F478396

General Info

Members Datasets Scaffolds Average Seq Length
738 388 670 240

Family's Representative Sequence

Representative Sequence 3300033179|Ga0307507_10000099|Ga0307507_1000009920
Length 278
Sequence LQNSLLLFSVLIPDSNILILDFNSTHTLKMKIALLGYGKMGKMIEKIALSRNHEIVLTIDQDNLHELTAQNLQKADAVIEFSMPATVLGNIQHCFNAGVPIVVGTTGWYDKLDEVKQQCEESNASLMYATNFSVGVNIFFHINRMLARVMNNYPYYDVQVEEIHHMQKLDAPSGTAITIAEGIIDNLDSKKDWLNVLTTDDRADNQNPLPDQLLIESLRIDSVPGTHTVIYDSEVDTIEFKHTAHNRSGFALGAVLAAEWIQGKKGFYTVDAMFDFKS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
6 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
7 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
8 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
9 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
10 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
11 2738541278 Niastella sp. CF465 Isolate Unclassified
12 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
13 2738541283 Pedobacter sp. OK701 Isolate Unclassified
14 2738541284 Pedobacter sp. YR016 Isolate Unclassified
15 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
16 2738541302 Pedobacter sp. CF074 Isolate Unclassified
17 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
18 2738543023 Pedobacter sp. OK628 Isolate Unclassified
19 2739367651 Pedobacter sp. OK291 Isolate Unclassified
20 2739367656 Pedobacter sp. CF523 Isolate Unclassified
21 2739367663 Pedobacter sp. YR510 Isolate Unclassified
22 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
23 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
24 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
25 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
26 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
27 2818991437 Pedobacter terrae 518 Isolate Unclassified
28 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
29 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
30 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
31 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
32 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
33 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
34 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
35 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
36 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
37 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
38 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
39 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
40 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
41 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
42 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
43 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
44 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
45 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
46 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
47 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
48 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
49 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
50 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
51 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
52 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
53 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
54 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
55 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
56 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
57 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
58 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
59 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
60 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
61 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
62 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
63 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
64 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
65 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
66 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
67 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
68 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
69 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
70 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
71 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
72 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
73 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
74 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
79 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
80 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
81 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
82 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
83 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
84 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
85 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
86 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
87 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
92 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
93 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
94 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
97 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
98 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
99 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
100 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
101 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
102 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
106 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
113 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
114 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
115 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
120 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
124 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
125 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
128 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
129 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
137 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
138 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
139 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
140 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
141 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
142 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
143 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
150 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
169 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
170 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
171 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
210 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
218 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
219 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
220 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
221 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
222 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
223 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
224 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
227 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
228 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
229 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
232 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
233 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
234 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
235 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
236 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
237 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
238 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
239 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
245 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
250 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
251 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
252 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
253 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
254 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
255 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
256 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
266 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
269 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
274 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
278 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
279 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
280 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
281 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
282 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
283 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
284 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
285 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
286 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
287 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
288 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
313 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
327 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
356 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
357 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
358 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
359 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
368 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
371 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
372 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
373 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
377 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
378 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
383 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
384 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
385 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
386 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
387 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
388 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.11
Metatranscriptomes 0.54
Isolates 9.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.99
Nodule 0.81
Rhizoplane 0.54
Rhizosphere 79.67
Stem 0
Stem Tuber 0
Unclassified 10.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_488003 2162886007 Bacteria 4900
2 SwRhRL2b_contig_829818 2162886007 Bacteria 4778
3 2214746907 2209111006 Bacteria 916
4 JGI24736J21556_1011486 3300001904 Bacteria 1441
5 JGI24740J21852_10050454 3300001979 Bacteria 1197
6 JGI24737J22298_10000321 3300001990 Bacteria 16053
7 JGI24737J22298_10010511 3300001990 Bacteria 3054
8 JGI24735J21928_10000003 3300002067 Bacteria 385983
9 JGI24735J21928_10003137 3300002067 Bacteria 5663
10 JGI24744J21845_10007987 3300002077 Bacteria 2184
11 JGI25162J39368_1000203 3300002737 Bacteria 62704
12 JGI25164J39214_1001360 3300002772 Bacteria 5927
13 JGI25152J39213_1000697 3300002773 Bacteria 17459
14 JGI25150J39212_1000001 3300002774 Bacteria 1318726
15 JGI25151J46595_10000001 3300003187 Bacteria 887211
