 3300046660 | Ga0495625_0241358 | Ga0495625_0241358_25_726 | 233 |
| 234 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_283572_284273 | 233 |
| 235 | 3300048921 | Ga0496118_0072993 | Ga0496118_0072993_517_1218 | 233 |
| 236 | 3300048924 | Ga0496121_0118226 | Ga0496121_0118226_207_908 | 233 |
| 237 | 3300048924 | Ga0496121_0119604 | Ga0496121_0119604_733_1434 | 233 |
| 238 | 3300048927 | Ga0496124_0020328 | Ga0496124_0020328_4532_5233 | 233 |
| 239 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_196121_196822 | 233 |
| 240 | 3300049539 | Ga0501323_000375 | Ga0501323_000375_2281_2982 | 233 |
| 241 | 3300049568 | Ga0501031_0004782 | Ga0501031_0004782_2991_3722 | 233 |
| 242 | 3300049569 | Ga0501032_0016210 | Ga0501032_0016210_2141_2872 | 233 |
| 243 | 3300049570 | Ga0501033_0000005 | Ga0501033_0000005_117762_118493 | 233 |
| 244 | 3300049571 | Ga0501034_0000259 | Ga0501034_0000259_66519_67250 | 233 |
| 245 | 3300049571 | Ga0501034_0255490 | Ga0501034_0255490_425_1144 | 233 |
| 246 | 3300049572 | Ga0501036_0014746 | Ga0501036_0014746_4115_4846 | 233 |
| 247 | 3300049574 | Ga0501038_0012276 | Ga0501038_0012276_6213_6944 | 233 |
| 248 | 3300049575 | Ga0501039_0023363 | Ga0501039_0023363_1488_2219 | 233 |
| 249 | 3300049586 | Ga0501070_0304069 | Ga0501070_0304069_547_1278 | 233 |
| 250 | 3300049679 | Ga0501249_001078 | Ga0501249_001078_2290_2991 | 233 |
| 251 | 3300049758 | Ga0501241_007429 | Ga0501241_007429_512_1213 | 233 |
| 252 | 3300049763 | Ga0501266_000002 | Ga0501266_000002_158032_158733 | 233 |
| 253 | 3300049766 | Ga0501269_006526 | Ga0501269_006526_694_1395 | 233 |
| 254 | 3300049776 | Ga0501280_004479 | Ga0501280_004479_851_1552 | 233 |
| 255 | 3300049822 | Ga0501035_0023485 | Ga0501035_0023485_1158_1889 | 233 |
| 256 | 3300049823 | Ga0501044_0145228 | Ga0501044_0145228_1159_1890 | 233 |
| 257 | 3300049824 | Ga0501045_0000184 | Ga0501045_0000184_20856_21587 | 233 |
| 258 | 3300053090 | Ga0500646_0015810 | Ga0500646_0015810_339_1040 | 233 |
| 259 | 3300053093 | Ga0500651_0183900 | Ga0500651_0183900_375_1076 | 233 |
| 260 | 3300053096 | Ga0500641_0000010 | Ga0500641_0000010_133439_134140 | 233 |
| 261 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_385924_386625 | 233 |
| 262 | 3300053136 | Ga0500559_0040733 | Ga0500559_0040733_471_1172 | 233 |
| 263 | 3300053726 | Ga0500584_049348 | Ga0500584_049348_636_1337 | 233 |
| 264 | iso_pu_bacteria | 2887375801 | 2887378101 | 233 |
| 265 | 3300005293 | Ga0065715_10029650 | Ga0065715_100296502 | 234 |
| 266 | 3300005563 | Ga0068855_100257001 | Ga0068855_1002570011 | 234 |
| 267 | 3300005614 | Ga0068856_100144746 | Ga0068856_1001447463 | 234 |
| 268 | 3300005614 | Ga0068856_101018314 | Ga0068856_1010183141 | 234 |
| 269 | 3300026078 | Ga0207702_10021352 | Ga0207702_100213525 | 234 |
| 270 | 3300027876 | Ga0209974_10014312 | Ga0209974_100143122 | 234 |
| 271 | 3300033180 | Ga0307510_10039095 | Ga0307510_100390952 | 234 |
| 272 | 3300041486 | Ga0451807_2107158 | Ga0451807_2107158_532_1239 | 234 |
| 273 | 3300041509 | Ga0451843_0848344 | Ga0451843_0848344_558_1265 | 234 |
| 274 | 3300044683 | Ga0466965_0188134 | Ga0466965_0188134_269_982 | 234 |
| 275 | 3300049572 | Ga0501036_0169703 | Ga0501036_0169703_1052_1759 | 234 |
| 276 | 3300049581 | Ga0501047_0193119 | Ga0501047_0193119_779_1486 | 234 |
| 277 | 3300049679 | Ga0501249_000012 | Ga0501249_000012_19261_19968 | 234 |
| 278 | 3300049822 | Ga0501035_0165986 | Ga0501035_0165986_467_1174 | 234 |
| 279 | 3300049823 | Ga0501044_0236580 | Ga0501044_0236580_1040_1747 | 234 |
| 280 | 3300053096 | Ga0500641_0001720 | Ga0500641_0001720_6845_7552 | 234 |
| 281 | 3300053118 | Ga0500594_0006680 | Ga0500594_0006680_181_888 | 234 |
| 282 | iso_pu_bacteria | 2738541278 | 2738731762 | 234 |
| 283 | 3300005327 | Ga0070658_10067944 | Ga0070658_100679441 | 235 |
| 284 | 3300005577 | Ga0068857_100300211 | Ga0068857_1003002112 | 235 |
| 285 | 3300005616 | Ga0068852_100412117 | Ga0068852_1004121171 | 235 |
| 286 | 3300009093 | Ga0105240_10000083 | Ga0105240_10000083153 | 235 |
| 287 | 3300009174 | Ga0105241_10017707 | Ga0105241_100177075 | 235 |
| 288 | 3300009545 | Ga0105237_10000198 | Ga0105237_1000019850 | 235 |
| 289 | 3300010375 | Ga0105239_10003144 | Ga0105239_1000314413 | 235 |
| 290 | 3300013306 | Ga0163162_10227865 | Ga0163162_102278653 | 235 |
| 291 | 3300025911 | Ga0207654_10002658 | Ga0207654_100026586 | 235 |
| 292 | 3300025913 | Ga0207695_10000127 | Ga0207695_10000127153 | 235 |
| 293 | 3300026142 | Ga0207698_10384700 | Ga0207698_103847002 | 235 |
| 294 | 3300005563 | Ga0068855_100034812 | Ga0068855_1000348124 | 236 |
| 295 | 3300005578 | Ga0068854_100209390 | Ga0068854_1002093902 | 236 |
| 296 | 3300005614 | Ga0068856_100000006 | Ga0068856_10000000663 | 236 |