16 JGI25165J46597_1000728 3300003214 Bacteria 25784
17 JGI25153J46596_10000001 3300003215 Bacteria 748985
18 rootH1_10152788 3300003316 Bacteria 1338
19 rootH2_10000984 3300003320 Bacteria 89440
20 rootH2_10015381 3300003320 Bacteria 19009
21 rootH2_10160370 3300003320 Bacteria 1383
22 rootH2_10228453 3300003320 Bacteria 1574
23 rootL2_10065652 3300003322 Bacteria 7156
24 rootL2_10110563 3300003322 Bacteria 2024
25 rootH1_10098029 3300003323 Bacteria 1285
26 rootH1_10154754 3300003316 Bacteria 1344
27 rootH1_10154754 3300003323 Bacteria 1743
28 rootH1_10195403 3300003323 Bacteria 1877
29 rootH1_10223455 3300003323 Bacteria 4540
30 rootH1_10332970 3300003323 Bacteria 1488
31 Ga0006562J51391_1004923 3300003578 Bacteria 5120
32 Ga0055536_1000004 3300003781 Bacteria 411108
33 Ga0055530_10000869 3300003791 Bacteria 24868
34 Ga0058863_11752149 3300004799 Bacteria 893
35 Ga0058862_12181088 3300004803 Bacteria 1002
36 Ga0065714_10002216 3300005288 Bacteria 50392
37 Ga0065714_10008551 3300005288 Bacteria 3953
38 Ga0065714_10010665 3300005288 Bacteria 3861
39 Ga0065714_10015338 3300005288 Bacteria 1840
40 Ga0065714_10065896 3300005288 Bacteria 8166
41 Ga0065714_10070770 3300005288 Bacteria 3762
42 Ga0065714_10096653 3300005288 Bacteria 1755
43 Ga0065714_10110891 3300005288 Bacteria 1476
44 Ga0065714_10133993 3300005288 Bacteria 1225
45 Ga0065704_10070251 3300005289 Bacteria 48366
46 Ga0065704_10073887 3300005289 Bacteria 6700
47 Ga0065704_10097387 3300005289 Bacteria 2397
48 Ga0065704_10132256 3300005289 Bacteria 1614
49 Ga0065704_10226425 3300005289 Bacteria 1057
50 Ga0065715_10008714 3300005293 Bacteria 3341
51 Ga0065715_10029650 3300005293 Bacteria 1457
52 Ga0065715_10107254 3300005293 Bacteria 2781
53 Ga0065715_10154827 3300005293 Bacteria 1689
54 Ga0065715_10353311 3300005293 Bacteria 947
55 Ga0070658_10000041 3300005327 Bacteria 134208
56 Ga0070658_10067944 3300005327 Bacteria 2913
57 Ga0070658_10401560 3300005327 Bacteria 1177
58 Ga0070676_10000775 3300005328 Bacteria 15746
59 Ga0070683_100018067 3300005329 Bacteria 6239
60 Ga0070680_100060235 3300005336 Bacteria 3107
61 Ga0070680_100143031 3300005336 Bacteria 2006
62 Ga0070682_100599602 3300005337 Bacteria 869
63 Ga0068868_100274731 3300005338 Bacteria 1424
64 Ga0070660_100046270 3300005339 Bacteria 3334
65 Ga0070660_100293353 3300005339 Bacteria 1332
66 Ga0070660_100353903 3300005339 Bacteria 1210
67 Ga0070692_10392937 3300005345 Bacteria 873
68 Ga0070668_100175537 3300005347 Unclassified 1747
69 Ga0070669_100007276 3300005353 Bacteria 7942
70 Ga0070671_100007168 3300005355 Bacteria 8913
71 Ga0070673_100002704 3300005364 Bacteria 10867
72 Ga0070659_100000225 3300005366 Bacteria 43770
73 Ga0070659_100003274 3300005366 Bacteria 11522
74 Ga0070659_100123163 3300005366 Bacteria 2102
75 Ga0070709_10277424 3300005434 Bacteria 1217
76 Ga0070713_100196486 3300005436 Bacteria 1820
77 Ga0070663_100043972 3300005455 Bacteria 3146
78 Ga0070678_100000911 3300005456 Bacteria 15188
79 Ga0070678_100335240 3300005456 Bacteria 1296
80 Ga0070662_100000355 3300005457 Bacteria 27474
81 Ga0070681_10029767 3300005458 Bacteria 5482
82 Ga0070681_10233580 3300005458 Bacteria 1753
83 Ga0068867_100001244 3300005459 Bacteria 17537
84 Ga0070706_100039678 3300005467 Archaea 4346
85 Ga0070707_100333753 3300005468 Bacteria 1473
86 Ga0070698_100022109 3300005471 Bacteria 6658
87 Ga0070698_100775467 3300005471 Unclassified 902
88 Ga0070679_100122173 3300005530 Bacteria 2589
89 Ga0070684_100080813 3300005535 Bacteria 2876
90 Ga0068853_100100874 3300005539 Bacteria 2552
91 Ga0070672_100037292 3300005543 Bacteria 3708
92 Ga0070696_100000897 3300005546 Bacteria 19309
93 Ga0070693_100131269 3300005547 Bacteria 1566
94 Ga0070665_100000096 3300005548 Bacteria 166864
95 Ga0068855_100000279 3300005563 Bacteria 63112
96 Ga0068855_100002137 3300005563 Bacteria 24454
97 Ga0068855_100005096 3300005563 Bacteria 16013
98 Ga0068855_100034812 3300005563 Bacteria 6002
99 Ga0068855_100053163 3300005563 Bacteria 4766
100 Ga0068855_100089320 3300005563 Bacteria 3558
101 Ga0068855_100257001 3300005563 Bacteria 1947
102 Ga0068857_100105925 3300005577 Bacteria 2525
103 Ga0068857_100300211 3300005577 Unclassified 1480
104 Ga0068857_100390008 3300005577 Bacteria 1294
105 Ga0068854_100209390 3300005578 Bacteria 1537
106 Ga0068856_100000006 3300005614 Bacteria 223827
107 Ga0068856_100012161 3300005614 Bacteria 8339
108 Ga0068856_100014566 3300005614 Bacteria 7598
109 Ga0068856_100019146 3300005614 Bacteria 6645
110 Ga0068856_100023803 3300005614 Bacteria 5956
111 Ga0068856_100049487 3300005614 Bacteria 4142
112 Ga0068856_100144746 3300005614 Unclassified 2384
113 Ga0068856_100695945 3300005614 Unclassified 1037
114 Ga0068856_101018314 3300005614 Bacteria 846
115 Ga0068852_100000920 3300005616 Bacteria 19482
116 Ga0068852_100412117 3300005616 Unclassified 1331
117 Ga0068852_101034905 3300005616 Bacteria 840
118 Ga0081539_10000261 3300005985 Bacteria 121256
119 Ga0075364_10001344 3300006051 Bacteria 13266
120 Ga0075362_10000037 3300006177 Bacteria 48807
121 Ga0075366_10000652 3300006195 Bacteria 16353
122 Ga0075366_10002252 3300006195 Bacteria 9861
123 Ga0075366_10030725 3300006195 Bacteria 3159
124 Ga0075366_10164955 3300006195 Bacteria 1343
125 Ga0097621_100000330 3300006237 Bacteria 32160
126 Ga0075370_10304769 3300006353 Bacteria 948
127 Ga0068871_100000085 3300006358 Bacteria 53374
128 Ga0068871_100067473 3300006358 Bacteria 2935
129 Ga0075428_100462108 3300006844 Unclassified 1359
130 Ga0075431_100022588 3300006847 Bacteria 6431
131 Ga0075434_100541753 3300006871 Bacteria 1184
132 Ga0075429_100016041 3300006880 Bacteria 6489
133 Ga0068865_100000096 3300006881 Bacteria 46186
134 Ga0099824_1006531 3300006942 Bacteria 15947
135 Ga0079104_1000091 3300006946 Bacteria 132682
136 Ga0099826_10055147 3300006948 Bacteria 2634
137 Ga0105244_10000027 3300009036 Bacteria 207569
138 Ga0105244_10057916 3300009036 Bacteria 1957
139 Ga0105250_10034406 3300009092 Bacteria 2033
140 Ga0105240_10000083 3300009093 Bacteria 192934
141 Ga0105240_10004631 3300009093 Bacteria 20858
142 Ga0105240_10072028 3300009093 Bacteria 4272
143 Ga0105240_10181495 3300009093 Unclassified 2483
144 Ga0105240_10187161 3300009093 Bacteria 2437
145 Ga0105240_10263220 3300009093 Unclassified 1988
146 Ga0105240_10298941 3300009093 Bacteria 1842
147 Ga0105240_10338136 3300009093 Bacteria 1711
148 Ga0105240_10442940 3300009093 Bacteria 1455
149 Ga0105241_10005104 3300009174 Bacteria 9685
150 Ga0105241_10010239 3300009174 Bacteria 6887
151 Ga0105241_10017707 3300009174 Bacteria 5238
152 Ga0105241_10018754 3300009174 Bacteria 5097
153 Ga0105241_10043373 3300009174 Bacteria 3407
154 Ga0105241_10079828 3300009174 Bacteria 2559
155 Ga0105241_10177369 3300009174 Bacteria 1765
156 Ga0105241_10602441 3300009174 Bacteria 993
157 Ga0105242_10010571 3300009176 Bacteria 7088
158 Ga0105242_10195501 3300009176 Bacteria 1793
159 Ga0105242_10703381 3300009176 Unclassified 989
160 Ga0105237_10000198 3300009545 Bacteria 85302
161 Ga0105237_10003401 3300009545 Bacteria 18925
162 Ga0105237_10005210 3300009545 Bacteria 14705
163 Ga0105237_10006711 3300009545 Bacteria 12720
164 Ga0105237_10007709 3300009545 Bacteria 11759
165 Ga0105237_10028356 3300009545 Bacteria 5703
166 Ga0105237_10035356 3300009545 Bacteria 5056
167 Ga0105237_10068325 3300009545 Bacteria 3547
168 Ga0105237_10116024 3300009545 Bacteria 2671
169 Ga0105237_10200734 3300009545 Bacteria 1994
170 Ga0105237_10642815 3300009545 Bacteria 1068
171 Ga0105238_10026895 3300009551 Bacteria 5863
172 Ga0105238_10156656 3300009551 Bacteria 2253
173 Ga0105238_10676786 3300009551 Bacteria 1043
174 Ga0105239_10000011 3300010375 Bacteria 337500
175 Ga0105239_10000115 3300010375 Bacteria 113217
176 Ga0105239_10001867 3300010375 Bacteria 27574
177 Ga0105239_10002632 3300010375 Bacteria 22682
178 Ga0105239_10003144 3300010375 Bacteria 20493
179 Ga0105239_10013222 3300010375 Bacteria 9172
180 Ga0105239_10035070 3300010375 Bacteria 5510
181 Ga0105239_10044847 3300010375 Bacteria 4846
182 Ga0105239_10055411 3300010375 Bacteria 4348
183 Ga0105239_10272698 3300010375 Bacteria 1903
184 Ga0105246_10530160 3300011119 Bacteria 1005
185 Ga0157373_10000007 3300013100 Bacteria 216734
186 Ga0157373_10000050 3300013100 Bacteria 106011
187 Ga0157373_10000601 3300013100 Bacteria 27966
188 Ga0157373_10009093 3300013100 Bacteria 7350
189 Ga0157373_10009649 3300013100 Bacteria 7124
190 Ga0157373_10225155 3300013100 Bacteria 1324
191 Ga0157371_10000074 3300013102 Bacteria 162988
192 Ga0157371_10000164 3300013102 Bacteria 96408
193 Ga0157371_10000486 3300013102 Bacteria 48340
194 Ga0157371_10001622 3300013102 Bacteria 23008
195 Ga0157371_10002408 3300013102 Bacteria 17899
196 Ga0157371_10012774 3300013102 Bacteria 6402
197 Ga0157371_10065206 3300013102 Bacteria 2579
198 Ga0157371_10132533 3300013102 Bacteria 1774
199 Ga0157370_10000192 3300013104 Bacteria 76389
200 Ga0157370_10000303 3300013104 Bacteria 61868
201 Ga0157370_10001177 3300013104 Bacteria 32660
202 Ga0157370_10001475 3300013104 Bacteria 29107
203 Ga0157370_10001760 3300013104 Bacteria 26710
204 Ga0157370_10008143 3300013104 Bacteria 11342
205 Ga0157370_10012581 3300013104 Bacteria 8770
206 Ga0157370_10025011 3300013104 Bacteria 5909
207 Ga0157370_10033538 3300013104 Bacteria 5006
208 Ga0157370_10071406 3300013104 Bacteria 3275
209 Ga0157370_10094687 3300013104 Bacteria 2802
210 Ga0157370_10135508 3300013104 Bacteria 2295
211 Ga0157370_10183764 3300013104 Bacteria 1942
212 Ga0157369_10000031 3300013105 Bacteria 203214
213 Ga0157369_10000494 3300013105 Bacteria 52196
214 Ga0157369_10004306 3300013105 Bacteria 16809
215 Ga0157369_10030017 3300013105 Bacteria 5999
216 Ga0157369_10031116 3300013105 Bacteria 5880
217 Ga0157369_10056415 3300013105 Bacteria 4239
218 Ga0157369_10169603 3300013105 Bacteria 2300
219 Ga0157369_10330982 3300013105 Bacteria 1583
220 Ga0157369_10496389 3300013105 Bacteria 1263
221 Ga0157374_10000536 3300013296 Bacteria 34007
222 Ga0157374_10000967 3300013296 Bacteria 24929
223 Ga0157374_10045908 3300013296 Bacteria 4044
224 Ga0157374_10085876 3300013296 Bacteria 2993
225 Ga0157378_10093511 3300013297 Bacteria 2737
226 Ga0157378_10095349 3300013297 Bacteria 2710
227 Ga0157378_10104066 3300013297 Bacteria 2595
228 Ga0157378_10121436 3300013297 Bacteria 2409
229 Ga0163162_10000005 3300013306 Bacteria 447195
230 Ga0163162_10001421 3300013306 Bacteria 22260
231 Ga0163162_10001734 3300013306 Bacteria 20435
232 Ga0163162_10078628 3300013306 Bacteria 3364
233 Ga0163162_10227865 3300013306 Bacteria 1994
234 Ga0163162_10761407 3300013306 Bacteria 1087
235 Ga0157372_10000042 3300013307 Bacteria 157651
236 Ga0157372_10000249 3300013307 Bacteria 59656
237 Ga0157372_10002322 3300013307 Bacteria 20604
238 Ga0157372_10006765 3300013307 Bacteria 12189
239 Ga0157372_10037629 3300013307 Bacteria 5339
240 Ga0157372_10059286 3300013307 Bacteria 4281
241 Ga0157372_10073868 3300013307 Bacteria 3844
242 Ga0157372_10123248 3300013307 Bacteria 2979
243 Ga0157372_10187213 3300013307 Bacteria 2397
244 Ga0157372_10249421 3300013307 Bacteria 2060
245 Ga0157372_10453972 3300013307 Bacteria 1494
246 Ga0157372_11011737 3300013307 Bacteria 962
247 Ga0157375_10041062 3300013308 Bacteria 4465
248 Ga0157375_10087622 3300013308 Bacteria 3166
249 Ga0157375_10327528 3300013308 Bacteria 1697
250 Ga0157375_10351530 3300013308 Bacteria 1640
251 Ga0157375_10443929 3300013308 Bacteria 1463
252 Ga0182008_10000014 3300014497 Bacteria 263844
253 Ga0182008_10000632 3300014497 Bacteria 25744
254 Ga0182008_10000876 3300014497 Bacteria 20916
255 Ga0182008_10010960 3300014497 Bacteria 4834
256 Ga0182008_10034731 3300014497 Bacteria 2528
257 Ga0157377_10141300 3300014745 Bacteria 1480
258 Ga0182006_1000159 3300015261 Bacteria 72265
259 Ga0182006_1000697 3300015261 Bacteria 23266
260 Ga0182006_1001331 3300015261 Bacteria 15112
261 Ga0182006_1003054 3300015261 Bacteria 8781
262 Ga0182006_1005766 3300015261 Bacteria 5843
263 Ga0182006_1055073 3300015261 Bacteria 1519
264 Ga0182007_10000002 3300015262 Bacteria 564661
265 Ga0182007_10007341 3300015262 Bacteria 4628
266 Ga0182007_10007397 3300015262 Bacteria 4608
267 Ga0182007_10029643 3300015262 Bacteria 1873
268 Ga0183373_1004 3300015682 Bacteria 537398
269 Ga0163161_10000055 3300017792 Bacteria 114949
270 Ga0163161_10000310 3300017792 Bacteria 42437
271 Ga0163161_10000406 3300017792 Bacteria 36130
272 Ga0163161_10001060 3300017792 Bacteria 20831
273 Ga0163161_10001090 3300017792 Bacteria 20550
274 Ga0163161_10001258 3300017792 Bacteria 18924
275 Ga0163161_10007129 3300017792 Bacteria 7727
276 Ga0163161_10491402 3300017792 Bacteria 998
277 Ga0209563_116204 3300025230 Bacteria 921
278 Ga0207427_100210 3300025231 Bacteria 53314
279 Ga0209437_100021 3300025233 Bacteria 646400
280 Ga0209437_100102 3300025233 Bacteria 224216
281 Ga0207425_1000002 3300025245 Bacteria 1362590
282 Ga0209646_1001716 3300025246 Bacteria 5540
283 Ga0209026_1000287 3300025250 Bacteria 57255
284 Ga0209026_1002893 3300025250 Bacteria 6037
285 Ga0209026_1004025 3300025250 Bacteria 4555
286 Ga0209129_1000002 3300025258 Bacteria 1359086
287 Ga0209129_1009030 3300025258 Bacteria 2685
288 Ga0209233_1000035 3300025261 Bacteria 568478
289 Ga0209233_1002196 3300025261 Bacteria 7314
290 Ga0209233_1018239 3300025261 Bacteria 1893
291 Ga0209455_1001657 3300025272 Bacteria 9647
292 Ga0209676_1000009 3300025292 Bacteria 981719
293 Ga0209025_1000004 3300025294 Bacteria 1361782
294 Ga0209758_1000006 3300025297 Bacteria 1359562
295 Ga0209050_1000094 3300025298 Bacteria 242893
296 Ga0207655_1000038 3300025728 Bacteria 348340
297 Ga0207647_10000392 3300025904 Bacteria 35883
298 Ga0207647_10001469 3300025904 Bacteria 18105
299 Ga0207647_10040765 3300025904 Unclassified 2922
300 Ga0207645_10002377 3300025907 Bacteria 14823
301 Ga0207705_10000068 3300025909 Bacteria 134316
302 Ga0207654_10001514 3300025911 Bacteria 12236
303 Ga0207654_10002658 3300025911 Bacteria 9074
304 Ga0207654_10331039 3300025911 Unclassified 1044
305 Ga0207654_10369331 3300025911 Bacteria 991
306 Ga0207707_10031734 3300025912 Bacteria 4624
307 Ga0207695_10000127 3300025913 Bacteria 227338
308 Ga0207695_10023140 3300025913 Bacteria 7030
309 Ga0207695_10292833 3300025913 Bacteria 1520
310 Ga0207695_10398082 3300025913 Bacteria 1262
311 Ga0207671_10000254 3300025914 Bacteria 79974
312 Ga0207671_10002928 3300025914 Bacteria 17594
313 Ga0207671_10004909 3300025914 Bacteria 12565
314 Ga0207671_10009249 3300025914 Bacteria 8255
315 Ga0207671_10020184 3300025914 Bacteria 5077
316 Ga0207671_10029553 3300025914 Bacteria 4092
317 Ga0207671_10048573 3300025914 Bacteria 3141
318 Ga0207671_10068431 3300025914 Bacteria 2646
319 Ga0207671_10416765 3300025914 Bacteria 1068
320 Ga0207660_10010300 3300025917 Bacteria 6063
321 Ga0207657_10063373 3300025919 Bacteria 3161
322 Ga0207657_10210208 3300025919 Bacteria 1562
323 Ga0207657_10375848 3300025919 Bacteria 1119
324 Ga0207652_10004808 3300025921 Bacteria 10938
325 Ga0207646_10229153 3300025922 Bacteria 1679
326 Ga0207681_10012016 3300025923 Bacteria 5333
327 Ga0207694_10077753 3300025924 Bacteria 2600
328 Ga0207644_10002294 3300025931 Bacteria 12410
329 Ga0207690_10001830 3300025932 Bacteria 13053
330 Ga0207690_10014966 3300025932 Bacteria 4697
331 Ga0207690_10050045 3300025932 Bacteria 2788
332 Ga0207706_10000738 3300025933 Bacteria 34077
333 Ga0207686_10183943 3300025934 Bacteria 1484
334 Ga0207704_10000893 3300025938 Bacteria 13239
335 Ga0207661_10012203 3300025944 Bacteria 6240
336 Ga0207667_10000346 3300025949 Bacteria 63247
337 Ga0207667_10003692 3300025949 Bacteria 18873
338 Ga0207667_10011446 3300025949 Bacteria 10310
339 Ga0207667_10013817 3300025949 Bacteria 9224
340 Ga0207667_10035066 3300025949 Bacteria 5384
341 Ga0207667_10136813 3300025949 Bacteria 2522
342 Ga0207667_10162511 3300025949 Bacteria 2297
343 Ga0207651_10031651 3300025960 Bacteria 3385
344 Ga0207677_10072866 3300026023 Bacteria 2430
345 Ga0207677_10087395 3300026023 Bacteria 2257
346 Ga0207639_10387559 3300026041 Unclassified 1256
347 Ga0207678_10051696 3300026067 Bacteria 3547
348 Ga0207702_10000023 3300026078 Bacteria 189234
349 Ga0207702_10012955 3300026078 Bacteria 6937
350 Ga0207702_10013701 3300026078 Bacteria 6735
351 Ga0207702_10021352 3300026078 Bacteria 5360
352 Ga0207702_10035373 3300026078 Bacteria 4177
353 Ga0207702_10687211 3300026078 Unclassified 1008
354 Ga0207648_10001082 3300026089 Bacteria 30521
355 Ga0207674_10107292 3300026116 Bacteria 2769
356 Ga0207683_10002826 3300026121 Bacteria 15171
357 Ga0207698_10003197 3300026142 Bacteria 9833
358 Ga0207698_10384700 3300026142 Unclassified 1336
359 Ga0207698_10862189 3300026142 Bacteria 911
360 Ga0209281_1000311 3300027111 Bacteria 86930
361 Ga0209489_112096 3300027361 Bacteria 8182
362 Ga0209282_1087910 3300027666 Bacteria 1637
363 Ga0209974_10014312 3300027876 Bacteria 2641
364 Ga0268266_10000185 3300028379 Bacteria 110685
365 Ga0268264_10767522 3300028381 Bacteria 961
366 Ga0265337_1000781 3300028556 Bacteria 16785
367 Ga0265326_10001730 3300028558 Bacteria 7555
368 Ga0265319_1000096 3300028563 Bacteria 67662
369 Ga0265319_1000553 3300028563 Bacteria 25349
370 Ga0265334_10000816 3300028573 Bacteria 15578
371 Ga0265318_10006692 3300028577 Bacteria 5279
372 Ga0265318_10057898 3300028577 Bacteria 1447
373 Ga0265323_10000359 3300028653 Bacteria 26221
374 Ga0265322_10000310 3300028654 Bacteria 20562
375 Ga0265322_10007804 3300028654 Bacteria 3119
376 Ga0265336_10000488 3300028666 Bacteria 23335
377 Ga0307517_10000408 3300028786 Bacteria 73511
378 Ga0307515_10000316 3300028794 Bacteria 119243
379 Ga0307515_10000676 3300028794 Bacteria 78539
380 Ga0307515_10055079 3300028794 Bacteria 5821
381 Ga0265338_10000493 3300028800 Bacteria 70460
382 Ga0265338_10000597 3300028800 Bacteria 63672
383 Ga0265338_10028183 3300028800 Bacteria 5607
384 Ga0265338_10058171 3300028800 Bacteria 3414
385 Ga0265324_10000306 3300029957 Bacteria 36178
386 Ga0265324_10003218 3300029957 Bacteria 7897
387 Ga0316183_1171692 3300030742 Bacteria 16840
388 Ga0316181_1145183 3300030744 Bacteria 1902
389 Ga0265330_10000356 3300031235 Bacteria 32258
390 Ga0265332_10000479 3300031238 Bacteria 27656
391 Ga0265332_10014947 3300031238 Bacteria 3431
392 Ga0265328_10019230 3300031239 Bacteria 2626
393 Ga0265320_10008237 3300031240 Bacteria 6394
394 Ga0265320_10011764 3300031240 Bacteria 5133
395 Ga0265325_10011238 3300031241 Bacteria 5148
396 Ga0265325_10016833 3300031241 Bacteria 4078
397 Ga0265325_10070946 3300031241 Bacteria 1749
398 Ga0265329_10000468 3300031242 Bacteria 21094
399 Ga0265340_10019677 3300031247 Bacteria 3475
400 Ga0265339_10002212 3300031249 Bacteria 14105
401 Ga0265339_10159354 3300031249 Bacteria 1136
402 Ga0265331_10001743 3300031250 Bacteria 15636
403 Ga0265327_10000896 3300031251 Bacteria 43961
404 Ga0265327_10019230 3300031251 Bacteria 4207
405 Ga0265316_10004433 3300031344 Bacteria 13989
406 Ga0265316_10021616 3300031344 Bacteria 5444
407 Ga0265316_10162854 3300031344 Unclassified 1667
408 Ga0307408_100000561 3300031548 Bacteria 32112
409 Ga0307408_100000566 3300031548 Bacteria 31917
410 Ga0307408_100000736 3300031548 Bacteria 26464
411 Ga0307408_100000824 3300031548 Bacteria 24639
412 Ga0307408_100004742 3300031548 Bacteria 9176
413 Ga0265313_10001526 3300031595 Bacteria 21525
414 Ga0265313_10071979 3300031595 Bacteria 1590
415 Ga0265314_10001494 3300031711 Bacteria 25965
416 Ga0265342_10003626 3300031712 Bacteria 12570
417 Ga0265342_10071778 3300031712 Bacteria 2016
418 Ga0316576_10092761 3300031727 Bacteria 2250
419 Ga0307516_10073865 3300031730 Bacteria 3267
420 Ga0307405_10000001 3300031731 Bacteria 1731270
421 Ga0307405_10000006 3300031731 Bacteria 361477
422 Ga0316577_10039680 3300031733 Unclassified 2634
423 Ga0307413_10000039 3300031824 Bacteria 33762
424 Ga0307413_10413148 3300031824 Bacteria 1061
425 Ga0307410_10000363 3300031852 Bacteria 17675
426 Ga0307406_10000950 3300031901 Bacteria 16237
427 Ga0307406_10072243 3300031901 Bacteria 2264
428 Ga0307407_10000031 3300031903 Bacteria 87995
429 Ga0307412_10000043 3300031911 Bacteria 166562
430 Ga0307412_10002048 3300031911 Bacteria 11186
431 Ga0307412_10047998 3300031911 Bacteria 2806
432 Ga0307412_10290256 3300031911 Bacteria 1288
433 Ga0307416_100000002 3300032002 Bacteria 509907
434 Ga0307416_100000179 3300032002 Bacteria 34391
435 Ga0307416_101109809 3300032002 Bacteria 896
436 Ga0307414_10000011 3300032004 Bacteria 338253
437 Ga0307414_10000713 3300032004 Bacteria 16976
438 Ga0307414_10003845 3300032004 Bacteria 8076
439 Ga0307414_10010702 3300032004 Bacteria 5341
440 Ga0307414_10047200 3300032004 Bacteria 2962
441 Ga0307414_10052340 3300032004 Bacteria 2841
442 Ga0307414_10058091 3300032004 Bacteria 2724
443 Ga0307414_10098436 3300032004 Bacteria 2194
444 Ga0307414_10120713 3300032004 Bacteria 2014
445 Ga0307414_10326961 3300032004 Bacteria 1307
446 Ga0307411_10000004 3300032005 Bacteria 460327
447 Ga0307411_10132693 3300032005 Bacteria 1823
448 Ga0307507_10000099 3300033179 Bacteria 139532
449 Ga0307510_10001986 3300033180 Bacteria 23038
450 Ga0307510_10039095 3300033180 Bacteria 5234
451 Ga0373926_0030749 3300035083 Bacteria 1892
452 Ga0373944_0003206 3300035089 Bacteria 4202
453 Ga0373943_0007974 3300035170 Unclassified 4754
454 Ga0373946_0004828 3300035171 Bacteria 4852
455 Ga0316574_0118220 3300035398 Bacteria 1701
456 Ga0373927_0016628 3300035695 Bacteria 4853
457 Ga0373947_0004258 3300035725 Bacteria 8397
458 Ga0316582_0595160 3300036647 Unclassified 761
459 Ga0316584_0002834 3300036712 Bacteria 11117
460 Ga0316584_0530281 3300036712 Bacteria 824
461 Ga0373925_0002642 3300037068 Bacteria 14220
462 Ga0395899_0000173 3300037312 Bacteria 96904
463 Ga0395899_0000177 3300037312 Bacteria 94226
464 Ga0395899_0000238 3300037312 Bacteria 74240
465 Ga0395899_0006897 3300037312 Bacteria 8797
466 Ga0395899_0010845 3300037312 Bacteria 6985
467 Ga0395900_0000139 3300037418 Bacteria 122708
468 Ga0395900_0001986 3300037418 Bacteria 23094
469 Ga0395900_0114314 3300037418 Bacteria 2770
470 Ga0395900_0164466 3300037418 Bacteria 2262
471 Ga0395900_0225301 3300037418 Bacteria 1888