| 297 | 3300009545 | Ga0105237_10035356 | Ga0105237_100353562 | 236 |
| 298 | 3300010375 | Ga0105239_10035070 | Ga0105239_100350704 | 236 |
| 299 | 3300017792 | Ga0163161_10007129 | Ga0163161_100071293 | 236 |
| 300 | 3300025914 | Ga0207671_10020184 | Ga0207671_100201842 | 236 |
| 301 | 3300025949 | Ga0207667_10035066 | Ga0207667_100350664 | 236 |
| 302 | 3300026078 | Ga0207702_10000023 | Ga0207702_1000002347 | 236 |
| 303 | 3300037418 | Ga0395900_0225301 | Ga0395900_0225301_771_1493 | 236 |
| 304 | 3300044712 | Ga0453684_0306036 | Ga0453684_0306036_206_943 | 236 |
| 305 | 3300044735 | Ga0466968_0162906 | Ga0466968_0162906_295_1017 | 236 |
| 306 | 3300046524 | Ga0495648_0165233 | Ga0495648_0165233_394_1113 | 236 |
| 307 | 3300049576 | Ga0501040_0376781 | Ga0501040_0376781_83_796 | 236 |
| 308 | 3300053098 | Ga0500650_0151774 | Ga0500650_0151774_325_1047 | 236 |
| 309 | 3300037471 | Ga0395905_0009042 | Ga0395905_0009042_7912_8628 | 237 |
| 310 | 3300045051 | Ga0451576_0000020 | Ga0451576_0000020_422220_422936 | 237 |
| 311 | 3300045051 | Ga0451576_0091205 | Ga0451576_0091205_452_1165 | 237 |
| 312 | 3300048928 | Ga0496125_0153492 | Ga0496125_0153492_22_735 | 237 |
| 313 | 3300005563 | Ga0068855_100002137 | Ga0068855_10000213711 | 238 |
| 314 | 3300005614 | Ga0068856_100049487 | Ga0068856_1000494872 | 238 |
| 315 | 3300006195 | Ga0075366_10030725 | Ga0075366_100307255 | 238 |
| 316 | 3300006358 | Ga0068871_100067473 | Ga0068871_1000674732 | 238 |
| 317 | 3300006880 | Ga0075429_100016041 | Ga0075429_1000160414 | 238 |
| 318 | 3300009093 | Ga0105240_10181495 | Ga0105240_101814952 | 238 |
| 319 | 3300009174 | Ga0105241_10018754 | Ga0105241_100187546 | 238 |
| 320 | 3300009545 | Ga0105237_10068325 | Ga0105237_100683254 | 238 |
| 321 | 3300010375 | Ga0105239_10013222 | Ga0105239_100132225 | 238 |
| 322 | 3300013297 | Ga0157378_10104066 | Ga0157378_101040664 | 238 |
| 323 | 3300013307 | Ga0157372_10123248 | Ga0157372_101232483 | 238 |
| 324 | 3300025911 | Ga0207654_10331039 | Ga0207654_103310391 | 238 |
| 325 | 3300025949 | Ga0207667_10011446 | Ga0207667_100114469 | 238 |
| 326 | 3300031251 | Ga0265327_10000896 | Ga0265327_1000089617 | 238 |
| 327 | 3300031548 | Ga0307408_100000561 | Ga0307408_10000056122 | 238 |
| 328 | 3300041486 | Ga0451807_1497265 | Ga0451807_1497265_275_991 | 238 |
| 329 | 3300041511 | Ga0451855_0315542 | Ga0451855_0315542_2859_3575 | 238 |
| 330 | 3300042876 | Ga0451577_0000250 | Ga0451577_0000250_45351_46067 | 238 |
| 331 | 3300042876 | Ga0451577_0299081 | Ga0451577_0299081_215_931 | 238 |
| 332 | 3300044673 | Ga0453683_0000418 | Ga0453683_0000418_3794_4510 | 238 |
| 333 | 3300044712 | Ga0453684_0000542 | Ga0453684_0000542_4628_5344 | 238 |
| 334 | 3300044712 | Ga0453684_0000771 | Ga0453684_0000771_36226_36942 | 238 |
| 335 | 3300044712 | Ga0453684_0158115 | Ga0453684_0158115_686_1402 | 238 |
| 336 | 3300044712 | Ga0453684_0213492 | Ga0453684_0213492_1207_1923 | 238 |
| 337 | 3300044712 | Ga0453684_0376823 | Ga0453684_0376823_188_904 | 238 |
| 338 | 3300045051 | Ga0451576_0000216 | Ga0451576_0000216_3829_4545 | 238 |
| 339 | 3300046460 | Ga0495638_0156087 | Ga0495638_0156087_482_1198 | 238 |
| 340 | 3300049823 | Ga0501044_0011700 | Ga0501044_0011700_121_837 | 238 |
| 341 | 3300050493 | nmdc:mga0k408_141042_c1 | nmdc:mga0k408_141042_c1_140_856 | 238 |
| 342 | 3300050508 | nmdc:mga09592_45525_c1 | nmdc:mga09592_45525_c1_146_865 | 238 |
| 343 | 3300053090 | Ga0500646_0010716 | Ga0500646_0010716_1304_2020 | 238 |
| 344 | 3300053092 | Ga0500583_0000060 | Ga0500583_0000060_51731_52447 | 238 |
| 345 | 3300053096 | Ga0500641_0079603 | Ga0500641_0079603_395_1111 | 238 |
| 346 | 3300053130 | Ga0500642_0201332 | Ga0500642_0201332_149_865 | 238 |
| 347 | 3300032002 | Ga0307416_101109809 | Ga0307416_1011098091 | 239 |
| 348 | 3300044673 | Ga0453683_0500574 | Ga0453683_0500574_49_768 | 239 |
| 349 | 3300044712 | Ga0453684_0000148 | Ga0453684_0000148_219975_220694 | 239 |
| 350 | 3300049579 | Ga0501043_0017878 | Ga0501043_0017878_2359_3081 | 239 |
| 351 | 3300009176 | Ga0105242_10195501 | Ga0105242_101955012 | 240 |
| 352 | 3300031727 | Ga0316576_10092761 | Ga0316576_100927611 | 240 |
| 353 | 3300031733 | Ga0316577_10039680 | Ga0316577_100396803 | 240 |
| 354 | 3300036712 | Ga0316584_0002834 | Ga0316584_0002834_6807_7532 | 240 |
| 355 | 3300039062 | Ga0400483_129034 | Ga0400483_129034_2886_3608 | 240 |
| 356 | 3300039062 | Ga0400483_246494 | Ga0400483_246494_14957_15679 | 240 |
| 357 | 3300039093 | Ga0400489_29524 | Ga0400489_29524_1167_1889 | 240 |
| 358 | 3300042876 | Ga0451577_0119839 | Ga0451577_0119839_125_856 | 240 |
| 359 | 3300044712 | Ga0453684_0083110 | Ga0453684_0083110_2345_3070 | 240 |
| 360 | 3300044712 | Ga0453684_0098119 | Ga0453684_0098119_2601_3332 | 240 |
| 361 | 3300047472 | Ga0495686_0000107 | Ga0495686_0000107_24854_25603 | 240 |
| 362 | 3300047472 | Ga0495686_0054572 | Ga0495686_0054572_1717_2466 | 240 |
| 363 | iso_pu_bacteria | 2738541302 | 2738855409 | 240 |
| 364 | iso_pu_bacteria | 2739367651 | 2739588169 | 240 |
| 365 | iso_pu_bacteria | 2739367656 | 2739614058 | 240 |
| 366 | iso_pu_bacteria | 2739367663 | 2739647039 | 240 |
| 367 | iso_pu_bacteria | 2818991437 | 2819546119 | 240 |
| 368 | iso_pu_bacteria | 2842722452 | 2842724024 | 240 |
| 369 | iso_pu_bacteria | 2842909656 | 2842912243 | 240 |
| 370 | iso_pu_bacteria | 2849281842 | 2849282672 | 240 |
| 371 | iso_pu_bacteria | 2857627736 | 2857629409 | 240 |
| 372 | iso_pu_bacteria | 2904445276 | 2904446406 | 240 |
| 373 | iso_pu_bacteria | 2945997725 | 2945999216 | 240 |
| 374 | iso_pu_bacteria | 2954016120 | 2954021611 | 240 |
| 375 | iso_pu_bacteria | 2898713307 | 2898713756 | 241 |
| 376 | 3300005366 | Ga0070659_100000225 | Ga0070659_1000002252 | 242 |
| 377 | 3300025919 | Ga0207657_10210208 | Ga0207657_102102082 | 242 |
| 378 | 3300025932 | Ga0207690_10001830 | Ga0207690_1000183012 | 242 |
| 379 | 3300028556 | Ga0265337_1000781 | Ga0265337_100078117 | 242 |
| 380 | 3300028558 | Ga0265326_10001730 | Ga0265326_100017307 | 242 |
| 381 | 3300028563 | Ga0265319_1000096 | Ga0265319_100009625 | 242 |
| 382 | 3300028563 | Ga0265319_1000553 | Ga0265319_100055322 | 242 |
| 383 | 3300028573 | Ga0265334_10000816 | Ga0265334_1000081613 | 242 |
| 384 | 3300028577 | Ga0265318_10006692 | Ga0265318_100066925 | 242 |
| 385 | 3300028577 | Ga0265318_10057898 | Ga0265318_100578982 | 242 |
| 386 | 3300028653 | Ga0265323_10000359 | Ga0265323_1000035923 | 242 |
| 387 | 3300028654 | Ga0265322_10000310 | Ga0265322_100003107 | 242 |
| 388 | 3300028654 | Ga0265322_10007804 | Ga0265322_100078041 | 242 |
| 389 | 3300028666 | Ga0265336_10000488 | Ga0265336_100004881 | 242 |
| 390 | 3300028800 | Ga0265338_10000493 | Ga0265338_1000049329 | 242 |
| 391 | 3300028800 | Ga0265338_10000597 | Ga0265338_1000059725 | 242 |
| 392 | 3300028800 | Ga0265338_10028183 | Ga0265338_100281834 | 242 |
| 393 | 3300028800 | Ga0265338_10058171 | Ga0265338_100581711 | 242 |
| 394 | 3300029957 | Ga0265324_10000306 | Ga0265324_1000030615 | 242 |
| 395 | 3300029957 | Ga0265324_10003218 | Ga0265324_100032186 | 242 |
| 396 | 3300031235 | Ga0265330_10000356 | Ga0265330_1000035622 | 242 |
| 397 | 3300031238 | Ga0265332_10000479 | Ga0265332_1000047920 | 242 |
| 398 | 3300031238 | Ga0265332_10014947 | Ga0265332_100149475 | 242 |
| 399 | 3300031239 | Ga0265328_10019230 | Ga0265328_100192303 | 242 |
| 400 | 3300031240 | Ga0265320_10008237 | Ga0265320_100082375 | 242 |
| 401 | 3300031240 | Ga0265320_10011764 | Ga0265320_100117641 | 242 |
| 402 | 3300031241 | Ga0265325_10011238 | Ga0265325_100112385 | 242 |
| 403 | 3300031241 | Ga0265325_10070946 | Ga0265325_100709461 | 242 |
| 404 | 3300031242 | Ga0265329_10000468 | Ga0265329_1000046820 | 242 |
| 405 | 3300031247 | Ga0265340_10019677 | Ga0265340_100196775 | 242 |
| 406 | 3300031249 | Ga0265339_10002212 | Ga0265339_1000221212 | 242 |
| 407 | 3300031249 | Ga0265339_10159354 | Ga0265339_101593541 | 242 |
| 408 | 3300031250 | Ga0265331_10001743 | Ga0265331_100017431 | 242 |
| 409 | 3300031344 | Ga0265316_10004433 | Ga0265316_100044337 | 242 |
| 410 | 3300031344 | Ga0265316_10021616 | Ga0265316_100216163 | 242 |
| 411 | 3300031344 | Ga0265316_10162854 | Ga0265316_101628542 | 242 |
| 412 | 3300031595 | Ga0265313_10001526 | Ga0265313_100015267 | 242 |
| 413 | 3300031711 | Ga0265314_10001494 | Ga0265314_1000149423 | 242 |
| 414 | 3300031712 | Ga0265342_10003626 | Ga0265342_100036264 | 242 |
| 415 | 3300031712 | Ga0265342_10071778 | Ga0265342_100717782 | 242 |
| 416 | iso_pu_bacteria | 2599185184 | 2599479450 | 242 |
| 417 | iso_pu_bacteria | 2738541284 | 2738764202 | 242 |
| 418 | iso_pu_bacteria | 2738543023 | 2739305241 | 242 |
| 419 | iso_pu_bacteria | 2775506987 | 2776611972 | 242 |
| 420 | iso_pu_bacteria | 2842903701 | 2842907995 | 242 |
| 421 | iso_pu_bacteria | 2852623160 | 2852625810 | 242 |
| 422 | iso_pu_bacteria | 2852627209 | 2852630941 | 242 |
| 423 | iso_pu_bacteria | 2884933994 | 2884935664 | 242 |
| 424 | iso_pu_bacteria | 2919186247 | 2919189268 | 242 |
| 425 | iso_pu_bacteria | 2919437846 | 2919440246 | 242 |
| 426 | iso_pu_bacteria | 2928078545 | 2928082244 | 242 |
| 427 | iso_pu_bacteria | 2928147474 | 2928149179 | 242 |
| 428 | iso_pu_bacteria | 2932082852 | 2932084961 | 242 |
| 429 | iso_pu_bacteria | 2939664404 | 2939666577 | 242 |
| 430 | iso_pu_bacteria | 2977232053 | 2977234178 | 242 |
| 431 | 3300005327 | Ga0070658_10401560 | Ga0070658_104015602 | 243 |
| 432 | 3300025250 | Ga0209026_1004025 | Ga0209026_10040253 | 243 |
| 433 | 3300025261 | Ga0209233_1018239 | Ga0209233_10182392 | 243 |