472 Ga0395900_0344081 3300037418 Bacteria 1466
473 Ga0395898_0152481 3300037466 Bacteria 2211
474 Ga0395905_0000169 3300037471 Bacteria 106579
475 Ga0395905_0009042 3300037471 Bacteria 9772
476 Ga0395905_0013551 3300037471 Bacteria 7811
477 Ga0395905_0228117 3300037471 Bacteria 1742
478 Ga0395901_0000838 3300038443 Bacteria 33913
479 Ga0395901_0105660 3300038443 Bacteria 2955
480 Ga0395901_0216416 3300038443 Bacteria 2004
481 Ga0395901_0529518 3300038443 Bacteria 1196
482 Ga0395901_0892942 3300038443 Bacteria 871
483 Ga0400483_129034 3300039062 Bacteria 10301
484 Ga0400483_246494 3300039062 Bacteria 22387
485 Ga0400489_29524 3300039093 Bacteria 3407
486 Ga0436361_0616042 3300039447 Bacteria 10564
487 Ga0439436_0010741 3300041404 Bacteria 2790
488 Ga0439447_000262 3300041407 Bacteria 18516
489 Ga0451807_1497265 3300041486 Bacteria 1009
490 Ga0451807_2107158 3300041486 Bacteria 1501
491 Ga0451843_0848344 3300041509 Bacteria 2289
492 Ga0451855_0315542 3300041511 Bacteria 4988
493 Ga0451855_1357253 3300041511 Unclassified 2154
494 Ga0439448_0006422 3300042005 Bacteria 3381
495 Ga0439457_000014 3300042014 Bacteria 36364
496 Ga0439457_018034 3300042014 Bacteria 1567
497 Ga0439462_0003017 3300042015 Bacteria 3997
498 Ga0451577_0000250 3300042876 Bacteria 105934
499 Ga0451577_0119839 3300042876 Bacteria 2357
500 Ga0451577_0153015 3300042876 Bacteria 2076
501 Ga0451577_0299081 3300042876 Unclassified 1458
502 Ga0453683_0000418 3300044673 Bacteria 49409
503 Ga0453683_0500574 3300044673 Unclassified 788
504 Ga0466965_0188134 3300044683 Bacteria 1091
505 Ga0466966_0011391 3300044684 Bacteria 5897
506 Ga0466961_0023410 3300044693 Bacteria 3974
507 Ga0453684_0000148 3300044712 Bacteria 308453
508 Ga0453684_0000542 3300044712 Bacteria 143132
509 Ga0453684_0000771 3300044712 Bacteria 110664
510 Ga0453684_0083110 3300044712 Bacteria 3986
511 Ga0453684_0098119 3300044712 Bacteria 3593
512 Ga0453684_0158115 3300044712 Bacteria 2684
513 Ga0453684_0213492 3300044712 Bacteria 2241
514 Ga0453684_0306036 3300044712 Bacteria 1805
515 Ga0453684_0376823 3300044712 Unclassified 1594
516 Ga0466968_0162906 3300044735 Bacteria 1030
517 Ga0466957_0029802 3300044842 Bacteria 3256
518 Ga0466959_0057164 3300045049 Bacteria 2845
519 Ga0451576_0000020 3300045051 Bacteria 529568
520 Ga0451576_0000216 3300045051 Bacteria 142333
521 Ga0451576_0091205 3300045051 Bacteria 3170
522 Ga0495603_0011823 3300046455 Bacteria 5283
523 Ga0495638_0156087 3300046460 Bacteria 1320
524 Ga0495651_0314471 3300046462 Bacteria 1046
525 Ga0495650_0000107 3300046471 Bacteria 200864
526 Ga0495650_0011966 3300046471 Bacteria 4699
527 Ga0495580_0010779 3300046472 Bacteria 7099
528 Ga0495582_0051700 3300046473 Bacteria 2265
529 Ga0495639_0000789 3300046475 Bacteria 14448
530 Ga0495639_0167731 3300046475 Bacteria 1065
531 Ga0495585_0000116 3300046492 Bacteria 86272
532 Ga0495585_0000170 3300046492 Bacteria 70224
533 Ga0495606_0002103 3300046507 Bacteria 24231
534 Ga0495606_0012971 3300046507 Bacteria 6630
535 Ga0495606_0032101 3300046507 Bacteria 3642
536 Ga0495606_0051259 3300046507 Bacteria 2693
537 Ga0495606_0055915 3300046507 Bacteria 2549
538 Ga0495606_0078485 3300046507 Bacteria 2059
539 Ga0495610_0000724 3300046512 Bacteria 31376
540 Ga0495610_0000784 3300046512 Bacteria 29827
541 Ga0495610_0056619 3300046512 Bacteria 1884
542 Ga0495616_0000882 3300046513 Bacteria 21777
543 Ga0495616_0006658 3300046513 Bacteria 6974
544 Ga0495616_0018662 3300046513 Bacteria 3802
545 Ga0495620_0084640 3300046515 Bacteria 1279
546 Ga0495630_0019994 3300046517 Bacteria 4930
547 Ga0495637_0028231 3300046520 Bacteria 2507
548 Ga0495643_0002717 3300046522 Bacteria 13619
549 Ga0495648_0165233 3300046524 Bacteria 1140
550 Ga0495663_0035203 3300046525 Bacteria 1503
551 Ga0495652_0187976 3300046529 Bacteria 1579
552 Ga0495652_0359872 3300046529 Bacteria 1040
553 Ga0495654_0034318 3300046530 Bacteria 2561
554 Ga0495665_0001769 3300046531 Bacteria 11640
555 Ga0495609_0001895 3300046538 Bacteria 13334
556 Ga0495609_0028800 3300046538 Bacteria 2533
557 Ga0495622_0015212 3300046557 Bacteria 3576
558 Ga0495633_0000006 3300046558 Bacteria 326774
559 Ga0495633_0006149 3300046558 Bacteria 7181
560 Ga0495633_0101684 3300046558 Bacteria 1334
561 Ga0495668_0000011 3300046616 Bacteria 472186
562 Ga0495668_0110833 3300046616 Bacteria 1501
563 Ga0495668_0119227 3300046616 Bacteria 1443
564 Ga0495625_0000021 3300046660 Bacteria 282133
565 Ga0495625_0000344 3300046660 Bacteria 71298
566 Ga0495625_0001450 3300046660 Bacteria 28784
567 Ga0495625_0014051 3300046660 Bacteria 6410
568 Ga0495625_0014342 3300046660 Bacteria 6331
569 Ga0495625_0052836 3300046660 Bacteria 2908
570 Ga0495625_0077428 3300046660 Bacteria 2323
571 Ga0495625_0241358 3300046660 Bacteria 1176
572 Ga0495625_0377360 3300046660 Bacteria 890
573 Ga0495661_0003287 3300046665 Bacteria 12000
574 Ga0495661_0011479 3300046665 Bacteria 6010
575 Ga0495588_0021304 3300046674 Bacteria 3193
576 Ga0495658_0078696 3300046683 Bacteria 1930
577 Ga0495671_0035629 3300046692 Bacteria 2526
578 Ga0495649_0000009 3300046694 Bacteria 451725
579 Ga0495660_0001836 3300046810 Bacteria 13932
580 Ga0495660_0059145 3300046810 Bacteria 2062
581 Ga0495581_0013370 3300047315 Unclassified 4759
582 Ga0495683_0173691 3300047323 Bacteria 989
583 Ga0495687_000356 3300047443 Bacteria 57396
584 Ga0495687_002785 3300047443 Bacteria 13508
585 Ga0495673_0009304 3300047469 Bacteria 5446
586 Ga0495686_0000107 3300047472 Bacteria 174386
587 Ga0495686_0000673 3300047472 Bacteria 46191
588 Ga0495686_0054572 3300047472 Bacteria 2502
589 Ga0495686_0087020 3300047472 Bacteria 1901
590 Ga0495593_0002299 3300047673 Bacteria 11458
591 Ga0495614_0002616 3300048089 Bacteria 8001
592 Ga0496115_0031776 3300048918 Bacteria 4162
593 Ga0496116_0000024 3300048919 Bacteria 471420
594 Ga0496117_0005463 3300048920 Bacteria 13327
595 Ga0496118_0029437 3300048921 Bacteria 4605
596 Ga0496118_0072993 3300048921 Bacteria 2461
597 Ga0496121_0090261 3300048924 Bacteria 2396
598 Ga0496121_0118226 3300048924 Bacteria 2007
599 Ga0496121_0119604 3300048924 Bacteria 1992
600 Ga0496122_0005019 3300048925 Bacteria 16009
601 Ga0496123_0006462 3300048926 Bacteria 11343
602 Ga0496123_0010972 3300048926 Bacteria 7924
603 Ga0496124_0020328 3300048927 Bacteria 6140
604 Ga0496124_0053507 3300048927 Bacteria 3421
605 Ga0496125_0000018 3300048928 Bacteria 482390
606 Ga0496125_0000452 3300048928 Bacteria 74236
607 Ga0496125_0153492 3300048928 Bacteria 1577
608 Ga0496126_0023580 3300048929 Bacteria 5961
609 Ga0495682_0041665 3300049460 Bacteria 1683
610 Ga0501323_000375 3300049539 Bacteria 3202
611 Ga0501031_0004782 3300049568 Bacteria 8794
612 Ga0501032_0003573 3300049569 Bacteria 11854
613 Ga0501032_0016210 3300049569 Bacteria 5242
614 Ga0501033_0000005 3300049570 Bacteria 379089
615 Ga0501034_0000259 3300049571 Bacteria 95584
616 Ga0501034_0035621 3300049571 Bacteria 5045
617 Ga0501034_0255490 3300049571 Bacteria 1696
618 Ga0501036_0014746 3300049572 Bacteria 6517
619 Ga0501036_0169703 3300049572 Bacteria 1838
620 Ga0501038_0012276 3300049574 Bacteria 7824
621 Ga0501039_0023363 3300049575 Bacteria 4746
622 Ga0501040_0376781 3300049576 Bacteria 1018
623 Ga0501043_0017878 3300049579 Bacteria 5560
624 Ga0501047_0193119 3300049581 Bacteria 1899
625 Ga0501070_0304069 3300049586 Unclassified 1299
626 Ga0501249_000012 3300049679 Bacteria 153759
627 Ga0501249_001078 3300049679 Bacteria 5790
628 Ga0501241_007429 3300049758 Bacteria 2006
629 Ga0501241_013856 3300049758 Unclassified 1464
630 Ga0501266_000002 3300049763 Bacteria 459947
631 Ga0501269_006526 3300049766 Bacteria 1407
632 Ga0501280_001973 3300049776 Bacteria 3571
633 Ga0501280_004479 3300049776 Bacteria 2052
634 Ga0501035_0023485 3300049822 Bacteria 5656
635 Ga0501035_0165986 3300049822 Bacteria 1909
636 Ga0501044_0011700 3300049823 Bacteria 9506
637 Ga0501044_0145228 3300049823 Bacteria 2358
638 Ga0501044_0236580 3300049823 Bacteria 1772
639 Ga0501045_0000184 3300049824 Bacteria 34854
640 nmdc:mga03683_29_c1 3300050489 Bacteria 74308
641 nmdc:mga00v17_285_c1 3300050491 Bacteria 29912
642 nmdc:mga0k408_141042_c1 3300050493 Bacteria 1434
643 nmdc:mga0k408_534_c1 3300050493 Bacteria 20938
644 nmdc:mga0k408_88770_c1 3300050493 Bacteria 1815
645 nmdc:mga07m45_99320_c1 3300050496 Bacteria 948
646 nmdc:mga09592_45525_c1 3300050508 Bacteria 3696
647 nmdc:mga06r32_137909_c1 3300050510 Bacteria 2414
648 nmdc:mga0a205_131170_c1 3300050515 Bacteria 2406
649 Ga0500635_0000417 3300053080 Bacteria 12581
650 Ga0500646_0002249 3300053090 Bacteria 5022
651 Ga0500646_0010716 3300053090 Bacteria 2353
652 Ga0500646_0015810 3300053090 Bacteria 1967
653 Ga0500647_0076489 3300053091 Bacteria 1606
654 Ga0500583_0000060 3300053092 Bacteria 68112
655 Ga0500651_0001777 3300053093 Bacteria 11046
656 Ga0500651_0183900 3300053093 Bacteria 1240
657 Ga0500641_0000010 3300053096 Bacteria 171383
658 Ga0500641_0000275 3300053096 Bacteria 19089
659 Ga0500641_0001720 3300053096 Bacteria 7784
660 Ga0500641_0079603 3300053096 Bacteria 1389
661 Ga0500650_0151774 3300053098 Bacteria 1071
662 Ga0500594_0006680 3300053118 Bacteria 2599
663 Ga0500618_000016 3300053125 Bacteria 164049
664 Ga0500642_0201332 3300053130 Bacteria 926
665 Ga0500658_0000002 3300053134 Bacteria 548440
666 Ga0500658_0197147 3300053134 Unclassified 920
667 Ga0500559_0040733 3300053136 Bacteria 2024
668 Ga0500624_000265 3300053157 Bacteria 18286
669 Ga0500636_0200309 3300053177 Bacteria 1057
670 Ga0500584_049348 3300053726 Bacteria 1909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10228453 rootH2_102284532 199
2 3300025913 Ga0207695_10398082 Ga0207695_103980822 199
3 3300002772 JGI25164J39214_1001360 JGI25164J39214_10013605 206
4 3300003214 JGI25165J46597_1000728 JGI25165J46597_100072811 206
5 3300025230 Ga0209563_116204 Ga0209563_1162041 206
6 3300025231 Ga0207427_100210 Ga0207427_10021035 206
7 3300025233 Ga0209437_100021 Ga0209437_100021620 206
8 3300025261 Ga0209233_1000035 Ga0209233_100003517 206
9 3300025914 Ga0207671_10029553 Ga0207671_100295534 207
10 3300025246 Ga0209646_1001716 Ga0209646_10017166 209
11 3300009545 Ga0105237_10028356 Ga0105237_100283563 210
12 3300010375 Ga0105239_10002632 Ga0105239_100026323 210
13 3300026142 Ga0207698_10862189 Ga0207698_108621892 211
14 3300003323 rootH1_10098029 rootH1_100980291 212
15 3300005616 Ga0068852_101034905 Ga0068852_1010349052 212
16 3300013307 Ga0157372_10453972 Ga0157372_104539722 215
17 3300005353 Ga0070669_100007276 Ga0070669_1000072766 217
18 3300013102 Ga0157371_10132533 Ga0157371_101325332 217
19 3300025923 Ga0207681_10012016 Ga0207681_100120163 217
20 3300041404 Ga0439436_0010741 Ga0439436_0010741_576_1292 217
21 3300042014 Ga0439457_000014 Ga0439457_000014_24493_25209 217
22 3300042015 Ga0439462_0003017 Ga0439462_0003017_1748_2464 217
23 3300005329 Ga0070683_100018067 Ga0070683_1000180672 218
24 3300005535 Ga0070684_100080813 Ga0070684_1000808134 218
25 3300013100 Ga0157373_10000050 Ga0157373_10000050108 218
26 3300013307 Ga0157372_10002322 Ga0157372_100023224 218