| 434 | 3300038443 | Ga0395901_0529518 | Ga0395901_0529518_168_902 | 243 |
| 435 | iso_pu_bacteria | 2738541283 | 2738756718 | 243 |
| 436 | iso_pu_bacteria | 2890737413 | 2890740210 | 243 |
| 437 | iso_pu_bacteria | 2896344016 | 2896347054 | 243 |
| 438 | iso_pu_bacteria | 2902048731 | 2902052212 | 243 |
| 439 | iso_pu_bacteria | 2904780799 | 2904783565 | 243 |
| 440 | iso_pu_bacteria | 2919177583 | 2919181427 | 243 |
| 441 | 3300001904 | JGI24736J21556_1011486 | JGI24736J21556_10114862 | 244 |
| 442 | 3300001990 | JGI24737J22298_10010511 | JGI24737J22298_100105113 | 244 |
| 443 | 3300002067 | JGI24735J21928_10003137 | JGI24735J21928_100031376 | 244 |
| 444 | 3300002773 | JGI25152J39213_1000697 | JGI25152J39213_100069710 | 244 |
| 445 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001142 | 244 |
| 446 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001653 | 244 |
| 447 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001542 | 244 |
| 448 | 3300003322 | rootL2_10110563 | rootL2_101105632 | 244 |
| 449 | 3300003781 | Ga0055536_1000004 | Ga0055536_1000004367 | 244 |
| 450 | 3300003791 | Ga0055530_10000869 | Ga0055530_100008698 | 244 |
| 451 | 3300005288 | Ga0065714_10002216 | Ga0065714_100022163 | 244 |
| 452 | 3300005288 | Ga0065714_10133993 | Ga0065714_101339932 | 244 |
| 453 | 3300005339 | Ga0070660_100293353 | Ga0070660_1002933532 | 244 |
| 454 | 3300005366 | Ga0070659_100003274 | Ga0070659_10000327411 | 244 |
| 455 | 3300005577 | Ga0068857_100105925 | Ga0068857_1001059252 | 244 |
| 456 | 3300005614 | Ga0068856_100012161 | Ga0068856_1000121615 | 244 |
| 457 | 3300009174 | Ga0105241_10602441 | Ga0105241_106024411 | 244 |
| 458 | 3300009545 | Ga0105237_10005210 | Ga0105237_1000521012 | 244 |
| 459 | 3300010375 | Ga0105239_10000115 | Ga0105239_100001156 | 244 |
| 460 | 3300013102 | Ga0157371_10000074 | Ga0157371_1000007495 | 244 |
| 461 | 3300013102 | Ga0157371_10000164 | Ga0157371_1000016448 | 244 |
| 462 | 3300013104 | Ga0157370_10001475 | Ga0157370_1000147517 | 244 |
| 463 | 3300013104 | Ga0157370_10033538 | Ga0157370_100335382 | 244 |
| 464 | 3300013104 | Ga0157370_10094687 | Ga0157370_100946872 | 244 |
| 465 | 3300013105 | Ga0157369_10000031 | Ga0157369_10000031153 | 244 |
| 466 | 3300013105 | Ga0157369_10330982 | Ga0157369_103309822 | 244 |
| 467 | 3300013306 | Ga0163162_10001734 | Ga0163162_1000173411 | 244 |
| 468 | 3300013307 | Ga0157372_10000249 | Ga0157372_1000024914 | 244 |
| 469 | 3300013307 | Ga0157372_10249421 | Ga0157372_102494212 | 244 |
| 470 | 3300013308 | Ga0157375_10327528 | Ga0157375_103275282 | 244 |
| 471 | 3300014497 | Ga0182008_10000876 | Ga0182008_100008765 | 244 |
| 472 | 3300015261 | Ga0182006_1000159 | Ga0182006_100015948 | 244 |
| 473 | 3300015261 | Ga0182006_1000697 | Ga0182006_10006975 | 244 |
| 474 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002185 | 244 |
| 475 | 3300015682 | Ga0183373_1004 | Ga0183373_1004291 | 244 |
| 476 | 3300017792 | Ga0163161_10000310 | Ga0163161_1000031017 | 244 |
| 477 | 3300025245 | Ga0207425_1000002 | Ga0207425_10000021019 | 244 |
| 478 | 3300025250 | Ga0209026_1002893 | Ga0209026_10028936 | 244 |
| 479 | 3300025258 | Ga0209129_1000002 | Ga0209129_10000021019 | 244 |
| 480 | 3300025261 | Ga0209233_1002196 | Ga0209233_10021963 | 244 |
| 481 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009189 | 244 |
| 482 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004172 | 244 |
| 483 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006172 | 244 |
| 484 | 3300025298 | Ga0209050_1000094 | Ga0209050_1000094189 | 244 |
| 485 | 3300025904 | Ga0207647_10001469 | Ga0207647_100014693 | 244 |
| 486 | 3300025904 | Ga0207647_10040765 | Ga0207647_100407651 | 244 |
| 487 | 3300025911 | Ga0207654_10369331 | Ga0207654_103693311 | 244 |
| 488 | 3300025914 | Ga0207671_10004909 | Ga0207671_100049097 | 244 |
| 489 | 3300025932 | Ga0207690_10014966 | Ga0207690_100149663 | 244 |
| 490 | 3300025949 | Ga0207667_10136813 | Ga0207667_101368134 | 244 |
| 491 | 3300026116 | Ga0207674_10107292 | Ga0207674_101072923 | 244 |
| 492 | 3300031251 | Ga0265327_10019230 | Ga0265327_100192301 | 244 |
| 493 | 3300031731 | Ga0307405_10000006 | Ga0307405_10000006320 | 244 |
| 494 | 3300031903 | Ga0307407_10000031 | Ga0307407_1000003147 | 244 |
| 495 | 3300031911 | Ga0307412_10290256 | Ga0307412_102902561 | 244 |
| 496 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002168 | 244 |
| 497 | 3300032004 | Ga0307414_10010702 | Ga0307414_100107022 | 244 |
| 498 | 3300037471 | Ga0395905_0228117 | Ga0395905_0228117_791_1537 | 244 |
| 499 | 3300038443 | Ga0395901_0892942 | Ga0395901_0892942_86_832 | 244 |
| 500 | 3300046507 | Ga0495606_0032101 | Ga0495606_0032101_2216_2950 | 244 |
| 501 | 3300046512 | Ga0495610_0000724 | Ga0495610_0000724_4255_4989 | 244 |
| 502 | 3300046512 | Ga0495610_0000784 | Ga0495610_0000784_14838_15572 | 244 |
| 503 | 3300046520 | Ga0495637_0028231 | Ga0495637_0028231_1662_2396 | 244 |
| 504 | 3300050493 | nmdc:mga0k408_88770_c1 | nmdc:mga0k408_88770_c1_1009_1758 | 244 |
| 505 | 3300003323 | rootH1_10195403 | rootH1_101954031 | 245 |
| 506 | 3300009545 | Ga0105237_10116024 | Ga0105237_101160242 | 245 |
| 507 | 3300025914 | Ga0207671_10068431 | Ga0207671_100684311 | 245 |
| 508 | 3300046462 | Ga0495651_0314471 | Ga0495651_0314471_238_987 | 245 |
| 509 | 3300046507 | Ga0495606_0055915 | Ga0495606_0055915_664_1419 | 245 |
| 510 | 3300046660 | Ga0495625_0377360 | Ga0495625_0377360_73_822 | 245 |
| 511 | 3300047472 | Ga0495686_0000673 | Ga0495686_0000673_9298_10047 | 245 |
| 512 | 2162886007 | SwRhRL2b_contig_829818 | SwRhRL2b_0309.00003380 | 246 |
| 513 | 3300001979 | JGI24740J21852_10050454 | JGI24740J21852_100504542 | 246 |
| 514 | 3300001990 | JGI24737J22298_10000321 | JGI24737J22298_1000032111 | 246 |
| 515 | 3300002067 | JGI24735J21928_10000003 | JGI24735J21928_10000003283 | 246 |
| 516 | 3300002077 | JGI24744J21845_10007987 | JGI24744J21845_100079872 | 246 |
| 517 | 3300003316 | rootH1_10152788 | rootH1_101527882 | 246 |
| 518 | 3300003320 | rootH2_10000984 | rootH2_1000098466 | 246 |
| 519 | 3300003320 | rootH2_10160370 | rootH2_101603702 | 246 |
| 520 | 3300003322 | rootL2_10065652 | rootL2_100656527 | 246 |
| 521 | 3300003323 | rootH1_10154754 | rootH1_101547542 | 246 |
| 522 | 3300003323 | rootH1_10223455 | rootH1_102234553 | 246 |
| 523 | 3300003323 | rootH1_10332970 | rootH1_103329701 | 246 |
| 524 | 3300005288 | Ga0065714_10010665 | Ga0065714_100106653 | 246 |
| 525 | 3300005288 | Ga0065714_10070770 | Ga0065714_100707702 | 246 |
| 526 | 3300005289 | Ga0065704_10070251 | Ga0065704_1007025142 | 246 |
| 527 | 3300005289 | Ga0065704_10073887 | Ga0065704_100738873 | 246 |
| 528 | 3300005327 | Ga0070658_10000041 | Ga0070658_1000004166 | 246 |
| 529 | 3300005328 | Ga0070676_10000775 | Ga0070676_100007754 | 246 |
| 530 | 3300005339 | Ga0070660_100046270 | Ga0070660_1000462702 | 246 |
| 531 | 3300005339 | Ga0070660_100353903 | Ga0070660_1003539031 | 246 |
| 532 | 3300005355 | Ga0070671_100007168 | Ga0070671_10000716810 | 246 |
| 533 | 3300005364 | Ga0070673_100002704 | Ga0070673_1000027042 | 246 |
| 534 | 3300005366 | Ga0070659_100123163 | Ga0070659_1001231632 | 246 |
| 535 | 3300005455 | Ga0070663_100043972 | Ga0070663_1000439723 | 246 |
| 536 | 3300005456 | Ga0070678_100000911 | Ga0070678_1000009114 | 246 |
| 537 | 3300005457 | Ga0070662_100000355 | Ga0070662_10000035523 | 246 |
| 538 | 3300005459 | Ga0068867_100001244 | Ga0068867_10000124413 | 246 |
| 539 | 3300005539 | Ga0068853_100100874 | Ga0068853_1001008742 | 246 |
| 540 | 3300005543 | Ga0070672_100037292 | Ga0070672_1000372923 | 246 |
| 541 | 3300005548 | Ga0070665_100000096 | Ga0070665_10000009657 | 246 |
| 542 | 3300005563 | Ga0068855_100005096 | Ga0068855_10000509614 | 246 |
| 543 | 3300005563 | Ga0068855_100053163 | Ga0068855_1000531634 | 246 |
| 544 | 3300005563 | Ga0068855_100089320 | Ga0068855_1000893202 | 246 |
| 545 | 3300005614 | Ga0068856_100019146 | Ga0068856_1000191468 | 246 |
| 546 | 3300005616 | Ga0068852_100000920 | Ga0068852_1000009208 | 246 |
| 547 | 3300006195 | Ga0075366_10000652 | Ga0075366_1000065212 | 246 |
| 548 | 3300006195 | Ga0075366_10002252 | Ga0075366_100022525 | 246 |
| 549 | 3300006237 | Ga0097621_100000330 | Ga0097621_10000033019 | 246 |
| 550 | 3300006353 | Ga0075370_10304769 | Ga0075370_103047691 | 246 |
| 551 | 3300006358 | Ga0068871_100000085 | Ga0068871_10000008538 | 246 |
| 552 | 3300006881 | Ga0068865_100000096 | Ga0068865_10000009613 | 246 |
| 553 | 3300009093 | Ga0105240_10004631 | Ga0105240_1000463110 | 246 |
| 554 | 3300009093 | Ga0105240_10072028 | Ga0105240_100720281 | 246 |
| 555 | 3300009093 | Ga0105240_10298941 | Ga0105240_102989411 | 246 |
| 556 | 3300009174 | Ga0105241_10005104 | Ga0105241_100051049 | 246 |
| 557 | 3300009174 | Ga0105241_10010239 | Ga0105241_100102394 | 246 |
| 558 | 3300009174 | Ga0105241_10079828 | Ga0105241_100798282 | 246 |
| 559 | 3300009176 | Ga0105242_10010571 | Ga0105242_100105717 | 246 |
| 560 | 3300009545 | Ga0105237_10003401 | Ga0105237_100034013 | 246 |
| 561 | 3300009545 | Ga0105237_10007709 | Ga0105237_100077092 | 246 |
| 562 | 3300009545 | Ga0105237_10200734 | Ga0105237_102007343 | 246 |
| 563 | 3300009545 | Ga0105237_10642815 | Ga0105237_106428151 | 246 |
| 564 | 3300009551 | Ga0105238_10026895 | Ga0105238_100268956 | 246 |
| 565 | 3300009551 | Ga0105238_10156656 | Ga0105238_101566563 | 246 |
| 566 | 3300010375 | Ga0105239_10044847 | Ga0105239_100448473 | 246 |
| 567 | 3300010375 | Ga0105239_10055411 | Ga0105239_100554114 | 246 |