27 3300025944 Ga0207661_10012203 Ga0207661_100122036 218
28 3300050515 nmdc:mga0a205_131170_c1 nmdc:mga0a205_131170_c1_10_681 218
29 3300053134 Ga0500658_0197147 Ga0500658_0197147_55_771 218
30 3300042014 Ga0439457_018034 Ga0439457_018034_771_1487 219
31 3300044842 Ga0466957_0029802 Ga0466957_0029802_167_883 219
32 3300053177 Ga0500636_0200309 Ga0500636_0200309_312_1028 219
33 3300006195 Ga0075366_10164955 Ga0075366_101649552 220
34 3300028381 Ga0268264_10767522 Ga0268264_107675221 220
35 3300005458 Ga0070681_10233580 Ga0070681_102335802 221
36 3300015261 Ga0182006_1005766 Ga0182006_10057667 221
37 3300013296 Ga0157374_10085876 Ga0157374_100858762 222
38 3300046616 Ga0495668_0110833 Ga0495668_0110833_216_974 222
39 3300005338 Ga0068868_100274731 Ga0068868_1002747311 223
40 3300005614 Ga0068856_100695945 Ga0068856_1006959451 223
41 3300026078 Ga0207702_10687211 Ga0207702_106872111 223
42 2209111006 2214746907 2213757316 224
43 3300005468 Ga0070707_100333753 Ga0070707_1003337532 224
44 3300005471 Ga0070698_100775467 Ga0070698_1007754672 224
45 3300005547 Ga0070693_100131269 Ga0070693_1001312692 224
46 3300013105 Ga0157369_10169603 Ga0157369_101696032 224
47 3300013307 Ga0157372_10037629 Ga0157372_100376296 224
48 3300025922 Ga0207646_10229153 Ga0207646_102291532 224
49 3300005336 Ga0070680_100143031 Ga0070680_1001430312 225
50 3300005345 Ga0070692_10392937 Ga0070692_103929371 225
51 3300005467 Ga0070706_100039678 Ga0070706_1000396784 225
52 3300005471 Ga0070698_100022109 Ga0070698_1000221092 225
53 3300005577 Ga0068857_100390008 Ga0068857_1003900082 225
54 3300005614 Ga0068856_100023803 Ga0068856_1000238034 225
55 3300005985 Ga0081539_10000261 Ga0081539_1000026126 225
56 3300013307 Ga0157372_10059286 Ga0157372_100592864 225
57 3300026078 Ga0207702_10035373 Ga0207702_100353734 225
58 3300005546 Ga0070696_100000897 Ga0070696_10000089711 226
59 3300006051 Ga0075364_10001344 Ga0075364_100013443 226
60 3300006177 Ga0075362_10000037 Ga0075362_1000003753 226
61 3300009093 Ga0105240_10187161 Ga0105240_101871612 226
62 3300010375 Ga0105239_10000011 Ga0105239_10000011302 226
63 3300046475 Ga0495639_0167731 Ga0495639_0167731_108_857 226
64 3300046492 Ga0495585_0000170 Ga0495585_0000170_28021_28770 226
65 3300046530 Ga0495654_0034318 Ga0495654_0034318_1592_2341 226
66 3300046538 Ga0495609_0001895 Ga0495609_0001895_6641_7390 226
67 3300046557 Ga0495622_0015212 Ga0495622_0015212_2657_3406 226
68 3300046558 Ga0495633_0000006 Ga0495633_0000006_155684_156433 226
69 3300046616 Ga0495668_0000011 Ga0495668_0000011_17685_18434 226
70 3300046660 Ga0495625_0001450 Ga0495625_0001450_2929_3678 226
71 3300046683 Ga0495658_0078696 Ga0495658_0078696_998_1747 226
72 3300046810 Ga0495660_0059145 Ga0495660_0059145_357_1106 226
73 3300049460 Ga0495682_0041665 Ga0495682_0041665_792_1541 226
74 3300050489 nmdc:mga03683_29_c1 nmdc:mga03683_29_c1_60618_61307 226
75 3300050491 nmdc:mga00v17_285_c1 nmdc:mga00v17_285_c1_26909_27598 226
76 3300005614 Ga0068856_100014566 Ga0068856_1000145664 227
77 3300009174 Ga0105241_10043373 Ga0105241_100433733 227
78 3300025250 Ga0209026_1000287 Ga0209026_100028727 227
79 3300026078 Ga0207702_10012955 Ga0207702_100129555 227
80 3300041511 Ga0451855_1357253 Ga0451855_1357253_845_1555 227
81 3300046507 Ga0495606_0078485 Ga0495606_0078485_1010_1759 227
82 3300046810 Ga0495660_0001836 Ga0495660_0001836_233_982 227
83 3300004799 Ga0058863_11752149 Ga0058863_117521491 228
84 3300004803 Ga0058862_12181088 Ga0058862_121810881 228
85 3300005336 Ga0070680_100060235 Ga0070680_1000602351 228
86 3300005458 Ga0070681_10029767 Ga0070681_100297674 228
87 3300005530 Ga0070679_100122173 Ga0070679_1001221732 228
88 3300006847 Ga0075431_100022588 Ga0075431_1000225884 228
89 3300025912 Ga0207707_10031734 Ga0207707_100317344 228
90 3300025917 Ga0207660_10010300 Ga0207660_100103003 228
91 3300042876 Ga0451577_0153015 Ga0451577_0153015_330_1025 228
92 3300050510 nmdc:mga06r32_137909_c1 nmdc:mga06r32_137909_c1_1463_2179 228
93 iso_pu_bacteria 2958512119 2958515966 228
94 iso_pu_bacteria 2965320100 2965322125 228
95 3300005347 Ga0070668_100175537 Ga0070668_1001755372 229
96 3300005456 Ga0070678_100335240 Ga0070678_1003352402 229
97 3300006844 Ga0075428_100462108 Ga0075428_1004621081 229
98 3300025272 Ga0209455_1001657 Ga0209455_10016572 229
99 3300046515 Ga0495620_0084640 Ga0495620_0084640_61_774 229
100 3300046525 Ga0495663_0035203 Ga0495663_0035203_93_806 229
101 3300049571 Ga0501034_0035621 Ga0501034_0035621_172_879 229
102 iso_pu_bacteria 2519899754 2520879710 229
103 iso_pu_bacteria 2643221600 2644009373 229
104 iso_pu_bacteria 2643221667 2644374117 229
105 iso_pu_bacteria 2643221716 2644643762 229
106 iso_pu_bacteria 2643221725 2644681652 229
107 iso_pu_bacteria 2738541279 2738732877 229
108 iso_pu_bacteria 2738541285 2738765415 229
109 iso_pu_bacteria 2738543007 2739214458 229
110 iso_pu_bacteria 2739367857 2740003034 229
111 iso_pu_bacteria 2739367858 2740007851 229
112 iso_pu_bacteria 2802428842 2802654721 229
113 iso_pu_bacteria 2816332280 2817413359 229
114 iso_pu_bacteria 2857613821 2857617227 229
115 iso_pu_bacteria 2857618242 2857619917 229
116 iso_pu_bacteria 2881247448 2881250034 229
117 iso_pu_bacteria 2881359912 2881360162 229
118 iso_pu_bacteria 2903895155 2903898838 229
119 iso_pu_bacteria 2904419702 2904423128 229
120 iso_pu_bacteria 2904555929 2904558684 229
121 iso_pu_bacteria 2919191525 2919194407 229
122 iso_pu_bacteria 2919509842 2919512838 229
123 iso_pu_bacteria 2929150217 2929150431 229
124 iso_pu_bacteria 2958458903 2958463142 229
125 iso_pu_bacteria 2977268062 2977271893 229
126 iso_pu_bacteria 8054307821 8054311604 229
127 iso_pu_bacteria 8055419101 8055423390 229
128 iso_pu_bacteria 8055592153 8055595246 229
129 3300009093 Ga0105240_10263220 Ga0105240_102632202 230
130 3300009551 Ga0105238_10676786 Ga0105238_106767862 230
131 3300013306 Ga0163162_10001421 Ga0163162_1000142114 230
132 3300036647 Ga0316582_0595160 Ga0316582_0595160_30_725 230
133 iso_pu_bacteria 2513020052 2513232557 230
134 iso_pu_bacteria 2919683626 2919684421 230
135 iso_pu_bacteria 8056440228 8056443337 230
136 3300005434 Ga0070709_10277424 Ga0070709_102774242 231
137 3300005436 Ga0070713_100196486 Ga0070713_1001964862 231
138 3300006871 Ga0075434_100541753 Ga0075434_1005417532 231
139 3300009093 Ga0105240_10338136 Ga0105240_103381362 231
140 3300009093 Ga0105240_10442940 Ga0105240_104429402 231
141 3300035083 Ga0373926_0030749 Ga0373926_0030749_425_1144 231
142 3300035089 Ga0373944_0003206 Ga0373944_0003206_462_1181 231
143 3300035170 Ga0373943_0007974 Ga0373943_0007974_137_856 231
144 3300035171 Ga0373946_0004828 Ga0373946_0004828_1712_2431 231
145 3300035695 Ga0373927_0016628 Ga0373927_0016628_3619_4338 231
146 3300035725 Ga0373947_0004258 Ga0373947_0004258_4154_4873 231
147 3300037068 Ga0373925_0002642 Ga0373925_0002642_10188_10907 231
148 3300046455 Ga0495603_0011823 Ga0495603_0011823_942_1661 231
149 3300046472 Ga0495580_0010779 Ga0495580_0010779_3561_4280 231
150 3300046473 Ga0495582_0051700 Ga0495582_0051700_1359_2078 231
151 3300046475 Ga0495639_0000789 Ga0495639_0000789_13482_14201 231
152 3300046517 Ga0495630_0019994 Ga0495630_0019994_495_1214 231
153 3300046531 Ga0495665_0001769 Ga0495665_0001769_3802_4521 231
154 3300046674 Ga0495588_0021304 Ga0495588_0021304_578_1297 231
155 3300047315 Ga0495581_0013370 Ga0495581_0013370_3814_4536 231
156 3300047673 Ga0495593_0002299 Ga0495593_0002299_7077_7796 231
157 3300048089 Ga0495614_0002616 Ga0495614_0002616_220_939 231
158 3300053080 Ga0500635_0000417 Ga0500635_0000417_10201_10947 231
159 3300002737 JGI25162J39368_1000203 JGI25162J39368_100020313 232
160 3300005563 Ga0068855_100000279 Ga0068855_10000027935 232
161 3300010375 Ga0105239_10001867 Ga0105239_1000186716 232
162 3300013104 Ga0157370_10001760 Ga0157370_1000176010 232
163 3300013297 Ga0157378_10121436 Ga0157378_101214362 232
164 3300013306 Ga0163162_10078628 Ga0163162_100786282 232
165 3300017792 Ga0163161_10001060 Ga0163161_100010608 232
166 3300025233 Ga0209437_100102 Ga0209437_10010250 232
167 3300025258 Ga0209129_1009030 Ga0209129_10090303 232
168 3300025921 Ga0207652_10004808 Ga0207652_100048082 232
169 3300025949 Ga0207667_10000346 Ga0207667_1000034629 232
170 3300031241 Ga0265325_10016833 Ga0265325_100168332 232
171 3300035398 Ga0316574_0118220 Ga0316574_0118220_172_870 232
172 3300036712 Ga0316584_0530281 Ga0316584_0530281_114_812 232
173 3300037312 Ga0395899_0000173 Ga0395899_0000173_24422_25123 232
174 3300037418 Ga0395900_0344081 Ga0395900_0344081_465_1166 232
175 3300046507 Ga0495606_0051259 Ga0495606_0051259_1762_2460 232
176 3300046513 Ga0495616_0018662 Ga0495616_0018662_2096_2794 232
177 3300046522 Ga0495643_0002717 Ga0495643_0002717_3824_4522 232
178 3300046660 Ga0495625_0014342 Ga0495625_0014342_1050_1748 232
179 3300048918 Ga0496115_0031776 Ga0496115_0031776_1389_2087 232
180 3300048924 Ga0496121_0090261 Ga0496121_0090261_1275_1973 232
181 3300048928 Ga0496125_0000452 Ga0496125_0000452_14321_15019 232
182 3300048929 Ga0496126_0023580 Ga0496126_0023580_814_1512 232
183 3300049569 Ga0501032_0003573 Ga0501032_0003573_9863_10594 232
184 3300053090 Ga0500646_0002249 Ga0500646_0002249_4221_4919 232
185 3300053096 Ga0500641_0000275 Ga0500641_0000275_13040_13738 232
186 3300003320 rootH2_10015381 rootH2_100153817 233
187 3300003578 Ga0006562J51391_1004923 Ga0006562J51391_10049235 233
188 3300005288 Ga0065714_10008551 Ga0065714_100085514 233
189 3300005288 Ga0065714_10065896 Ga0065714_100658963 233
190 3300005288 Ga0065714_10096653 Ga0065714_100966532 233
191 3300005288 Ga0065714_10110891 Ga0065714_101108911 233
192 3300005289 Ga0065704_10097387 Ga0065704_100973873 233
193 3300005289 Ga0065704_10132256 Ga0065704_101322562 233
194 3300005293 Ga0065715_10008714 Ga0065715_100087142 233
195 3300005293 Ga0065715_10107254 Ga0065715_101072543 233
196 3300005293 Ga0065715_10154827 Ga0065715_101548272 233
197 3300005293 Ga0065715_10353311 Ga0065715_103533112 233
198 3300005337 Ga0070682_100599602 Ga0070682_1005996021 233
199 3300006942 Ga0099824_1006531 Ga0099824_10065318 233
200 3300006946 Ga0079104_1000091 Ga0079104_10000916 233
201 3300006948 Ga0099826_10055147 Ga0099826_100551472 233
202 3300009036 Ga0105244_10000027 Ga0105244_100000276 233
203 3300009036 Ga0105244_10057916 Ga0105244_100579162 233
204 3300009092 Ga0105250_10034406 Ga0105250_100344062 233
205 3300013100 Ga0157373_10000007 Ga0157373_1000000736 233
206 3300013104 Ga0157370_10000192 Ga0157370_1000019224 233
207 3300013104 Ga0157370_10001177 Ga0157370_100011774 233
208 3300013104 Ga0157370_10012581 Ga0157370_100125817 233
209 3300013104 Ga0157370_10025011 Ga0157370_100250113 233
210 3300013105 Ga0157369_10004306 Ga0157369_100043066 233
211 3300015261 Ga0182006_1003054 Ga0182006_10030548 233
212 3300015261 Ga0182006_1055073 Ga0182006_10550733 233
213 3300017792 Ga0163161_10000055 Ga0163161_1000005552 233
214 3300017792 Ga0163161_10491402 Ga0163161_104914022 233
215 3300025728 Ga0207655_1000038 Ga0207655_10000387 233
216 3300025914 Ga0207671_10000254 Ga0207671_1000025449 233
217 3300027111 Ga0209281_1000311 Ga0209281_100031121 233
218 3300027361 Ga0209489_112096 Ga0209489_1120967 233
219 3300027666 Ga0209282_1087910 Ga0209282_10879103 233
220 3300028794 Ga0307515_10000316 Ga0307515_100003164 233
221 3300031548 Ga0307408_100000824 Ga0307408_10000082426 233
222 3300031731 Ga0307405_10000001 Ga0307405_10000001987 233
223 3300031824 Ga0307413_10000039 Ga0307413_100000396 233
224 3300031852 Ga0307410_10000363 Ga0307410_1000036315 233
225 3300031901 Ga0307406_10000950 Ga0307406_1000095010 233
226 3300031901 Ga0307406_10072243 Ga0307406_100722432 233
227 3300032002 Ga0307416_100000179 Ga0307416_1000001797 233
228 3300032004 Ga0307414_10000011 Ga0307414_10000011162 233
229 3300032004 Ga0307414_10120713 Ga0307414_101207132 233
230 3300032005 Ga0307411_10000004 Ga0307411_10000004192 233
231 3300032005 Ga0307411_10132693 Ga0307411_101326932 233
232 3300041407 Ga0439447_000262 Ga0439447_000262_5966_6667 233
233 3300046660 Ga0495625_0241358 Ga0495625_0241358_25_726 233
234 3300048919 Ga0496116_0000024 Ga0496116_0000024_283572_284273 233
235 3300048921 Ga0496118_0072993 Ga0496118_0072993_517_1218 233
236 3300048924 Ga0496121_0118226 Ga0496121_0118226_207_908 233
237 3300048924 Ga0496121_0119604 Ga0496121_0119604_733_1434 233
238 3300048927 Ga0496124_0020328 Ga0496124_0020328_4532_5233 233
239 3300048928 Ga0496125_0000018 Ga0496125_0000018_196121_196822 233
240 3300049539 Ga0501323_000375 Ga0501323_000375_2281_2982 233
241 3300049568 Ga0501031_0004782 Ga0501031_0004782_2991_3722 233
242 3300049569 Ga0501032_0016210 Ga0501032_0016210_2141_2872 233
243 3300049570 Ga0501033_0000005 Ga0501033_0000005_117762_118493 233
244 3300049571 Ga0501034_0000259 Ga0501034_0000259_66519_67250 233
245 3300049571 Ga0501034_0255490 Ga0501034_0255490_425_1144 233
246 3300049572 Ga0501036_0014746 Ga0501036_0014746_4115_4846 233
247 3300049574 Ga0501038_0012276 Ga0501038_0012276_6213_6944 233
248 3300049575 Ga0501039_0023363 Ga0501039_0023363_1488_2219 233
249 3300049586 Ga0501070_0304069 Ga0501070_0304069_547_1278 233
250 3300049679 Ga0501249_001078 Ga0501249_001078_2290_2991 233
251 3300049758 Ga0501241_007429 Ga0501241_007429_512_1213 233
252 3300049763 Ga0501266_000002 Ga0501266_000002_158032_158733 233
253 3300049766 Ga0501269_006526 Ga0501269_006526_694_1395 233
254 3300049776 Ga0501280_004479 Ga0501280_004479_851_1552 233
255 3300049822 Ga0501035_0023485 Ga0501035_0023485_1158_1889 233
256 3300049823 Ga0501044_0145228 Ga0501044_0145228_1159_1890 233
257 3300049824 Ga0501045_0000184 Ga0501045_0000184_20856_21587 233
258 3300053090 Ga0500646_0015810 Ga0500646_0015810_339_1040 233
259 3300053093 Ga0500651_0183900 Ga0500651_0183900_375_1076 233
260 3300053096 Ga0500641_0000010 Ga0500641_0000010_133439_134140 233
261 3300053134 Ga0500658_0000002 Ga0500658_0000002_385924_386625 233
262 3300053136 Ga0500559_0040733 Ga0500559_0040733_471_1172 233
263 3300053726 Ga0500584_049348 Ga0500584_049348_636_1337 233
264 iso_pu_bacteria 2887375801 2887378101 233
265 3300005293 Ga0065715_10029650 Ga0065715_100296502 234
266 3300005563 Ga0068855_100257001 Ga0068855_1002570011 234
267 3300005614 Ga0068856_100144746 Ga0068856_1001447463 234
268 3300005614 Ga0068856_101018314 Ga0068856_1010183141 234
269 3300026078 Ga0207702_10021352 Ga0207702_100213525 234
270 3300027876 Ga0209974_10014312 Ga0209974_100143122 234
271 3300033180 Ga0307510_10039095 Ga0307510_100390952 234
272 3300041486 Ga0451807_2107158 Ga0451807_2107158_532_1239 234
273 3300041509 Ga0451843_0848344 Ga0451843_0848344_558_1265 234
274 3300044683 Ga0466965_0188134 Ga0466965_0188134_269_982 234
275 3300049572 Ga0501036_0169703 Ga0501036_0169703_1052_1759 234
276 3300049581 Ga0501047_0193119 Ga0501047_0193119_779_1486 234
277 3300049679 Ga0501249_000012 Ga0501249_000012_19261_19968 234
278 3300049822 Ga0501035_0165986 Ga0501035_0165986_467_1174 234
279 3300049823 Ga0501044_0236580 Ga0501044_0236580_1040_1747 234
280 3300053096 Ga0500641_0001720 Ga0500641_0001720_6845_7552 234
281 3300053118 Ga0500594_0006680 Ga0500594_0006680_181_888 234
282 iso_pu_bacteria 2738541278 2738731762 234
283 3300005327 Ga0070658_10067944 Ga0070658_100679441 235
284 3300005577 Ga0068857_100300211 Ga0068857_1003002112 235
285 3300005616 Ga0068852_100412117 Ga0068852_1004121171 235
286 3300009093 Ga0105240_10000083 Ga0105240_10000083153 235
287 3300009174 Ga0105241_10017707 Ga0105241_100177075 235
288 3300009545 Ga0105237_10000198 Ga0105237_1000019850 235
289 3300010375 Ga0105239_10003144 Ga0105239_1000314413 235
290 3300013306 Ga0163162_10227865 Ga0163162_102278653 235
291 3300025911 Ga0207654_10002658 Ga0207654_100026586 235
292 3300025913 Ga0207695_10000127 Ga0207695_10000127153 235
293 3300026142 Ga0207698_10384700 Ga0207698_103847002 235
294 3300005563 Ga0068855_100034812 Ga0068855_1000348124 236
295 3300005578 Ga0068854_100209390 Ga0068854_1002093902 236
296 3300005614 Ga0068856_100000006 Ga0068856_10000000663 236
297 3300009545 Ga0105237_10035356 Ga0105237_100353562 236
298 3300010375 Ga0105239_10035070 Ga0105239_100350704 236
299 3300017792 Ga0163161_10007129 Ga0163161_100071293 236
300 3300025914 Ga0207671_10020184 Ga0207671_100201842 236
301 3300025949 Ga0207667_10035066 Ga0207667_100350664 236
302 3300026078 Ga0207702_10000023 Ga0207702_1000002347 236
303 3300037418 Ga0395900_0225301 Ga0395900_0225301_771_1493 236
304 3300044712 Ga0453684_0306036 Ga0453684_0306036_206_943 236
305 3300044735 Ga0466968_0162906 Ga0466968_0162906_295_1017 236
306 3300046524 Ga0495648_0165233 Ga0495648_0165233_394_1113 236
307 3300049576 Ga0501040_0376781 Ga0501040_0376781_83_796 236
308 3300053098 Ga0500650_0151774 Ga0500650_0151774_325_1047 236
309 3300037471 Ga0395905_0009042 Ga0395905_0009042_7912_8628 237
310 3300045051 Ga0451576_0000020 Ga0451576_0000020_422220_422936 237
311 3300045051 Ga0451576_0091205 Ga0451576_0091205_452_1165 237
312 3300048928 Ga0496125_0153492 Ga0496125_0153492_22_735 237
313 3300005563 Ga0068855_100002137 Ga0068855_10000213711 238
314 3300005614 Ga0068856_100049487 Ga0068856_1000494872 238
315 3300006195 Ga0075366_10030725 Ga0075366_100307255 238
316 3300006358 Ga0068871_100067473 Ga0068871_1000674732 238
317 3300006880 Ga0075429_100016041 Ga0075429_1000160414 238
318 3300009093 Ga0105240_10181495 Ga0105240_101814952 238
319 3300009174 Ga0105241_10018754 Ga0105241_100187546 238
320 3300009545 Ga0105237_10068325 Ga0105237_100683254 238
321 3300010375 Ga0105239_10013222 Ga0105239_100132225 238
322 3300013297 Ga0157378_10104066 Ga0157378_101040664 238
323 3300013307 Ga0157372_10123248 Ga0157372_101232483 238
324 3300025911 Ga0207654_10331039 Ga0207654_103310391 238
325 3300025949 Ga0207667_10011446 Ga0207667_100114469 238
326 3300031251 Ga0265327_10000896 Ga0265327_1000089617 238
327 3300031548 Ga0307408_100000561 Ga0307408_10000056122 238
328 3300041486 Ga0451807_1497265 Ga0451807_1497265_275_991 238
329 3300041511 Ga0451855_0315542 Ga0451855_0315542_2859_3575 238
330 3300042876 Ga0451577_0000250 Ga0451577_0000250_45351_46067 238
331 3300042876 Ga0451577_0299081 Ga0451577_0299081_215_931 238
332 3300044673 Ga0453683_0000418 Ga0453683_0000418_3794_4510 238
333 3300044712 Ga0453684_0000542 Ga0453684_0000542_4628_5344 238
334 3300044712 Ga0453684_0000771 Ga0453684_0000771_36226_36942 238
335 3300044712 Ga0453684_0158115 Ga0453684_0158115_686_1402 238
336 3300044712 Ga0453684_0213492 Ga0453684_0213492_1207_1923 238
337 3300044712 Ga0453684_0376823 Ga0453684_0376823_188_904 238
338 3300045051 Ga0451576_0000216 Ga0451576_0000216_3829_4545 238
339 3300046460 Ga0495638_0156087 Ga0495638_0156087_482_1198 238
340 3300049823 Ga0501044_0011700 Ga0501044_0011700_121_837 238
341 3300050493 nmdc:mga0k408_141042_c1 nmdc:mga0k408_141042_c1_140_856 238
342 3300050508 nmdc:mga09592_45525_c1 nmdc:mga09592_45525_c1_146_865 238
343 3300053090 Ga0500646_0010716 Ga0500646_0010716_1304_2020 238
344 3300053092 Ga0500583_0000060 Ga0500583_0000060_51731_52447 238
345 3300053096 Ga0500641_0079603 Ga0500641_0079603_395_1111 238
346 3300053130 Ga0500642_0201332 Ga0500642_0201332_149_865 238
347 3300032002 Ga0307416_101109809 Ga0307416_1011098091 239
348 3300044673 Ga0453683_0500574 Ga0453683_0500574_49_768 239
349 3300044712 Ga0453684_0000148 Ga0453684_0000148_219975_220694 239
350 3300049579 Ga0501043_0017878 Ga0501043_0017878_2359_3081 239
351 3300009176 Ga0105242_10195501 Ga0105242_101955012 240
352 3300031727 Ga0316576_10092761 Ga0316576_100927611 240
353 3300031733 Ga0316577_10039680 Ga0316577_100396803 240
354 3300036712 Ga0316584_0002834 Ga0316584_0002834_6807_7532 240
355 3300039062 Ga0400483_129034 Ga0400483_129034_2886_3608 240
356 3300039062 Ga0400483_246494 Ga0400483_246494_14957_15679 240
357 3300039093 Ga0400489_29524 Ga0400489_29524_1167_1889 240
358 3300042876 Ga0451577_0119839 Ga0451577_0119839_125_856 240
359 3300044712 Ga0453684_0083110 Ga0453684_0083110_2345_3070 240
360 3300044712 Ga0453684_0098119 Ga0453684_0098119_2601_3332 240
361 3300047472 Ga0495686_0000107 Ga0495686_0000107_24854_25603 240
362 3300047472 Ga0495686_0054572 Ga0495686_0054572_1717_2466 240
363 iso_pu_bacteria 2738541302 2738855409 240
364 iso_pu_bacteria 2739367651 2739588169 240
365 iso_pu_bacteria 2739367656 2739614058 240
366 iso_pu_bacteria 2739367663 2739647039 240
367 iso_pu_bacteria 2818991437 2819546119 240
368 iso_pu_bacteria 2842722452 2842724024 240
369 iso_pu_bacteria 2842909656 2842912243 240
370 iso_pu_bacteria 2849281842 2849282672 240
371 iso_pu_bacteria 2857627736 2857629409 240
372 iso_pu_bacteria 2904445276 2904446406 240
373 iso_pu_bacteria 2945997725 2945999216 240
374 iso_pu_bacteria 2954016120 2954021611 240
375 iso_pu_bacteria 2898713307 2898713756 241
376 3300005366 Ga0070659_100000225 Ga0070659_1000002252 242
377 3300025919 Ga0207657_10210208 Ga0207657_102102082 242
378 3300025932 Ga0207690_10001830 Ga0207690_1000183012 242
379 3300028556 Ga0265337_1000781 Ga0265337_100078117 242
380 3300028558 Ga0265326_10001730 Ga0265326_100017307 242
381 3300028563 Ga0265319_1000096 Ga0265319_100009625 242
382 3300028563 Ga0265319_1000553 Ga0265319_100055322 242
383 3300028573 Ga0265334_10000816 Ga0265334_1000081613 242
384 3300028577 Ga0265318_10006692 Ga0265318_100066925 242
385 3300028577 Ga0265318_10057898 Ga0265318_100578982 242
386 3300028653 Ga0265323_10000359 Ga0265323_1000035923 242
387 3300028654 Ga0265322_10000310 Ga0265322_100003107 242
388 3300028654 Ga0265322_10007804 Ga0265322_100078041 242
389 3300028666 Ga0265336_10000488 Ga0265336_100004881 242
390 3300028800 Ga0265338_10000493 Ga0265338_1000049329 242
391 3300028800 Ga0265338_10000597 Ga0265338_1000059725 242
392 3300028800 Ga0265338_10028183 Ga0265338_100281834 242
393 3300028800 Ga0265338_10058171 Ga0265338_100581711 242
394 3300029957 Ga0265324_10000306 Ga0265324_1000030615 242
395 3300029957 Ga0265324_10003218 Ga0265324_100032186 242
396 3300031235 Ga0265330_10000356 Ga0265330_1000035622 242
397 3300031238 Ga0265332_10000479 Ga0265332_1000047920 242
398 3300031238 Ga0265332_10014947 Ga0265332_100149475 242
399 3300031239 Ga0265328_10019230 Ga0265328_100192303 242
400 3300031240 Ga0265320_10008237 Ga0265320_100082375 242
401 3300031240 Ga0265320_10011764 Ga0265320_100117641 242
402 3300031241 Ga0265325_10011238 Ga0265325_100112385 242
403 3300031241 Ga0265325_10070946 Ga0265325_100709461 242
404 3300031242 Ga0265329_10000468 Ga0265329_1000046820 242
405 3300031247 Ga0265340_10019677 Ga0265340_100196775 242
406 3300031249 Ga0265339_10002212 Ga0265339_1000221212 242
407 3300031249 Ga0265339_10159354 Ga0265339_101593541 242
408 3300031250 Ga0265331_10001743 Ga0265331_100017431 242
409 3300031344 Ga0265316_10004433 Ga0265316_100044337 242
410 3300031344 Ga0265316_10021616 Ga0265316_100216163 242
411 3300031344 Ga0265316_10162854 Ga0265316_101628542 242
412 3300031595 Ga0265313_10001526 Ga0265313_100015267 242
413 3300031711 Ga0265314_10001494 Ga0265314_1000149423 242
414 3300031712 Ga0265342_10003626 Ga0265342_100036264 242
415 3300031712 Ga0265342_10071778 Ga0265342_100717782 242
416 iso_pu_bacteria 2599185184 2599479450 242
417 iso_pu_bacteria 2738541284 2738764202 242
418 iso_pu_bacteria 2738543023 2739305241 242
419 iso_pu_bacteria 2775506987 2776611972 242
420 iso_pu_bacteria 2842903701 2842907995 242
421 iso_pu_bacteria 2852623160 2852625810 242
422 iso_pu_bacteria 2852627209 2852630941 242
423 iso_pu_bacteria 2884933994 2884935664 242
424 iso_pu_bacteria 2919186247 2919189268 242
425 iso_pu_bacteria 2919437846 2919440246 242
426 iso_pu_bacteria 2928078545 2928082244 242
427 iso_pu_bacteria 2928147474 2928149179 242
428 iso_pu_bacteria 2932082852 2932084961 242
429 iso_pu_bacteria 2939664404 2939666577 242
430 iso_pu_bacteria 2977232053 2977234178 242
431 3300005327 Ga0070658_10401560 Ga0070658_104015602 243
432 3300025250 Ga0209026_1004025 Ga0209026_10040253 243
433 3300025261 Ga0209233_1018239 Ga0209233_10182392 243
434 3300038443 Ga0395901_0529518 Ga0395901_0529518_168_902 243
435 iso_pu_bacteria 2738541283 2738756718 243
436 iso_pu_bacteria 2890737413 2890740210 243
437 iso_pu_bacteria 2896344016 2896347054 243
438 iso_pu_bacteria 2902048731 2902052212 243
439 iso_pu_bacteria 2904780799 2904783565 243
440 iso_pu_bacteria 2919177583 2919181427 243
441 3300001904 JGI24736J21556_1011486 JGI24736J21556_10114862 244
442 3300001990 JGI24737J22298_10010511 JGI24737J22298_100105113 244
443 3300002067 JGI24735J21928_10003137 JGI24735J21928_100031376 244
444 3300002773 JGI25152J39213_1000697 JGI25152J39213_100069710 244
445 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001142 244
446 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001653 244
447 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001542 244
448 3300003322 rootL2_10110563 rootL2_101105632 244
449 3300003781 Ga0055536_1000004 Ga0055536_1000004367 244
450 3300003791 Ga0055530_10000869 Ga0055530_100008698 244
451 3300005288 Ga0065714_10002216 Ga0065714_100022163 244
452 3300005288 Ga0065714_10133993 Ga0065714_101339932 244
453 3300005339 Ga0070660_100293353 Ga0070660_1002933532 244
454 3300005366 Ga0070659_100003274 Ga0070659_10000327411 244
455 3300005577 Ga0068857_100105925 Ga0068857_1001059252 244
456 3300005614 Ga0068856_100012161 Ga0068856_1000121615 244
457 3300009174 Ga0105241_10602441 Ga0105241_106024411 244
458 3300009545 Ga0105237_10005210 Ga0105237_1000521012 244
459 3300010375 Ga0105239_10000115 Ga0105239_100001156 244
460 3300013102 Ga0157371_10000074 Ga0157371_1000007495 244
461 3300013102 Ga0157371_10000164 Ga0157371_1000016448 244
462 3300013104 Ga0157370_10001475 Ga0157370_1000147517 244
463 3300013104 Ga0157370_10033538 Ga0157370_100335382 244
464 3300013104 Ga0157370_10094687 Ga0157370_100946872 244
465 3300013105 Ga0157369_10000031 Ga0157369_10000031153 244
466 3300013105 Ga0157369_10330982 Ga0157369_103309822 244
467 3300013306 Ga0163162_10001734 Ga0163162_1000173411 244
468 3300013307 Ga0157372_10000249 Ga0157372_1000024914 244
469 3300013307 Ga0157372_10249421 Ga0157372_102494212 244
470 3300013308 Ga0157375_10327528 Ga0157375_103275282 244
471 3300014497 Ga0182008_10000876 Ga0182008_100008765 244
472 3300015261 Ga0182006_1000159 Ga0182006_100015948 244
473 3300015261 Ga0182006_1000697 Ga0182006_10006975 244
474 3300015262 Ga0182007_10000002 Ga0182007_10000002185 244
475 3300015682 Ga0183373_1004 Ga0183373_1004291 244
476 3300017792 Ga0163161_10000310 Ga0163161_1000031017 244
477 3300025245 Ga0207425_1000002 Ga0207425_10000021019 244
478 3300025250 Ga0209026_1002893 Ga0209026_10028936 244
479 3300025258 Ga0209129_1000002 Ga0209129_10000021019 244
480 3300025261 Ga0209233_1002196 Ga0209233_10021963 244
481 3300025292 Ga0209676_1000009 Ga0209676_1000009189 244
482 3300025294 Ga0209025_1000004 Ga0209025_1000004172 244
483 3300025297 Ga0209758_1000006 Ga0209758_1000006172 244
484 3300025298 Ga0209050_1000094 Ga0209050_1000094189 244
485 3300025904 Ga0207647_10001469 Ga0207647_100014693 244
486 3300025904 Ga0207647_10040765 Ga0207647_100407651 244
487 3300025911 Ga0207654_10369331 Ga0207654_103693311 244
488 3300025914 Ga0207671_10004909 Ga0207671_100049097 244
489 3300025932 Ga0207690_10014966 Ga0207690_100149663 244
490 3300025949 Ga0207667_10136813 Ga0207667_101368134 244
491 3300026116 Ga0207674_10107292 Ga0207674_101072923 244
492 3300031251 Ga0265327_10019230 Ga0265327_100192301 244
493 3300031731 Ga0307405_10000006 Ga0307405_10000006320 244
494 3300031903 Ga0307407_10000031 Ga0307407_1000003147 244
495 3300031911 Ga0307412_10290256 Ga0307412_102902561 244
496 3300032002 Ga0307416_100000002 Ga0307416_100000002168 244
497 3300032004 Ga0307414_10010702 Ga0307414_100107022 244
498 3300037471 Ga0395905_0228117 Ga0395905_0228117_791_1537 244
499 3300038443 Ga0395901_0892942 Ga0395901_0892942_86_832 244
500 3300046507 Ga0495606_0032101 Ga0495606_0032101_2216_2950 244
501 3300046512 Ga0495610_0000724 Ga0495610_0000724_4255_4989 244
502 3300046512 Ga0495610_0000784 Ga0495610_0000784_14838_15572 244
503 3300046520 Ga0495637_0028231 Ga0495637_0028231_1662_2396 244
504 3300050493 nmdc:mga0k408_88770_c1 nmdc:mga0k408_88770_c1_1009_1758 244
505 3300003323 rootH1_10195403 rootH1_101954031 245
506 3300009545 Ga0105237_10116024 Ga0105237_101160242 245
507 3300025914 Ga0207671_10068431 Ga0207671_100684311 245
508 3300046462 Ga0495651_0314471 Ga0495651_0314471_238_987 245
509 3300046507 Ga0495606_0055915 Ga0495606_0055915_664_1419 245
510 3300046660 Ga0495625_0377360 Ga0495625_0377360_73_822 245
511 3300047472 Ga0495686_0000673 Ga0495686_0000673_9298_10047 245
512 2162886007 SwRhRL2b_contig_829818 SwRhRL2b_0309.00003380 246
513 3300001979 JGI24740J21852_10050454 JGI24740J21852_100504542 246
514 3300001990 JGI24737J22298_10000321 JGI24737J22298_1000032111 246
515 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003283 246
516 3300002077 JGI24744J21845_10007987 JGI24744J21845_100079872 246
517 3300003316 rootH1_10152788 rootH1_101527882 246
518 3300003320 rootH2_10000984 rootH2_1000098466 246
519 3300003320 rootH2_10160370 rootH2_101603702 246
520 3300003322 rootL2_10065652 rootL2_100656527 246
521 3300003323 rootH1_10154754 rootH1_101547542 246
522 3300003323 rootH1_10223455 rootH1_102234553 246
523 3300003323 rootH1_10332970 rootH1_103329701 246
524 3300005288 Ga0065714_10010665 Ga0065714_100106653 246
525 3300005288 Ga0065714_10070770 Ga0065714_100707702 246
526 3300005289 Ga0065704_10070251 Ga0065704_1007025142 246
527 3300005289 Ga0065704_10073887 Ga0065704_100738873 246
528 3300005327 Ga0070658_10000041 Ga0070658_1000004166 246
529 3300005328 Ga0070676_10000775 Ga0070676_100007754 246
530 3300005339 Ga0070660_100046270 Ga0070660_1000462702 246
531 3300005339 Ga0070660_100353903 Ga0070660_1003539031 246
532 3300005355 Ga0070671_100007168 Ga0070671_10000716810 246
533 3300005364 Ga0070673_100002704 Ga0070673_1000027042 246
534 3300005366 Ga0070659_100123163 Ga0070659_1001231632 246
535 3300005455 Ga0070663_100043972 Ga0070663_1000439723 246
536 3300005456 Ga0070678_100000911 Ga0070678_1000009114 246
537 3300005457 Ga0070662_100000355 Ga0070662_10000035523 246
538 3300005459 Ga0068867_100001244 Ga0068867_10000124413 246
539 3300005539 Ga0068853_100100874 Ga0068853_1001008742 246
540 3300005543 Ga0070672_100037292 Ga0070672_1000372923 246
541 3300005548 Ga0070665_100000096 Ga0070665_10000009657 246
542 3300005563 Ga0068855_100005096 Ga0068855_10000509614 246
543 3300005563 Ga0068855_100053163 Ga0068855_1000531634 246
544 3300005563 Ga0068855_100089320 Ga0068855_1000893202 246
545 3300005614 Ga0068856_100019146 Ga0068856_1000191468 246
546 3300005616 Ga0068852_100000920 Ga0068852_1000009208 246
547 3300006195 Ga0075366_10000652 Ga0075366_1000065212 246
548 3300006195 Ga0075366_10002252 Ga0075366_100022525 246
549 3300006237 Ga0097621_100000330 Ga0097621_10000033019 246
550 3300006353 Ga0075370_10304769 Ga0075370_103047691 246
551 3300006358 Ga0068871_100000085 Ga0068871_10000008538 246
552 3300006881 Ga0068865_100000096 Ga0068865_10000009613 246
553 3300009093 Ga0105240_10004631 Ga0105240_1000463110 246
554 3300009093 Ga0105240_10072028 Ga0105240_100720281 246
555 3300009093 Ga0105240_10298941 Ga0105240_102989411 246
556 3300009174 Ga0105241_10005104 Ga0105241_100051049 246
557 3300009174 Ga0105241_10010239 Ga0105241_100102394 246
558 3300009174 Ga0105241_10079828 Ga0105241_100798282 246
559 3300009176 Ga0105242_10010571 Ga0105242_100105717 246
560 3300009545 Ga0105237_10003401 Ga0105237_100034013 246
561 3300009545 Ga0105237_10007709 Ga0105237_100077092 246
562 3300009545 Ga0105237_10200734 Ga0105237_102007343 246
563 3300009545 Ga0105237_10642815 Ga0105237_106428151 246
564 3300009551 Ga0105238_10026895 Ga0105238_100268956 246
565 3300009551 Ga0105238_10156656 Ga0105238_101566563 246
566 3300010375 Ga0105239_10044847 Ga0105239_100448473 246
567 3300010375 Ga0105239_10055411 Ga0105239_100554114 246
568 3300010375 Ga0105239_10272698 Ga0105239_102726982 246
569 3300011119 Ga0105246_10530160 Ga0105246_105301602 246
570 3300013100 Ga0157373_10000601 Ga0157373_1000060124 246
571 3300013100 Ga0157373_10009093 Ga0157373_100090933 246
572 3300013100 Ga0157373_10009649 Ga0157373_100096492 246
573 3300013100 Ga0157373_10225155 Ga0157373_102251552 246
574 3300013102 Ga0157371_10000486 Ga0157371_1000048640 246
575 3300013102 Ga0157371_10001622 Ga0157371_1000162213 246
576 3300013102 Ga0157371_10002408 Ga0157371_100024084 246
577 3300013102 Ga0157371_10012774 Ga0157371_100127743 246
578 3300013102 Ga0157371_10065206 Ga0157371_100652063 246
579 3300013104 Ga0157370_10008143 Ga0157370_1000814310 246
580 3300013104 Ga0157370_10071406 Ga0157370_100714062 246
581 3300013104 Ga0157370_10135508 Ga0157370_101355083 246
582 3300013104 Ga0157370_10183764 Ga0157370_101837643 246
583 3300013105 Ga0157369_10000494 Ga0157369_100004948 246
584 3300013105 Ga0157369_10030017 Ga0157369_100300172 246
585 3300013105 Ga0157369_10031116 Ga0157369_100311164 246
586 3300013105 Ga0157369_10056415 Ga0157369_100564152 246
587 3300013105 Ga0157369_10496389 Ga0157369_104963891 246
588 3300013296 Ga0157374_10000536 Ga0157374_1000053617 246
589 3300013296 Ga0157374_10000967 Ga0157374_100009677 246
590 3300013296 Ga0157374_10045908 Ga0157374_100459084 246
591 3300013297 Ga0157378_10093511 Ga0157378_100935112 246
592 3300013297 Ga0157378_10095349 Ga0157378_100953493 246
593 3300013306 Ga0163162_10000005 Ga0163162_10000005184 246
594 3300013306 Ga0163162_10761407 Ga0163162_107614072 246
595 3300013307 Ga0157372_10000042 Ga0157372_1000004277 246
596 3300013307 Ga0157372_10073868 Ga0157372_100738683 246
597 3300013307 Ga0157372_10187213 Ga0157372_101872132 246
598 3300013307 Ga0157372_11011737 Ga0157372_110117371 246
599 3300013308 Ga0157375_10041062 Ga0157375_100410624 246
600 3300013308 Ga0157375_10087622 Ga0157375_100876222 246
601 3300013308 Ga0157375_10351530 Ga0157375_103515302 246
602 3300013308 Ga0157375_10443929 Ga0157375_104439292 246
603 3300014497 Ga0182008_10000014 Ga0182008_10000014166 246
604 3300014745 Ga0157377_10141300 Ga0157377_101413002 246
605 3300017792 Ga0163161_10001258 Ga0163161_100012584 246
606 3300025904 Ga0207647_10000392 Ga0207647_1000039221 246
607 3300025907 Ga0207645_10002377 Ga0207645_100023774 246
608 3300025909 Ga0207705_10000068 Ga0207705_1000006859 246
609 3300025911 Ga0207654_10001514 Ga0207654_100015143 246
610 3300025913 Ga0207695_10023140 Ga0207695_100231408 246
611 3300025913 Ga0207695_10292833 Ga0207695_102928332 246
612 3300025914 Ga0207671_10002928 Ga0207671_1000292815 246
613 3300025914 Ga0207671_10048573 Ga0207671_100485733 246
614 3300025914 Ga0207671_10416765 Ga0207671_104167651 246
615 3300025919 Ga0207657_10063373 Ga0207657_100633733 246
616 3300025919 Ga0207657_10375848 Ga0207657_103758482 246
617 3300025924 Ga0207694_10077753 Ga0207694_100777532 246
618 3300025931 Ga0207644_10002294 Ga0207644_100022948 246
619 3300025932 Ga0207690_10050045 Ga0207690_100500452 246
620 3300025933 Ga0207706_10000738 Ga0207706_1000073811 246
621 3300025934 Ga0207686_10183943 Ga0207686_101839432 246
622 3300025938 Ga0207704_10000893 Ga0207704_100008936 246
623 3300025949 Ga0207667_10003692 Ga0207667_100036929 246
624 3300025949 Ga0207667_10013817 Ga0207667_100138172 246
625 3300025949 Ga0207667_10162511 Ga0207667_101625112 246
626 3300025960 Ga0207651_10031651 Ga0207651_100316512 246
627 3300026023 Ga0207677_10072866 Ga0207677_100728663 246
628 3300026023 Ga0207677_10087395 Ga0207677_100873952 246
629 3300026041 Ga0207639_10387559 Ga0207639_103875592 246
630 3300026067 Ga0207678_10051696 Ga0207678_100516962 246
631 3300026078 Ga0207702_10013701 Ga0207702_100137014 246
632 3300026089 Ga0207648_10001082 Ga0207648_1000108226 246
633 3300026121 Ga0207683_10002826 Ga0207683_100028264 246
634 3300026142 Ga0207698_10003197 Ga0207698_100031974 246
635 3300028379 Ga0268266_10000185 Ga0268266_1000018552 246
636 3300028786 Ga0307517_10000408 Ga0307517_100004081 246
637 3300028794 Ga0307515_10000676 Ga0307515_100006769 246
638 3300028794 Ga0307515_10055079 Ga0307515_100550794 246
639 3300031730 Ga0307516_10073865 Ga0307516_100738652 246
640 3300031911 Ga0307412_10000043 Ga0307412_1000004348 246
641 3300031911 Ga0307412_10047998 Ga0307412_100479982 246
642 3300032004 Ga0307414_10000713 Ga0307414_100007132 246
643 3300032004 Ga0307414_10003845 Ga0307414_100038453 246
644 3300032004 Ga0307414_10047200 Ga0307414_100472004 246
645 3300032004 Ga0307414_10058091 Ga0307414_100580913 246
646 3300033180 Ga0307510_10001986 Ga0307510_100019869 246
647 3300037312 Ga0395899_0000177 Ga0395899_0000177_6398_7150 246
648 3300037312 Ga0395899_0000238 Ga0395899_0000238_2298_3050 246
649 3300037312 Ga0395899_0006897 Ga0395899_0006897_2848_3600 246
650 3300037312 Ga0395899_0010845 Ga0395899_0010845_3381_4133 246
651 3300037418 Ga0395900_0000139 Ga0395900_0000139_12877_13629 246
652 3300037418 Ga0395900_0001986 Ga0395900_0001986_20057_20809 246
653 3300037418 Ga0395900_0114314 Ga0395900_0114314_845_1597 246
654 3300037418 Ga0395900_0164466 Ga0395900_0164466_1223_1975 246
655 3300037466 Ga0395898_0152481 Ga0395898_0152481_297_1049 246
656 3300037471 Ga0395905_0000169 Ga0395905_0000169_5314_6066 246
657 3300037471 Ga0395905_0013551 Ga0395905_0013551_2286_3038 246
658 3300038443 Ga0395901_0000838 Ga0395901_0000838_8666_9418 246
659 3300038443 Ga0395901_0105660 Ga0395901_0105660_1881_2633 246
660 3300038443 Ga0395901_0216416 Ga0395901_0216416_297_1049 246
661 3300039447 Ga0436361_0616042 Ga0436361_0616042_5503_6255 246
662 3300042005 Ga0439448_0006422 Ga0439448_0006422_1319_2071 246
663 3300044684 Ga0466966_0011391 Ga0466966_0011391_4839_5591 246
664 3300044693 Ga0466961_0023410 Ga0466961_0023410_1449_2201 246
665 3300045049 Ga0466959_0057164 Ga0466959_0057164_1569_2321 246
666 3300046471 Ga0495650_0000107 Ga0495650_0000107_196637_197386 246
667 3300046471 Ga0495650_0011966 Ga0495650_0011966_2043_2792 246
668 3300046492 Ga0495585_0000116 Ga0495585_0000116_23045_23794 246
669 3300046507 Ga0495606_0002103 Ga0495606_0002103_14209_14958 246
670 3300046507 Ga0495606_0012971 Ga0495606_0012971_1255_2004 246
671 3300046512 Ga0495610_0056619 Ga0495610_0056619_786_1535 246
672 3300046513 Ga0495616_0000882 Ga0495616_0000882_6885_7634 246
673 3300046513 Ga0495616_0006658 Ga0495616_0006658_248_997 246
674 3300046529 Ga0495652_0187976 Ga0495652_0187976_559_1308 246
675 3300046529 Ga0495652_0359872 Ga0495652_0359872_241_990 246
676 3300046538 Ga0495609_0028800 Ga0495609_0028800_538_1287 246
677 3300046558 Ga0495633_0006149 Ga0495633_0006149_5331_6080 246
678 3300046616 Ga0495668_0119227 Ga0495668_0119227_150_899 246
679 3300046660 Ga0495625_0000021 Ga0495625_0000021_31034_31783 246
680 3300046660 Ga0495625_0000344 Ga0495625_0000344_34007_34756 246
681 3300046660 Ga0495625_0014051 Ga0495625_0014051_2691_3440 246
682 3300046660 Ga0495625_0052836 Ga0495625_0052836_1165_1914 246
683 3300046660 Ga0495625_0077428 Ga0495625_0077428_1247_1996 246
684 3300046665 Ga0495661_0003287 Ga0495661_0003287_10824_11573 246
685 3300046665 Ga0495661_0011479 Ga0495661_0011479_2736_3485 246
686 3300046692 Ga0495671_0035629 Ga0495671_0035629_996_1745 246
687 3300046694 Ga0495649_0000009 Ga0495649_0000009_427744_428493 246
688 3300047323 Ga0495683_0173691 Ga0495683_0173691_142_891 246
689 3300047443 Ga0495687_000356 Ga0495687_000356_35465_36214 246
690 3300047443 Ga0495687_002785 Ga0495687_002785_4614_5366 246
691 3300047469 Ga0495673_0009304 Ga0495673_0009304_2750_3499 246
692 3300047472 Ga0495686_0087020 Ga0495686_0087020_211_960 246
693 3300049758 Ga0501241_013856 Ga0501241_013856_498_1238 246
694 3300049776 Ga0501280_001973 Ga0501280_001973_1353_2093 246
695 3300050493 nmdc:mga0k408_534_c1 nmdc:mga0k408_534_c1_17305_18054 246
696 3300050496 nmdc:mga07m45_99320_c1 nmdc:mga07m45_99320_c1_87_836 246
697 3300053091 Ga0500647_0076489 Ga0500647_0076489_345_1094 246
698 3300053093 Ga0500651_0001777 Ga0500651_0001777_5897_6637 246
699 3300053125 Ga0500618_000016 Ga0500618_000016_70698_71447 246
700 3300053157 Ga0500624_000265 Ga0500624_000265_10135_10884 246
701 3300005289 Ga0065704_10226425 Ga0065704_102264252 247
702 3300009176 Ga0105242_10703381 Ga0105242_107033812 247
703 3300009545 Ga0105237_10006711 Ga0105237_100067118 247
704 3300013104 Ga0157370_10000303 Ga0157370_1000030340 247
705 3300013307 Ga0157372_10006765 Ga0157372_1000676510 247
706 3300014497 Ga0182008_10000632 Ga0182008_1000063221 247
707 3300014497 Ga0182008_10010960 Ga0182008_100109604 247
708 3300014497 Ga0182008_10034731 Ga0182008_100347312 247
709 3300015261 Ga0182006_1001331 Ga0182006_10013315 247
710 3300015262 Ga0182007_10007341 Ga0182007_100073411 247
711 3300015262 Ga0182007_10007397 Ga0182007_100073972 247
712 3300015262 Ga0182007_10029643 Ga0182007_100296432 247
713 3300017792 Ga0163161_10000406 Ga0163161_100004065 247
714 3300025914 Ga0207671_10009249 Ga0207671_100092498 247
715 3300030742 Ga0316183_1171692 Ga0316183_11716929 247
716 3300030744 Ga0316181_1145183 Ga0316181_11451832 247
717 3300031548 Ga0307408_100000566 Ga0307408_10000056613 247
718 3300031548 Ga0307408_100000736 Ga0307408_10000073617 247
719 3300031548 Ga0307408_100004742 Ga0307408_1000047424 247
720 3300031824 Ga0307413_10413148 Ga0307413_104131481 247
721 3300031911 Ga0307412_10002048 Ga0307412_100020486 247
722 3300032004 Ga0307414_10052340 Ga0307414_100523402 247
723 3300032004 Ga0307414_10098436 Ga0307414_100984361 247
724 3300032004 Ga0307414_10326961 Ga0307414_103269612 247
725 3300048920 Ga0496117_0005463 Ga0496117_0005463_3024_3767 247
726 3300048921 Ga0496118_0029437 Ga0496118_0029437_1613_2356 247
727 3300048925 Ga0496122_0005019 Ga0496122_0005019_15112_15855 247
728 3300048926 Ga0496123_0006462 Ga0496123_0006462_8087_8830 247
729 3300048926 Ga0496123_0010972 Ga0496123_0010972_2362_3105 247
730 3300048927 Ga0496124_0053507 Ga0496124_0053507_144_887 247
731 3300009174 Ga0105241_10177369 Ga0105241_101773692 252
732 3300005288 Ga0065714_10015338 Ga0065714_100153381 253
733 3300031595 Ga0265313_10071979 Ga0265313_100719792 255
734 3300017792 Ga0163161_10001090 Ga0163161_1000109015 261
735 3300046558 Ga0495633_0101684 Ga0495633_0101684_137_961 261
736 iso_pu_bacteria 2585427687 2586210870 261
737 3300033179 Ga0307507_10000099 Ga0307507_1000009920 266
738 2162886007 SwRhRL2b_contig_488003 SwRhRL2b_0217.00005910 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

30

132

0.89

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

135

274

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vm6-assembly1.cif.gz_C crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution 0.8671 22 264
5us6-assembly1.cif.gz_D structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.8559 22 267
1vm6-assembly1.cif.gz_C crystal structure of dihydrodipicolinate reductase (tm1520) from thermotoga maritima at 2.27 a resolution 0.8522 22 264
5us6-assembly2.cif.gz_H structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.8503 22 268
5wol-assembly1.cif.gz_A crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii 0.8496 22 263
ID Description Score Start End Superfamily
1vm6D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8871 126 234 3.30.360.10
af_P9WP23_2_120_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8762 23 138 3.50.50.60
1vm6D02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.8675 126 234 3.30.360.10
1yl7C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8653 23 124 3.40.50.720
af_Q57865_2_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8628 22 262 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6M1N564-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.9984 22 266 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287
AF-A0A6M1N564-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.9943 22 266 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287
AF-A0A4R1LUY1-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.994 22 267 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287
AF-A0A1T4ZYL8-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase (HTPA reductase) (EC 1.17.1.8) 0.9939 22 268 GO:0005829
GO:0008839
GO:0009089
GO:0016726
GO:0019877
GO:0050661
GO:0051287
AF-A0A4U9JA54-F1-model_v4 deleted 0.9921 22 121

Feature Viewer

pLDDT pTM Quality
90.63 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map