| 568 | 3300010375 | Ga0105239_10272698 | Ga0105239_102726982 | 246 |
| 569 | 3300011119 | Ga0105246_10530160 | Ga0105246_105301602 | 246 |
| 570 | 3300013100 | Ga0157373_10000601 | Ga0157373_1000060124 | 246 |
| 571 | 3300013100 | Ga0157373_10009093 | Ga0157373_100090933 | 246 |
| 572 | 3300013100 | Ga0157373_10009649 | Ga0157373_100096492 | 246 |
| 573 | 3300013100 | Ga0157373_10225155 | Ga0157373_102251552 | 246 |
| 574 | 3300013102 | Ga0157371_10000486 | Ga0157371_1000048640 | 246 |
| 575 | 3300013102 | Ga0157371_10001622 | Ga0157371_1000162213 | 246 |
| 576 | 3300013102 | Ga0157371_10002408 | Ga0157371_100024084 | 246 |
| 577 | 3300013102 | Ga0157371_10012774 | Ga0157371_100127743 | 246 |
| 578 | 3300013102 | Ga0157371_10065206 | Ga0157371_100652063 | 246 |
| 579 | 3300013104 | Ga0157370_10008143 | Ga0157370_1000814310 | 246 |
| 580 | 3300013104 | Ga0157370_10071406 | Ga0157370_100714062 | 246 |
| 581 | 3300013104 | Ga0157370_10135508 | Ga0157370_101355083 | 246 |
| 582 | 3300013104 | Ga0157370_10183764 | Ga0157370_101837643 | 246 |
| 583 | 3300013105 | Ga0157369_10000494 | Ga0157369_100004948 | 246 |
| 584 | 3300013105 | Ga0157369_10030017 | Ga0157369_100300172 | 246 |
| 585 | 3300013105 | Ga0157369_10031116 | Ga0157369_100311164 | 246 |
| 586 | 3300013105 | Ga0157369_10056415 | Ga0157369_100564152 | 246 |
| 587 | 3300013105 | Ga0157369_10496389 | Ga0157369_104963891 | 246 |
| 588 | 3300013296 | Ga0157374_10000536 | Ga0157374_1000053617 | 246 |
| 589 | 3300013296 | Ga0157374_10000967 | Ga0157374_100009677 | 246 |
| 590 | 3300013296 | Ga0157374_10045908 | Ga0157374_100459084 | 246 |
| 591 | 3300013297 | Ga0157378_10093511 | Ga0157378_100935112 | 246 |
| 592 | 3300013297 | Ga0157378_10095349 | Ga0157378_100953493 | 246 |
| 593 | 3300013306 | Ga0163162_10000005 | Ga0163162_10000005184 | 246 |
| 594 | 3300013306 | Ga0163162_10761407 | Ga0163162_107614072 | 246 |
| 595 | 3300013307 | Ga0157372_10000042 | Ga0157372_1000004277 | 246 |
| 596 | 3300013307 | Ga0157372_10073868 | Ga0157372_100738683 | 246 |
| 597 | 3300013307 | Ga0157372_10187213 | Ga0157372_101872132 | 246 |
| 598 | 3300013307 | Ga0157372_11011737 | Ga0157372_110117371 | 246 |
| 599 | 3300013308 | Ga0157375_10041062 | Ga0157375_100410624 | 246 |
| 600 | 3300013308 | Ga0157375_10087622 | Ga0157375_100876222 | 246 |
| 601 | 3300013308 | Ga0157375_10351530 | Ga0157375_103515302 | 246 |
| 602 | 3300013308 | Ga0157375_10443929 | Ga0157375_104439292 | 246 |
| 603 | 3300014497 | Ga0182008_10000014 | Ga0182008_10000014166 | 246 |
| 604 | 3300014745 | Ga0157377_10141300 | Ga0157377_101413002 | 246 |
| 605 | 3300017792 | Ga0163161_10001258 | Ga0163161_100012584 | 246 |
| 606 | 3300025904 | Ga0207647_10000392 | Ga0207647_1000039221 | 246 |
| 607 | 3300025907 | Ga0207645_10002377 | Ga0207645_100023774 | 246 |
| 608 | 3300025909 | Ga0207705_10000068 | Ga0207705_1000006859 | 246 |
| 609 | 3300025911 | Ga0207654_10001514 | Ga0207654_100015143 | 246 |
| 610 | 3300025913 | Ga0207695_10023140 | Ga0207695_100231408 | 246 |
| 611 | 3300025913 | Ga0207695_10292833 | Ga0207695_102928332 | 246 |
| 612 | 3300025914 | Ga0207671_10002928 | Ga0207671_1000292815 | 246 |
| 613 | 3300025914 | Ga0207671_10048573 | Ga0207671_100485733 | 246 |
| 614 | 3300025914 | Ga0207671_10416765 | Ga0207671_104167651 | 246 |
| 615 | 3300025919 | Ga0207657_10063373 | Ga0207657_100633733 | 246 |
| 616 | 3300025919 | Ga0207657_10375848 | Ga0207657_103758482 | 246 |
| 617 | 3300025924 | Ga0207694_10077753 | Ga0207694_100777532 | 246 |
| 618 | 3300025931 | Ga0207644_10002294 | Ga0207644_100022948 | 246 |
| 619 | 3300025932 | Ga0207690_10050045 | Ga0207690_100500452 | 246 |
| 620 | 3300025933 | Ga0207706_10000738 | Ga0207706_1000073811 | 246 |
| 621 | 3300025934 | Ga0207686_10183943 | Ga0207686_101839432 | 246 |
| 622 | 3300025938 | Ga0207704_10000893 | Ga0207704_100008936 | 246 |
| 623 | 3300025949 | Ga0207667_10003692 | Ga0207667_100036929 | 246 |
| 624 | 3300025949 | Ga0207667_10013817 | Ga0207667_100138172 | 246 |
| 625 | 3300025949 | Ga0207667_10162511 | Ga0207667_101625112 | 246 |
| 626 | 3300025960 | Ga0207651_10031651 | Ga0207651_100316512 | 246 |
| 627 | 3300026023 | Ga0207677_10072866 | Ga0207677_100728663 | 246 |
| 628 | 3300026023 | Ga0207677_10087395 | Ga0207677_100873952 | 246 |
| 629 | 3300026041 | Ga0207639_10387559 | Ga0207639_103875592 | 246 |
| 630 | 3300026067 | Ga0207678_10051696 | Ga0207678_100516962 | 246 |
| 631 | 3300026078 | Ga0207702_10013701 | Ga0207702_100137014 | 246 |
| 632 | 3300026089 | Ga0207648_10001082 | Ga0207648_1000108226 | 246 |
| 633 | 3300026121 | Ga0207683_10002826 | Ga0207683_100028264 | 246 |
| 634 | 3300026142 | Ga0207698_10003197 | Ga0207698_100031974 | 246 |
| 635 | 3300028379 | Ga0268266_10000185 | Ga0268266_1000018552 | 246 |
| 636 | 3300028786 | Ga0307517_10000408 | Ga0307517_100004081 | 246 |
| 637 | 3300028794 | Ga0307515_10000676 | Ga0307515_100006769 | 246 |
| 638 | 3300028794 | Ga0307515_10055079 | Ga0307515_100550794 | 246 |
| 639 | 3300031730 | Ga0307516_10073865 | Ga0307516_100738652 | 246 |
| 640 | 3300031911 | Ga0307412_10000043 | Ga0307412_1000004348 | 246 |
| 641 | 3300031911 | Ga0307412_10047998 | Ga0307412_100479982 | 246 |
| 642 | 3300032004 | Ga0307414_10000713 | Ga0307414_100007132 | 246 |
| 643 | 3300032004 | Ga0307414_10003845 | Ga0307414_100038453 | 246 |
| 644 | 3300032004 | Ga0307414_10047200 | Ga0307414_100472004 | 246 |
| 645 | 3300032004 | Ga0307414_10058091 | Ga0307414_100580913 | 246 |
| 646 | 3300033180 | Ga0307510_10001986 | Ga0307510_100019869 | 246 |
| 647 | 3300037312 | Ga0395899_0000177 | Ga0395899_0000177_6398_7150 | 246 |
| 648 | 3300037312 | Ga0395899_0000238 | Ga0395899_0000238_2298_3050 | 246 |
| 649 | 3300037312 | Ga0395899_0006897 | Ga0395899_0006897_2848_3600 | 246 |
| 650 | 3300037312 | Ga0395899_0010845 | Ga0395899_0010845_3381_4133 | 246 |
| 651 | 3300037418 | Ga0395900_0000139 | Ga0395900_0000139_12877_13629 | 246 |
| 652 | 3300037418 | Ga0395900_0001986 | Ga0395900_0001986_20057_20809 | 246 |
| 653 | 3300037418 | Ga0395900_0114314 | Ga0395900_0114314_845_1597 | 246 |
| 654 | 3300037418 | Ga0395900_0164466 | Ga0395900_0164466_1223_1975 | 246 |
| 655 | 3300037466 | Ga0395898_0152481 | Ga0395898_0152481_297_1049 | 246 |
| 656 | 3300037471 | Ga0395905_0000169 | Ga0395905_0000169_5314_6066 | 246 |
| 657 | 3300037471 | Ga0395905_0013551 | Ga0395905_0013551_2286_3038 | 246 |
| 658 | 3300038443 | Ga0395901_0000838 | Ga0395901_0000838_8666_9418 | 246 |
| 659 | 3300038443 | Ga0395901_0105660 | Ga0395901_0105660_1881_2633 | 246 |
| 660 | 3300038443 | Ga0395901_0216416 | Ga0395901_0216416_297_1049 | 246 |
| 661 | 3300039447 | Ga0436361_0616042 | Ga0436361_0616042_5503_6255 | 246 |
| 662 | 3300042005 | Ga0439448_0006422 | Ga0439448_0006422_1319_2071 | 246 |
| 663 | 3300044684 | Ga0466966_0011391 | Ga0466966_0011391_4839_5591 | 246 |
| 664 | 3300044693 | Ga0466961_0023410 | Ga0466961_0023410_1449_2201 | 246 |
| 665 | 3300045049 | Ga0466959_0057164 | Ga0466959_0057164_1569_2321 | 246 |
| 666 | 3300046471 | Ga0495650_0000107 | Ga0495650_0000107_196637_197386 | 246 |
| 667 | 3300046471 | Ga0495650_0011966 | Ga0495650_0011966_2043_2792 | 246 |
| 668 | 3300046492 | Ga0495585_0000116 | Ga0495585_0000116_23045_23794 | 246 |
| 669 | 3300046507 | Ga0495606_0002103 | Ga0495606_0002103_14209_14958 | 246 |
| 670 | 3300046507 | Ga0495606_0012971 | Ga0495606_0012971_1255_2004 | 246 |
| 671 | 3300046512 | Ga0495610_0056619 | Ga0495610_0056619_786_1535 | 246 |
| 672 | 3300046513 | Ga0495616_0000882 | Ga0495616_0000882_6885_7634 | 246 |
| 673 | 3300046513 | Ga0495616_0006658 | Ga0495616_0006658_248_997 | 246 |
| 674 | 3300046529 | Ga0495652_0187976 | Ga0495652_0187976_559_1308 | 246 |
| 675 | 3300046529 | Ga0495652_0359872 | Ga0495652_0359872_241_990 | 246 |
| 676 | 3300046538 | Ga0495609_0028800 | Ga0495609_0028800_538_1287 | 246 |
| 677 | 3300046558 | Ga0495633_0006149 | Ga0495633_0006149_5331_6080 | 246 |
| 678 | 3300046616 | Ga0495668_0119227 | Ga0495668_0119227_150_899 | 246 |
| 679 | 3300046660 | Ga0495625_0000021 | Ga0495625_0000021_31034_31783 | 246 |
| 680 | 3300046660 | Ga0495625_0000344 | Ga0495625_0000344_34007_34756 | 246 |
| 681 | 3300046660 | Ga0495625_0014051 | Ga0495625_0014051_2691_3440 | 246 |
| 682 | 3300046660 | Ga0495625_0052836 | Ga0495625_0052836_1165_1914 | 246 |
| 683 | 3300046660 | Ga0495625_0077428 | Ga0495625_0077428_1247_1996 | 246 |
| 684 | 3300046665 | Ga0495661_0003287 | Ga0495661_0003287_10824_11573 | 246 |
| 685 | 3300046665 | Ga0495661_0011479 | Ga0495661_0011479_2736_3485 | 246 |
| 686 | 3300046692 | Ga0495671_0035629 | Ga0495671_0035629_996_1745 | 246 |
| 687 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_427744_428493 | 246 |
| 688 | 3300047323 | Ga0495683_0173691 | Ga0495683_0173691_142_891 | 246 |
| 689 | 3300047443 | Ga0495687_000356 | Ga0495687_000356_35465_36214 | 246 |
| 690 | 3300047443 | Ga0495687_002785 | Ga0495687_002785_4614_5366 | 246 |
| 691 | 3300047469 | Ga0495673_0009304 | Ga0495673_0009304_2750_3499 | 246 |
| 692 | 3300047472 | Ga0495686_0087020 | Ga0495686_0087020_211_960 | 246 |
| 693 | 3300049758 | Ga0501241_013856 | Ga0501241_013856_498_1238 | 246 |
| 694 | 3300049776 | Ga0501280_001973 | Ga0501280_001973_1353_2093 | 246 |
| 695 | 3300050493 | nmdc:mga0k408_534_c1 | nmdc:mga0k408_534_c1_17305_18054 | 246 |
| 696 | 3300050496 | nmdc:mga07m45_99320_c1 | nmdc:mga07m45_99320_c1_87_836 | 246 |
| 697 | 3300053091 | Ga0500647_0076489 | Ga0500647_0076489_345_1094 | 246 |
| 698 | 3300053093 | Ga0500651_0001777 | Ga0500651_0001777_5897_6637 | 246 |
| 699 | 3300053125 | Ga0500618_000016 | Ga0500618_000016_70698_71447 | 246 |
| 700 | 3300053157 | Ga0500624_000265 | Ga0500624_000265_10135_10884 | 246 |
| 701 | 3300005289 | Ga0065704_10226425 | Ga0065704_102264252 | 247 |
| 702 | 3300009176 | Ga0105242_10703381 | Ga0105242_107033812 | 247 |
| 703 | 3300009545 | Ga0105237_10006711 | Ga0105237_100067118 | 247 |
| 704 | 3300013104 | Ga0157370_10000303 | Ga0157370_1000030340 | 247 |
| 705 | 3300013307 | Ga0157372_10006765 | Ga0157372_1000676510 | 247 |
| 706 | 3300014497 | Ga0182008_10000632 | Ga0182008_1000063221 | 247 |
| 707 | 3300014497 | Ga0182008_10010960 | Ga0182008_100109604 | 247 |
| 708 | 3300014497 | Ga0182008_10034731 | Ga0182008_100347312 | 247 |
| 709 | 3300015261 | Ga0182006_1001331 | Ga0182006_10013315 | 247 |
| 710 | 3300015262 | Ga0182007_10007341 | Ga0182007_100073411 | 247 |
| 711 | 3300015262 | Ga0182007_10007397 | Ga0182007_100073972 | 247 |
| 712 | 3300015262 | Ga0182007_10029643 | Ga0182007_100296432 | 247 |
| 713 | 3300017792 | Ga0163161_10000406 | Ga0163161_100004065 | 247 |
| 714 | 3300025914 | Ga0207671_10009249 | Ga0207671_100092498 | 247 |
| 715 | 3300030742 | Ga0316183_1171692 | Ga0316183_11716929 | 247 |
| 716 | 3300030744 | Ga0316181_1145183 | Ga0316181_11451832 | 247 |
| 717 | 3300031548 | Ga0307408_100000566 | Ga0307408_10000056613 | 247 |
| 718 | 3300031548 | Ga0307408_100000736 | Ga0307408_10000073617 | 247 |
| 719 | 3300031548 | Ga0307408_100004742 | Ga0307408_1000047424 | 247 |
| 720 | 3300031824 | Ga0307413_10413148 | Ga0307413_104131481 | 247 |
| 721 | 3300031911 | Ga0307412_10002048 | Ga0307412_100020486 | 247 |
| 722 | 3300032004 | Ga0307414_10052340 | Ga0307414_100523402 | 247 |
| 723 | 3300032004 | Ga0307414_10098436 | Ga0307414_100984361 | 247 |
| 724 | 3300032004 | Ga0307414_10326961 | Ga0307414_103269612 | 247 |
| 725 | 3300048920 | Ga0496117_0005463 | Ga0496117_0005463_3024_3767 | 247 |
| 726 | 3300048921 | Ga0496118_0029437 | Ga0496118_0029437_1613_2356 | 247 |
| 727 | 3300048925 | Ga0496122_0005019 | Ga0496122_0005019_15112_15855 | 247 |
| 728 | 3300048926 | Ga0496123_0006462 | Ga0496123_0006462_8087_8830 | 247 |
| 729 | 3300048926 | Ga0496123_0010972 | Ga0496123_0010972_2362_3105 | 247 |
| 730 | 3300048927 | Ga0496124_0053507 | Ga0496124_0053507_144_887 | 247 |
| 731 | 3300009174 | Ga0105241_10177369 | Ga0105241_101773692 | 252 |
| 732 | 3300005288 | Ga0065714_10015338 | Ga0065714_100153381 | 253 |
| 733 | 3300031595 | Ga0265313_10071979 | Ga0265313_100719792 | 255 |
| 734 | 3300017792 | Ga0163161_10001090 | Ga0163161_1000109015 | 261 |
| 735 | 3300046558 | Ga0495633_0101684 | Ga0495633_0101684_137_961 | 261 |
| 736 | iso_pu_bacteria | 2585427687 | 2586210870 | 261 |
| 737 | 3300033179 | Ga0307507_10000099 | Ga0307507_1000009920 | 266 |
| 738 | 2162886007 | SwRhRL2b_contig_488003 | SwRhRL2b_0217.00005910 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vm6-assembly1.cif.gz_C | crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution | 0.8671 | 22 | 264 |
| 5us6-assembly1.cif.gz_D | structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag | 0.8559 | 22 | 267 |
| 1vm6-assembly1.cif.gz_C | crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution | 0.8522 | 22 | 264 |
| 5us6-assembly2.cif.gz_H | structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag | 0.8503 | 22 | 268 |
| 5wol-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii | 0.8496 | 22 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vm6D02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8871 | 126 | 234 | 3.30.360.10 |
| af_P9WP23_2_120_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8762 | 23 | 138 | 3.50.50.60 |
| 1vm6D02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.8675 | 126 | 234 | 3.30.360.10 |
| 1yl7C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8653 | 23 | 124 | 3.40.50.720 |
| af_Q57865_2_266_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8628 | 22 | 262 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M1N564-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) | 0.9984 | 22 | 266 |
GO:0005829
GO:0008839 GO:0009089 GO:0016726 GO:0019877 GO:0050661 GO:0051287 |
| AF-A0A6M1N564-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) | 0.9943 | 22 | 266 |
GO:0005829
GO:0008839 GO:0009089 GO:0016726 GO:0019877 GO:0050661 GO:0051287 |
| AF-A0A4R1LUY1-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) | 0.994 | 22 | 267 |
GO:0005829
GO:0008839 GO:0009089 GO:0016726 GO:0019877 GO:0050661 GO:0051287 |
| AF-A0A1T4ZYL8-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) | 0.9939 | 22 | 268 |
GO:0005829
GO:0008839 GO:0009089 GO:0016726 GO:0019877 GO:0050661 GO:0051287 |
| AF-A0A4U9JA54-F1-model_v4 | deleted | 0.9921 | 22 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar