F478358

General Info

Members Datasets Scaffolds Average Seq Length
737 343 1474 289

Family's Representative Sequence

Representative Sequence 3300053120|Ga0500597_034210|Ga0500597_034210_708_1745
Length 345
Sequence VADRTIELKLSENSTVRRIKPNRWFQFIRHFETILAKVLLNTGILESNCSETVRLSIMAQQNDNRPFGAAEDWTIPQDWARYTAVEHAMWDRLFERQSAILPGRVASEFLAGLDILRLSKPGIPDFEELSERLMAATGWQVVAVPGLVPDAVFFDHLANRRFVAGRFIRTPDQLDYLQEPDIFHDVFGHVPLLANPVFADYMQAYGMGGQRAAGLGSIEKLARLYWYTVEFGLIRSGDDLRIYGSGIVSSYGESVFALDDPSPNRLGFNLQRLMRTKYRIDDYQQNYFVIDSFEDLLRQTQETDFGPLYAALENQSDIEIEAILPSDEVYTRGTQSYAKAKLVTT

Samples

Sample ID Description Type Environment
1 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
117 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
218 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
274 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
275 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
276 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
277 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
278 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
279 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
280 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
281 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
282 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
283 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
284 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
297 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
298 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
299 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
300 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
307 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
308 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
309 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
310 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
311 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
312 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
313 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
316 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
317 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
318 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
319 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
322 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
323 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
324 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
327 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
328 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
329 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
330 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
331 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
332 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
333 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
334 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
335 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
336 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
337 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
338 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
339 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
340 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
341 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
342 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
343 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0.14
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.72
Nodule 0.27
Rhizoplane 4.48
Rhizosphere 67.44
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500597_034210 3300053120 Bacteria 2107
2 SwRhRL2b_contig_1233908 2162886007 Bacteria 5725
3 SwRhRL2b_contig_3308639 2162886007 Bacteria 12228
4 JGI24736J21556_1000004 3300001904 Bacteria 55308
5 JGI24736J21556_1000158 3300001904 Bacteria 11955
6 JGI24741J21665_1000027 3300001915 Bacteria 34739
7 JGI24740J21852_10005199 3300001979 Bacteria 5524
8 JGI24740J21852_10009996 3300001979 Bacteria 3677
9 JGI24739J22299_10006854 3300001989 Bacteria 4290
10 JGI24739J22299_10018201 3300001989 Bacteria 2528
11 JGI24737J22298_10003710 3300001990 Bacteria 5376
12 JGI24737J22298_10005046 3300001990 Bacteria 4575
13 JGI24737J22298_10009302 3300001990 Bacteria 3273
14 JGI24743J22301_10006315 3300001991 Bacteria 2015
15 JGI24735J21928_10002350 3300002067 Bacteria 6589
16 JGI24735J21928_10005878 3300002067 Bacteria 4056
17 JGI24750J21931_1000060 3300002070 Bacteria 15589
18 JGI24748J21848_1000083 3300002074 Bacteria 28195
19 JGI24738J21930_10000860 3300002075 Bacteria 8715
20 JGI24738J21930_10028035 3300002075 Bacteria 1153
21 JGI24749J21850_1000053 3300002076 Bacteria 22163
22 JGI24749J21850_1000625 3300002076 Bacteria 5147
23 JGI24744J21845_10014295 3300002077 Bacteria 1595
24 JGI24034J26672_10000021 3300002239 Bacteria 118553
25 JGI24742J22300_10005615 3300002244 Bacteria 2062
26 JGI24751J29686_10000172 3300002459 Bacteria 30053
27 JGI24751J29686_10003922 3300002459 Bacteria 3005
28 JGI25150J39212_1000313 3300002774 Bacteria 23995
29 JGI25153J46596_10000027 3300003215 Bacteria 210760
30 Ga0055542_1005309 3300003762 Bacteria 2935
31 Ga0055526_1006101 3300003771 Bacteria 6654
32 Ga0055536_1000580 3300003781 Bacteria 24917
33 Ga0055530_10000017 3300003791 Bacteria 144027
34 Ga0055530_10000638 3300003791 Bacteria 30190
35 Ga0055530_10013388 3300003791 Bacteria 2803
36 Ga0055540_1003210 3300003792 Bacteria 8028
37 Ga0055531_10000129 3300003794 Bacteria 85460
38 Ga0055531_10000640 3300003794 Bacteria 30187
39 Ga0055531_10030489 3300003794 Bacteria 1809
40 Ga0065165_1001477 3300005262 Bacteria 25096
41 Ga0065165_1032230 3300005262 Bacteria 1645
42 Ga0065704_10016101 3300005289 Bacteria 1316
43 Ga0065704_10024609 3300005289 Bacteria 1696
44 Ga0065704_10027091 3300005289 Bacteria 2399
45 Ga0065704_10070288 3300005289 Bacteria 39072
46 Ga0065704_10070363 3300005289 Bacteria 29943
47 Ga0065704_10081727 3300005289 Bacteria 3709
48 Ga0065704_10090763 3300005289 Bacteria 2765
49 Ga0065707_10004435 3300005295 Bacteria 6895
50 Ga0065707_10081814 3300005295 Bacteria 36963
51 Ga0065707_10091000 3300005295 Bacteria 4024
52 Ga0070658_10000678 3300005327 Bacteria 29438
53 Ga0070658_10007974 3300005327 Bacteria 8521
54 Ga0070676_10000947 3300005328 Bacteria 14413
55 Ga0070676_10264286 3300005328 Bacteria 1153
56 Ga0070683_100308388 3300005329 Bacteria 1506
57 Ga0070690_100000005 3300005330 Bacteria 142006
58 Ga0070690_100021439 3300005330 Bacteria 3945
59 Ga0070670_100000008 3300005331 Bacteria 292132
60 Ga0070670_100048027 3300005331 Bacteria 3674
61 Ga0068869_100036969 3300005334 Bacteria 3470
62 Ga0070666_10000021 3300005335 Bacteria 167450
63 Ga0070666_10271778 3300005335 Bacteria 1203
64 Ga0070680_100037860 3300005336 Bacteria 3899
65 Ga0068868_100008798 3300005338 Bacteria 7233
66 Ga0070660_100058904 3300005339 Bacteria 2977
67 Ga0070660_100238560 3300005339 Bacteria 1480
68 Ga0070661_100088897 3300005344 Bacteria 2287
69 Ga0070668_100000172 3300005347 Bacteria 41511
70 Ga0070668_100046209 3300005347 Bacteria 3342
71 Ga0070668_100069013 3300005347 Bacteria 2749
72 Ga0070668_100101697 3300005347 Bacteria 2278
73 Ga0070669_100000045 3300005353 Bacteria 119932
74 Ga0070669_100000357 3300005353 Bacteria 35454
75 Ga0070669_100000362 3300005353 Bacteria 35206
76 Ga0070669_100057186 3300005353 Bacteria 2861
77 Ga0070669_100091330 3300005353 Bacteria 2283
78 Ga0070669_100094664 3300005353 Bacteria 2245
79 Ga0070671_100001370 3300005355 Bacteria 18264
80 Ga0070671_100005700 3300005355 Bacteria 9923
81 Ga0070671_100058641 3300005355 Bacteria 3204
82 Ga0070671_100084707 3300005355 Bacteria 2651
83 Ga0070671_100182132 3300005355 Bacteria 1779
84 Ga0070671_100506634 3300005355 Bacteria 1038
85 Ga0070674_100031853 3300005356 Bacteria 3498
86 Ga0070674_100107308 3300005356 Bacteria 2044
87 Ga0070673_100000009 3300005364 Bacteria 155005
88 Ga0070659_100031293 3300005366 Bacteria 4121
89 Ga0070659_100093398 3300005366 Bacteria 2414
90 Ga0070659_100624851 3300005366 Bacteria 927
91 Ga0070667_100000199 3300005367 Bacteria 71115
92 Ga0070667_100000552 3300005367 Bacteria 37288
93 Ga0070667_100000635 3300005367 Bacteria 34114
94 Ga0070667_100004904 3300005367 Bacteria 11210
95 Ga0070705_100065893 3300005440 Bacteria 2170
96 Ga0070663_100016515 3300005455 Bacteria 4798
97 Ga0070663_100047309 3300005455 Bacteria 3047
98 Ga0070663_100053630 3300005455 Bacteria 2879
99 Ga0070681_10104220 3300005458 Bacteria 2779
100 Ga0068867_100000002 3300005459 Bacteria 247206
101 Ga0070685_10031457 3300005466 Bacteria 2965
102 Ga0070679_100008895 3300005530 Bacteria 9477
103 Ga0068853_100001276 3300005539 Bacteria 18049
104 Ga0068853_100079368 3300005539 Bacteria 2870
105 Ga0070686_100000001 3300005544 Bacteria 515830
106 Ga0070686_100349754 3300005544 Bacteria 1110
107 Ga0070665_100006376 3300005548 Bacteria 12025
108 Ga0070665_100053577 3300005548 Bacteria 4046
109 Ga0070665_100086809 3300005548 Bacteria 3134
110 Ga0070704_100074562 3300005549 Bacteria 2475
111 Ga0068855_100001880 3300005563 Bacteria 26079
112 Ga0068855_100033473 3300005563 Bacteria 6133
113 Ga0068855_100055513 3300005563 Bacteria 4652
114 Ga0068855_100071686 3300005563 Bacteria 4028
115 Ga0068855_100451480 3300005563 Bacteria 1403
116 Ga0070664_100080535 3300005564 Bacteria 2805
117 Ga0070664_100336447 3300005564 Bacteria 1370
118 Ga0068857_100300966 3300005577 Bacteria 1478
119 Ga0068857_100523521 3300005577 Bacteria 1115
120 Ga0068854_100006328 3300005578 Bacteria 7529
121 Ga0068854_100170689 3300005578 Bacteria 1692
122 Ga0068856_100175056 3300005614 Bacteria 2158
123 Ga0068856_100802469 3300005614 Bacteria 961
124 Ga0068852_100034855 3300005616 Bacteria 4192
125 Ga0068859_100217309 3300005617 Bacteria 1999
126 Ga0068859_100384209 3300005617 Bacteria 1499
127 Ga0068864_100000476 3300005618 Bacteria 34760
128 Ga0068864_100005296 3300005618 Bacteria 10556
129 Ga0068864_100037970 3300005618 Bacteria 4111
130 Ga0068864_100070930 3300005618 Bacteria 3033
131 Ga0068861_100001596 3300005719 Bacteria 14429
132 Ga0068861_100166470 3300005719 Bacteria 1823
133 Ga0068861_100430605 3300005719 Bacteria 1177
134 Ga0068851_10013340 3300005834 Bacteria 3890
135 Ga0068851_10180067 3300005834 Bacteria 1170
136 Ga0068863_100000029 3300005841 Bacteria 177191
137 Ga0068863_100000046 3300005841 Bacteria 143895
138 Ga0068863_100004290 3300005841 Bacteria 14042
139 Ga0068863_100042061 3300005841 Bacteria 4343
140 Ga0068863_100051764 3300005841 Bacteria 3891
141 Ga0068858_100019555 3300005842 Bacteria 6333
142 Ga0068858_100326910 3300005842 Bacteria 1466
143 Ga0068860_100000084 3300005843 Bacteria 167450
144 Ga0068860_100000288 3300005843 Bacteria 71737
145 Ga0068860_100013683 3300005843 Bacteria 7955
146 Ga0068860_100015185 3300005843 Bacteria 7522
147 Ga0068862_100001635 3300005844 Bacteria 20398
148 Ga0068862_100023508 3300005844 Bacteria 5165
149 Ga0068862_100189389 3300005844 Bacteria 1850
150 Ga0075368_10000225 3300006042 Bacteria 15895
151 Ga0075368_10000346 3300006042 Bacteria 13571
152 Ga0075368_10096929 3300006042 Bacteria 1209
153 Ga0075363_100074097 3300006048 Bacteria 1853
154 Ga0075364_10013544 3300006051 Bacteria 5018
155 Ga0075364_10227958 3300006051 Bacteria 1265
156 Ga0075362_10007630 3300006177 Bacteria 4108
157 Ga0075367_10001261 3300006178 Bacteria 10679
158 Ga0075367_10037372 3300006178 Bacteria 2821
159 Ga0075367_10045197 3300006178 Bacteria 2584
160 Ga0075369_10013681 3300006186 Bacteria 3227
161 Ga0075366_10083426 3300006195 Bacteria 1910
162 Ga0097621_100174042 3300006237 Bacteria 1857
163 Ga0075370_10002969 3300006353 Bacteria 7971
164 Ga0075370_10008165 3300006353 Bacteria 5373
165 Ga0075370_10151124 3300006353 Bacteria 1361
166 Ga0075430_100009875 3300006846 Bacteria 8072
167 Ga0068865_100000905 3300006881 Bacteria 16830
168 Ga0068865_100134524 3300006881 Bacteria 1856
169 Ga0068865_100161765 3300006881 Bacteria 1708
170 Ga0097620_100016987 3300006931 Bacteria 7305
171 Ga0097620_100217304 3300006931 Bacteria 1999
172 Ga0097620_100384209 3300006931 Bacteria 1499
173 Ga0079104_1027728 3300006946 Bacteria 1448
174 Ga0105251_10001436 3300009011 Bacteria 20478
175 Ga0105240_10000052 3300009093 Bacteria 232583
176 Ga0105240_10001171 3300009093 Bacteria 45972
177 Ga0105240_10016191 3300009093 Bacteria 10104
178 Ga0105240_10128111 3300009093 Bacteria 3047
179 Ga0105245_10162780 3300009098 Bacteria 2118
180 Ga0105247_10000842 3300009101 Bacteria 23321
181 Ga0105247_10034498 3300009101 Bacteria 3082
182 Ga0105243_10002796 3300009148 Bacteria 14485
183 Ga0105243_10036973 3300009148 Bacteria 3792
184 Ga0105241_10138735 3300009174 Bacteria 1977
185 Ga0105241_10242760 3300009174 Bacteria 1523
186 Ga0105242_10000742 3300009176 Bacteria 25399
187 Ga0105248_10002057 3300009177 Bacteria 22278
188 Ga0105248_10287345 3300009177 Bacteria 1852
189 Ga0105248_10344681 3300009177 Bacteria 1677
190 Ga0105237_10016895 3300009545 Bacteria 7572
191 Ga0105237_10020246 3300009545 Bacteria 6864
192 Ga0105237_10069377 3300009545 Bacteria 3520
193 Ga0105237_10072066 3300009545 Bacteria 3449
194 Ga0105237_10077788 3300009545 Bacteria 3307
195 Ga0105237_10122496 3300009545 Bacteria 2594
196 Ga0105237_10263128 3300009545 Bacteria 1727
197 Ga0105238_10188550 3300009551 Bacteria 2038
198 Ga0105238_10438722 3300009551 Bacteria 1302
199 Ga0105249_10000047 3300009553 Bacteria 176249
200 Ga0105249_10045356 3300009553 Bacteria 3998
201 Ga0105249_10199350 3300009553 Bacteria 1958
202 Ga0105249_10308035 3300009553 Bacteria 1591
203 Ga0105148_100009 3300009978 Bacteria 31431
204 Ga0105148_100052 3300009978 Bacteria 17846
205 Ga0105239_10005594 3300010375 Bacteria 14694
206 Ga0105239_10045376 3300010375 Bacteria 4816
207 Ga0105239_10115174 3300010375 Bacteria 2982
208 Ga0105239_10447254 3300010375 Bacteria 1465
209 Ga0105239_10677694 3300010375 Bacteria 1178
210 Ga0157326_1000840 3300012513 Bacteria 3556
211 Ga0157373_10029414 3300013100 Bacteria 3957
212 Ga0157371_10235102 3300013102 Bacteria 1317
213 Ga0157370_10272263 3300013104 Bacteria 1564
214 Ga0157369_10006710 3300013105 Bacteria 13284
215 Ga0157369_10081086 3300013105 Bacteria 3473
216 Ga0157369_10107360 3300013105 Bacteria 2970
217 Ga0157374_10241537 3300013296 Bacteria 1776
218 Ga0157374_10369448 3300013296 Bacteria 1427
219 Ga0157378_10000484 3300013297 Bacteria 37864
220 Ga0157378_10016172 3300013297 Bacteria 6533
221 Ga0157378_10232488 3300013297 Bacteria 1757
222 Ga0163162_10005403 3300013306 Bacteria 12343
223 Ga0163162_10031244 3300013306 Bacteria 5282
224 Ga0163162_10298101 3300013306 Bacteria 1744
225 Ga0157372_10125236 3300013307 Bacteria 2954
226 Ga0157375_10001290 3300013308 Bacteria 21614
227 Ga0163163_10004110 3300014325 Bacteria 12412
228 Ga0163163_10061962 3300014325 Bacteria 3706
229 Ga0163163_10146244 3300014325 Bacteria 2407
230 Ga0163163_10182414 3300014325 Bacteria 2146
231 Ga0157380_10000062 3300014326 Bacteria 61714
232 Ga0157380_10000995 3300014326 Bacteria 18016
233 Ga0157380_10002327 3300014326 Bacteria 12762
234 Ga0157380_10027469 3300014326 Bacteria 4329
235 Ga0157380_10433192 3300014326 Bacteria 1258
236 Ga0157379_10083461 3300014968 Bacteria 2864
237 Ga0157376_10000134 3300014969 Bacteria 51135
238 Ga0157376_10673620 3300014969 Bacteria 1037
239 Ga0163161_10001074 3300017792 Bacteria 20688
240 Ga0163161_10029919 3300017792 Bacteria 3872
241 Ga0209674_109404 3300025226 Bacteria 1091
242 Ga0209147_101472 3300025229 Bacteria 8441
243 Ga0207425_1000005 3300025245 Bacteria 900502
244 Ga0209148_1000147 3300025254 Bacteria 160231
245 Ga0209129_1002457 3300025258 Bacteria 9079
246 Ga0209565_1000231 3300025263 Bacteria 61384
247 Ga0209455_1011583 3300025272 Bacteria 2162
248 Ga0209675_1000089 3300025291 Bacteria 146897
249 Ga0209676_1000212 3300025292 Bacteria 128606
250 Ga0209676_1013374 3300025292 Bacteria 3159
251 Ga0209025_1000515 3300025294 Bacteria 73801
252 Ga0209564_1000164 3300025295 Bacteria 160675
253 Ga0209564_1000619 3300025295 Bacteria 54397
254 Ga0209564_1026360 3300025295 Bacteria 1923
255 Ga0209758_1000002 3300025297 Bacteria 1400310
256 Ga0209050_1000001 3300025298 Bacteria 3563507
257 Ga0209050_1000010 3300025298 Bacteria 980454
258 Ga0209050_1000068 3300025298 Bacteria 298849
259 Ga0209050_1000483 3300025298 Bacteria 69796
260 Ga0209051_1000817 3300025303 Bacteria 32251
261 Ga0209257_1000027 3300025304 Bacteria 703541
262 Ga0209257_1000193 3300025304 Bacteria 151777
263 Ga0209257_1005709 3300025304 Bacteria 8543
264 Ga0209257_1005767 3300025304 Bacteria 8454
265 Ga0209257_1008265 3300025304 Bacteria 5979
266 Ga0207697_10104306 3300025315 Bacteria 1211
267 Ga0207656_10037846 3300025321 Bacteria 2032
268 Ga0207656_10129298 3300025321 Bacteria 1182
269 Ga0207696_1005813 3300025711 Bacteria 5065
270 Ga0207713_1000601 3300025735 Bacteria 35469
271 Ga0207713_1025852 3300025735 Bacteria 2702
272 Ga0207713_1104579 3300025735 Bacteria 971
273 Ga0207710_10002403 3300025900 Bacteria 8733
274 Ga0207710_10087567 3300025900 Bacteria 1453
275 Ga0207680_10000008 3300025903 Bacteria 518177
276 Ga0207680_10013563 3300025903 Bacteria 4191
277 Ga0207680_10034005 3300025903 Bacteria 2913
278 Ga0207680_10099163 3300025903 Bacteria 1869
279 Ga0207647_10000952 3300025904 Bacteria 22408
280 Ga0207647_10050376 3300025904 Bacteria 2579
281 Ga0207645_10004724 3300025907 Bacteria 10024
282 Ga0207643_10059265 3300025908 Bacteria 2184
283 Ga0207705_10000432 3300025909 Bacteria 36515
284 Ga0207705_10038693 3300025909 Bacteria 3416
285 Ga0207705_10178134 3300025909 Bacteria 1603
286 Ga0207654_10000698 3300025911 Bacteria 18736
287 Ga0207654_10076219 3300025911 Bacteria 2006
288 Ga0207654_10118246 3300025911 Bacteria 1660
289 Ga0207695_10000122 3300025913 Bacteria 232677
290 Ga0207695_10002374 3300025913 Bacteria 27948
291 Ga0207695_10002631 3300025913 Bacteria 26270
292 Ga0207695_10003217 3300025913 Bacteria 23248
293 Ga0207695_10008302 3300025913 Bacteria 13012
294 Ga0207695_10043228 3300025913 Bacteria 4803
295 Ga0207695_10100988 3300025913 Bacteria 2880
296 Ga0207671_10002254 3300025914 Bacteria 20881
297 Ga0207671_10140602 3300025914 Bacteria 1860
298 Ga0207657_10046566 3300025919 Bacteria 3798
299 Ga0207657_10048987 3300025919 Bacteria 3685
300 Ga0207657_10097168 3300025919 Bacteria 2449
301 Ga0207652_10038327 3300025921 Bacteria 4062
302 Ga0207681_10000022 3300025923 Bacteria 230079
303 Ga0207681_10000321 3300025923 Bacteria 34677
304 Ga0207681_10055994 3300025923 Bacteria 2688
305 Ga0207681_10082706 3300025923 Bacteria 2270
306 Ga0207681_10087461 3300025923 Bacteria 2217
307 Ga0207694_10001423 3300025924 Bacteria 20509
308 Ga0207694_10206858 3300025924 Bacteria 1598
309 Ga0207694_10376114 3300025924 Bacteria 1178
310 Ga0207650_10000019 3300025925 Bacteria 344751
311 Ga0207650_10000020 3300025925 Bacteria 342596
312 Ga0207650_10122540 3300025925 Bacteria 2026
313 Ga0207650_10232956 3300025925 Bacteria 1486
314 Ga0207650_10296167 3300025925 Bacteria 1320
315 Ga0207650_10578492 3300025925 Bacteria 943
316 Ga0207687_10484789 3300025927 Bacteria 1030
317 Ga0207644_10000318 3300025931 Bacteria 31448
318 Ga0207644_10003990 3300025931 Bacteria 9585
319 Ga0207644_10007674 3300025931 Bacteria 7036
320 Ga0207644_10039068 3300025931 Bacteria 3348
321 Ga0207644_10165761 3300025931 Bacteria 1721
322 Ga0207644_10176310 3300025931 Bacteria 1673
323 Ga0207644_10336098 3300025931 Bacteria 1224
324 Ga0207706_10005149 3300025933 Bacteria 12202
325 Ga0207706_10022957 3300025933 Bacteria 5602
326 Ga0207706_10239128 3300025933 Bacteria 1587
327 Ga0207686_10021120 3300025934 Bacteria 3731
328 Ga0207686_10095554 3300025934 Bacteria 1972
329 Ga0207709_10000066 3300025935 Bacteria 189194
330 Ga0207670_10001974 3300025936 Bacteria 10750
331 Ga0207669_10126409 3300025937 Bacteria 1747
332 Ga0207704_10000002 3300025938 Bacteria 303025
333 Ga0207704_10000007 3300025938 Bacteria 211230
334 Ga0207704_10082966 3300025938 Bacteria 2078
335 Ga0207704_10273171 3300025938 Bacteria 1281
336 Ga0207711_10000838 3300025941 Bacteria 29705
337 Ga0207711_10000889 3300025941 Bacteria 28799
338 Ga0207711_10020165 3300025941 Bacteria 5555
339 Ga0207711_10057297 3300025941 Bacteria 3350
340 Ga0207711_10193183 3300025941 Bacteria 1856
341 Ga0207689_10097142 3300025942 Bacteria 2419
342 Ga0207689_10125075 3300025942 Bacteria 2115
343 Ga0207667_10000343 3300025949 Bacteria 63689
344 Ga0207667_10003138 3300025949 Bacteria 20458
345 Ga0207667_10016393 3300025949 Bacteria 8375
346 Ga0207667_10019137 3300025949 Bacteria 7657
347 Ga0207667_10138056 3300025949 Bacteria 2510
348 Ga0207651_10000004 3300025960 Bacteria 290191
349 Ga0207712_10000009 3300025961 Bacteria 518177
350 Ga0207712_10000508 3300025961 Bacteria 32312
351 Ga0207712_10598853 3300025961 Bacteria 953
352 Ga0207668_10000313 3300025972 Bacteria 31786
353 Ga0207668_10010339 3300025972 Bacteria 5637
354 Ga0207668_10014571 3300025972 Bacteria 4866
355 Ga0207668_10033540 3300025972 Bacteria 3401
356 Ga0207668_10041609 3300025972 Bacteria 3108
357 Ga0207668_10043901 3300025972 Bacteria 3037
358 Ga0207668_10051540 3300025972 Bacteria 2843
359 Ga0207668_10343950 3300025972 Bacteria 1245
360 Ga0207640_10009834 3300025981 Bacteria 5365
361 Ga0207640_10068894 3300025981 Bacteria 2373
362 Ga0207658_10000159 3300025986 Bacteria 71280
363 Ga0207658_10000332 3300025986 Bacteria 47441
364 Ga0207658_10001467 3300025986 Bacteria 18396
365 Ga0207658_10002324 3300025986 Bacteria 13966
366 Ga0207658_10023400 3300025986 Bacteria 4311
367 Ga0207658_10085721 3300025986 Bacteria 2427
368 Ga0207677_10000060 3300026023 Bacteria 93186
369 Ga0207703_10071066 3300026035 Bacteria 2874
370 Ga0207703_10124791 3300026035 Bacteria 2215
371 Ga0207639_10004001 3300026041 Bacteria 9953
372 Ga0207639_10124821 3300026041 Bacteria 2121
373 Ga0207678_10002216 3300026067 Bacteria 17553
374 Ga0207678_10004471 3300026067 Bacteria 12567
375 Ga0207678_10005410 3300026067 Bacteria 11434
376 Ga0207702_10001800 3300026078 Bacteria 21115
377 Ga0207702_10012724 3300026078 Bacteria 7002
378 Ga0207641_10000049 3300026088 Bacteria 177222
379 Ga0207641_10000517 3300026088 Bacteria 43309
380 Ga0207641_10001931 3300026088 Bacteria 19887
381 Ga0207641_10003674 3300026088 Bacteria 13511
382 Ga0207641_10027854 3300026088 Bacteria 4667
383 Ga0207641_10157734 3300026088 Bacteria 2060
384 Ga0207648_10000003 3300026089 Bacteria 289983
385 Ga0207676_10000022 3300026095 Bacteria 296286
386 Ga0207676_10001436 3300026095 Bacteria 17716
387 Ga0207676_10135394 3300026095 Bacteria 2101
388 Ga0207676_10257235 3300026095 Bacteria 1574
389 Ga0207674_10025551 3300026116 Bacteria 6294
390 Ga0207674_10056234 3300026116 Bacteria 3997
391 Ga0207674_10057470 3300026116 Bacteria 3944
392 Ga0207674_10204851 3300026116 Bacteria 1922
393 Ga0207675_100000841 3300026118 Bacteria 30545
394 Ga0207675_100013085 3300026118 Bacteria 7744
395 Ga0207675_100215995 3300026118 Bacteria 1846
396 Ga0207675_100630334 3300026118 Bacteria 1077
397 Ga0207683_10053530 3300026121 Bacteria 3539
398 Ga0207698_10032795 3300026142 Bacteria 3767
399 Ga0207698_10061912 3300026142 Bacteria 2919
400 Ga0207698_10105310 3300026142 Bacteria 2350
401 Ga0209281_1025812 3300027111 Bacteria 1091
402 Ga0209813_10000180 3300027866 Bacteria 20487
403 Ga0209813_10000872 3300027866 Bacteria 6798
404 Ga0268266_10000341 3300028379 Bacteria 72917
405 Ga0268266_10054982 3300028379 Bacteria 3421
406 Ga0268266_10092933 3300028379 Bacteria 2647
407 Ga0268266_10210882 3300028379 Bacteria 1781
408 Ga0268265_10001114 3300028380 Bacteria 23815
409 Ga0268265_10003238 3300028380 Bacteria 11825
410 Ga0268265_10005512 3300028380 Bacteria 8637
411 Ga0268265_10040218 3300028380 Bacteria 3452
412 Ga0268265_10089087 3300028380 Bacteria 2460
413 Ga0268265_10152606 3300028380 Bacteria 1950
414 Ga0268264_10000003 3300028381 Bacteria 1141976
415 Ga0268264_10000342 3300028381 Bacteria 71753
416 Ga0268264_10006007 3300028381 Bacteria 10275
417 Ga0268264_10006643 3300028381 Bacteria 9728
418 Ga0268264_10011266 3300028381 Bacteria 7389
419 Ga0268264_10062999 3300028381 Bacteria 3116
420 Ga0307515_10001181 3300028794 Bacteria 59747
421 Ga0307515_10133963 3300028794 Bacteria 2708
422 Ga0265327_10000275 3300031251 Bacteria 101668
423 Ga0265316_10229308 3300031344 Bacteria 1368
424 Ga0307516_10000051 3300031730 Bacteria 129126
425 Ga0307405_10068585 3300031731 Bacteria 2270
426 Ga0307410_10061941 3300031852 Bacteria 2561
427 Ga0307410_10507802 3300031852 Bacteria 993
428 Ga0307412_10000515 3300031911 Bacteria 23070
429 Ga0307412_10014120 3300031911 Bacteria 4703
430 Ga0307412_10029669 3300031911 Bacteria 3435
431 Ga0307412_10039260 3300031911 Bacteria 3055
432 Ga0307416_100171098 3300032002 Bacteria 2022
433 Ga0307416_100438077 3300032002 Bacteria 1356
434 Ga0307414_10000328 3300032004 Bacteria 27172
435 Ga0307411_10055828 3300032005 Bacteria 2600
436 Ga0307411_10084352 3300032005 Bacteria 2197
437 Ga0373932_0025429 3300035112 Bacteria 1603
438 Ga0395900_0343419 3300037418 Bacteria 1468
439 Ga0395898_0235205 3300037466 Bacteria 1747
440 Ga0395905_0400057 3300037471 Bacteria 1268
441 Ga0395901_0043629 3300038443 Bacteria 4651
442 Ga0237819_00134 3300038705 Bacteria 27766
443 Ga0436362_1026846 3300039453 Bacteria 1359
444 Ga0439436_0018614 3300041404 Bacteria 2076
445 Ga0439461_0011817 3300041410 Bacteria 1625
446 Ga0439465_0010873 3300041413 Bacteria 2855
447 Ga0451802_0643022 3300041460 Bacteria 3891
448 Ga0439431_0035978 3300041997 Bacteria 1245
449 Ga0439432_021508 3300042006 Bacteria 2137
450 Ga0439457_007618 3300042014 Bacteria 2593
451 Ga0466964_0028108 3300044706 Bacteria 2213
452 Ga0466968_0006657 3300044735 Bacteria 4364
453 Ga0495627_000113 3300046453 Bacteria 100542
454 Ga0495638_0000012 3300046460 Bacteria 435577
455 Ga0495638_0000123 3300046460 Bacteria 125420
456 Ga0495650_0000093 3300046471 Bacteria 221558
457 Ga0495650_0001327 3300046471 Bacteria 24827
458 Ga0495650_0069138 3300046471 Bacteria 1391
459 Ga0495584_0020356 3300046491 Bacteria 3372
460 Ga0495583_0000474 3300046506 Bacteria 58751
461 Ga0495583_0001160 3300046506 Bacteria 28668
462 Ga0495606_0000272 3300046507 Bacteria 90684
463 Ga0495606_0000382 3300046507 Bacteria 75382
464 Ga0495606_0000443 3300046507 Bacteria 67796
465 Ga0495606_0002643 3300046507 Bacteria 20453
466 Ga0495606_0046954 3300046507 Bacteria 2850
467 Ga0495610_0001282 3300046512 Bacteria 22474
468 Ga0495610_0008306 3300046512 Bacteria 6741
469 Ga0495616_0000176 3300046513 Bacteria 54755
470 Ga0495616_0062116 3300046513 Bacteria 1830
471 Ga0495616_0131471 3300046513 Bacteria 1147
472 Ga0495620_0018265 3300046515 Bacteria 3475
473 Ga0495631_0004640 3300046518 Bacteria 7271
474 Ga0495632_0000001 3300046519 Bacteria 873295
475 Ga0495632_0000773 3300046519 Bacteria 28703
476 Ga0495637_0000809 3300046520 Bacteria 20718
477 Ga0495637_0013583 3300046520 Bacteria 3862
478 Ga0495637_0056792 3300046520 Unclassified 1619
479 Ga0495643_0000006 3300046522 Bacteria 419524
480 Ga0495643_0011649 3300046522 Bacteria 5343
481 Ga0495643_0062648 3300046522 Bacteria 1968
482 Ga0495648_0000295 3300046524 Bacteria 55574
483 Ga0495648_0001990 3300046524 Bacteria 19425
484 Ga0495648_0041808 3300046524 Bacteria 2891
485 Ga0495663_0000002 3300046525 Bacteria 495384
486 Ga0495642_0005393 3300046528 Bacteria 4908
487 Ga0495654_0001238 3300046530 Bacteria 18023
488 Ga0495587_0078108 3300046536 Bacteria 1921
489 Ga0495609_0036465 3300046538 Bacteria 2220
490 Ga0495609_0041526 3300046538 Bacteria 2067
491 Ga0495597_0005293 3300046542 Bacteria 6852
492 Ga0495597_0029662 3300046542 Bacteria 2497
493 Ga0495622_0002978 3300046557 Bacteria 8051
494 Ga0495622_0020902 3300046557 Bacteria 3048
495 Ga0495633_0000053 3300046558 Bacteria 152374
496 Ga0495633_0000160 3300046558 Bacteria 88116
497 Ga0495633_0001046 3300046558 Bacteria 22624
498 Ga0495633_0005525 3300046558 Bacteria 7696
499 Ga0495668_0002823 3300046616 Bacteria 13813
500 Ga0495668_0013682 3300046616 Bacteria 4776
501 Ga0495668_0027073 3300046616 Bacteria 3249
502 Ga0495668_0042439 3300046616 Bacteria 2532
503 Ga0495668_0200403 3300046616 Bacteria 1093
504 Ga0495634_0115611 3300046642 Bacteria 1722
505 Ga0495625_0006257 3300046660 Bacteria 10656
506 Ga0495625_0178507 3300046660 Bacteria 1414
507 Ga0495625_0183568 3300046660 Bacteria 1389
508 Ga0495588_0213298 3300046674 Bacteria 1019
509 Ga0495599_0047019 3300046678 Bacteria 2705
510 Ga0495646_0168617 3300046680 Bacteria 1208
511 Ga0495669_0000639 3300046684 Bacteria 15243
512 Ga0495669_0024103 3300046684 Bacteria 2652
513 Ga0495613_0204739 3300046689 Bacteria 1390
514 Ga0495670_0000036 3300046691 Bacteria 78512
515 Ga0495670_0020373 3300046691 Bacteria 3270
516 Ga0495670_0021440 3300046691 Bacteria 3186
517 Ga0495670_0025856 3300046691 Bacteria 2905
518 Ga0495671_0000008 3300046692 Bacteria 419524
519 Ga0495671_0000111 3300046692 Bacteria 72744
520 Ga0495600_0033760 3300046809 Bacteria 3321
521 Ga0495660_0032948 3300046810 Bacteria 2908
522 Ga0495687_000084 3300047443 Bacteria 145072
523 Ga0495687_052898 3300047443 Bacteria 1714
524 Ga0495673_0000013 3300047469 Bacteria 612902
525 Ga0495673_0007717 3300047469 Bacteria 6144
526 Ga0495681_0000058 3300047470 Bacteria 103041
527 Ga0495681_0002650 3300047470 Bacteria 12688
528 Ga0495686_0000433 3300047472 Bacteria 64805
529 Ga0495686_0002518 3300047472 Bacteria 17169
530 Ga0495686_0010639 3300047472 Bacteria 6533
531 Ga0495686_0045272 3300047472 Bacteria 2784
532 Ga0495686_0047711 3300047472 Bacteria 2703
533 Ga0496100_0147609 3300048903 Bacteria 1674
534 Ga0496101_0351262 3300048904 Bacteria 1159
535 Ga0496101_0363113 3300048904 Bacteria 1138
536 Ga0496102_0000106 3300048905 Bacteria 118841
537 Ga0496102_0000143 3300048905 Bacteria 96813
538 Ga0496102_0508198 3300048905 Bacteria 1127
539 Ga0496103_0000095 3300048906 Bacteria 98260
540 Ga0496103_0000098 3300048906 Bacteria 96109
541 Ga0496103_0000924 3300048906 Bacteria 21086
542 Ga0496103_0015455 3300048906 Bacteria 4542
543 Ga0496104_0019175 3300048907 Bacteria 6253
544 Ga0496104_0129301 3300048907 Bacteria 2426
545 Ga0496104_0152808 3300048907 Bacteria 2215
546 Ga0496105_0189572 3300048908 Bacteria 1682
547 Ga0496105_0381490 3300048908 Bacteria 1121
548 Ga0496106_0013364 3300048909 Bacteria 6061
549 Ga0496106_0091425 3300048909 Bacteria 2350
550 Ga0496106_0097613 3300048909 Bacteria 2275
551 Ga0496108_0006555 3300048911 Bacteria 9443
552 Ga0496109_0023726 3300048912 Bacteria 5445
553 Ga0496110_0070177 3300048913 Bacteria 3104
554 Ga0496110_0130597 3300048913 Bacteria 2268
555 Ga0496111_0226626 3300048914 Bacteria 1388
556 Ga0496112_0002555 3300048915 Bacteria 14702
557 Ga0496112_0004022 3300048915 Bacteria 12332
558 Ga0496113_0000022 3300048916 Bacteria 68269
559 Ga0496113_0023762 3300048916 Bacteria 4349
560 Ga0496113_0107503 3300048916 Bacteria 2168
561 Ga0496113_0361267 3300048916 Bacteria 1165
562 Ga0496114_0082909 3300048917 Bacteria 2711
563 Ga0496115_0069307 3300048918 Bacteria 2856
564 Ga0496116_0001473 3300048919 Bacteria 26338
565 Ga0496116_0052511 3300048919 Bacteria 2700
566 Ga0496116_0066591 3300048919 Bacteria 2304
567 Ga0496117_0000121 3300048920 Bacteria 171532
568 Ga0496117_0002347 3300048920 Bacteria 24194
569 Ga0496117_0004218 3300048920 Bacteria 16055
570 Ga0496117_0013111 3300048920 Bacteria 7255
571 Ga0496117_0034039 3300048920 Bacteria 3845
572 Ga0496118_0000095 3300048921 Bacteria 164850
573 Ga0496118_0002332 3300048921 Bacteria 25731
574 Ga0496118_0004877 3300048921 Bacteria 15615
575 Ga0496118_0004878 3300048921 Bacteria 15615
576 Ga0496118_0029869 3300048921 Bacteria 4562
577 Ga0496118_0064346 3300048921 Bacteria 2692
578 Ga0496118_0118962 3300048921 Bacteria 1728
579 Ga0496118_0124746 3300048921 Bacteria 1669
580 Ga0496118_0143926 3300048921 Bacteria 1505
581 Ga0496119_0001217 3300048922 Bacteria 32132
582 Ga0496119_0014522 3300048922 Bacteria 6153
583 Ga0496119_0026090 3300048922 Bacteria 4061
584 Ga0496119_0042198 3300048922 Bacteria 2896
585 Ga0496119_0141446 3300048922 Bacteria 1299
586 Ga0496120_0029409 3300048923 Bacteria 3354
587 Ga0496121_0000272 3300048924 Bacteria 108051
588 Ga0496121_0004371 3300048924 Bacteria 19103
589 Ga0496121_0004952 3300048924 Bacteria 17471
590 Ga0496121_0028429 3300048924 Bacteria 5203
591 Ga0496121_0029618 3300048924 Bacteria 5055
592 Ga0496121_0029998 3300048924 Bacteria 5006
593 Ga0496122_0054539 3300048925 Bacteria 3001
594 Ga0496122_0065917 3300048925 Bacteria 2621
595 Ga0496122_0121086 3300048925 Bacteria 1687
596 Ga0496122_0189059 3300048925 Bacteria 1218
597 Ga0496123_0010012 3300048926 Bacteria 8446
598 Ga0496123_0025209 3300048926 Bacteria 4490
599 Ga0496123_0058779 3300048926 Bacteria 2491
600 Ga0496123_0091348 3300048926 Bacteria 1806
601 Ga0496123_0151834 3300048926 Bacteria 1248
602 Ga0496123_0169219 3300048926 Bacteria 1155
603 Ga0496124_0000119 3300048927 Bacteria 163996
604 Ga0496124_0000417 3300048927 Bacteria 76104
605 Ga0496124_0005450 3300048927 Bacteria 14302
606 Ga0496124_0113541 3300048927 Bacteria 2176
607 Ga0496124_0117893 3300048927 Bacteria 2126
608 Ga0496125_0000953 3300048928 Bacteria 45480
609 Ga0496125_0002341 3300048928 Bacteria 24847
610 Ga0496125_0012810 3300048928 Bacteria 8291
611 Ga0496125_0064504 3300048928 Bacteria 2910
612 Ga0496125_0076259 3300048928 Bacteria 2589
613 Ga0496126_0009286 3300048929 Bacteria 10475
614 Ga0496126_0042375 3300048929 Bacteria 4204
615 Ga0496126_0059050 3300048929 Bacteria 3455
616 Ga0496126_0310704 3300048929 Bacteria 1298
617 Ga0495678_069590 3300049459 Bacteria 1294
618 Ga0495682_0006896 3300049460 Bacteria 4564
619 Ga0501335_003397 3300049551 Bacteria 1347
620 Ga0501034_0061308 3300049571 Bacteria 3777
621 Ga0501070_0413397 3300049586 Bacteria 1090
622 Ga0501198_011888 3300049649 Bacteria 1304
623 Ga0501211_001542 3300049658 Bacteria 2468
624 Ga0501223_000006 3300049663 Bacteria 133378
625 Ga0501223_000100 3300049663 Bacteria 24668
626 Ga0501224_000002 3300049664 Bacteria 229331
627 Ga0501233_000375 3300049668 Bacteria 7069
628 Ga0501235_000453 3300049669 Bacteria 8013
629 Ga0501235_000617 3300049669 Bacteria 7167
630 Ga0501246_000655 3300049676 Bacteria 2532
631 Ga0501249_000095 3300049679 Bacteria 27655
632 Ga0501225_0000032 3300049705 Bacteria 47166
633 Ga0501225_0000120 3300049705 Bacteria 24331
634 Ga0501225_0001607 3300049705 Bacteria 7065
635 Ga0501225_0030924 3300049705 Bacteria 1473
636 Ga0501234_000367 3300049707 Bacteria 6686
637 Ga0501204_002066 3300049850 Bacteria 2021
638 Ga0501226_000089 3300049853 Bacteria 25215
639 nmdc:mga03683_1401_c1 3300050489 Bacteria 7178
640 nmdc:mga03n38_3421_c1 3300050490 Bacteria 5094
641 nmdc:mga00v17_59624_c1 3300050491 Bacteria 2342
642 nmdc:mga00v17_9340_c1 3300050491 Bacteria 5302
643 nmdc:mga0yw44_5062_c1 3300050492 Bacteria 4537
644 nmdc:mga0yw44_76938_c1 3300050492 Bacteria 2084
645 nmdc:mga06z11_100_c1 3300050494 Bacteria 36184
646 nmdc:mga06z11_108_c1 3300050494 Bacteria 33977
647 nmdc:mga04h51_11_c1 3300050495 Bacteria 101578
648 nmdc:mga04h51_181_c1 3300050495 Bacteria 17738
649 nmdc:mga07m45_114364_c1 3300050496 Bacteria 1556
650 nmdc:mga07m45_15_c1 3300050496 Bacteria 152740
651 nmdc:mga07m45_31802_c1 3300050496 Bacteria 2924
652 nmdc:mga07m45_4041_c1 3300050496 Bacteria 7146
653 nmdc:mga07m45_40709_c1 3300050496 Bacteria 2600
654 nmdc:mga0qj67_27752_c1 3300050509 Bacteria 4390
655 nmdc:mga0sz30_109_c1 3300050516 Bacteria 31084
656 nmdc:mga0sz30_36836_c1 3300050516 Bacteria 2046
657 Ga0500578_0020670 3300053086 Bacteria 4232
658 Ga0500651_0039143 3300053093 Bacteria 2986
659 Ga0500651_0163430 3300053093 Bacteria 1330
660 Ga0500566_0007265 3300053094 Bacteria 6565
661 Ga0500566_0014559 3300053094 Bacteria 4622
662 Ga0500566_0059490 3300053094 Bacteria 2166
663 Ga0500650_0006230 3300053098 Bacteria 4533
664 Ga0500555_000477 3300053103 Bacteria 16617
665 Ga0500555_064078 3300053103 Bacteria 982
666 Ga0500556_0000024 3300053104 Bacteria 167556
667 Ga0500569_013432 3300053109 Bacteria 2004
668 Ga0500595_005233 3300053119 Bacteria 5685
669 Ga0500607_000065 3300053121 Bacteria 74437
670 Ga0500607_000168 3300053121 Bacteria 57382
671 Ga0500607_030204 3300053121 Bacteria 2989
672 Ga0500608_025822 3300053122 Bacteria 2753
673 Ga0500618_000092 3300053125 Bacteria 73216
674 Ga0500618_004379 3300053125 Bacteria 4538
675 Ga0500618_014931 3300053125 Bacteria 1973
676 Ga0500618_035729 3300053125 Bacteria 1153
677 Ga0500642_0000035 3300053130 Bacteria 106656
678 Ga0500642_0001609 3300053130 Bacteria 6511
679 Ga0500652_000134 3300053131 Bacteria 27819
680 Ga0500655_000399 3300053133 Bacteria 9184
681 Ga0500658_0000598 3300053134 Bacteria 14978
682 Ga0500559_0000668 3300053136 Bacteria 22938
683 Ga0500559_0001329 3300053136 Bacteria 14235
684 Ga0500559_0002950 3300053136 Bacteria 8556
685 Ga0500559_0030167 3300053136 Bacteria 2324
686 Ga0500559_0049447 3300053136 Bacteria 1852
687 Ga0500559_0068225 3300053136 Bacteria 1597
688 Ga0500568_0003427 3300053139 Bacteria 8842
689 Ga0500568_0015006 3300053139 Plasmid 3477
690 Ga0500568_0033607 3300053139 Bacteria 2104
691 Ga0500568_0066066 3300053139 Bacteria 1391
692 Ga0500577_0000483 3300053142 Bacteria 10273
693 Ga0500577_0004181 3300053142 Bacteria 3797
694 Ga0500590_043419 3300053148 Bacteria 2306
695 Ga0500590_062176 3300053148 Bacteria 1874
696 Ga0500604_0006540 3300053151 Bacteria 3082
697 Ga0500604_0035841 3300053151 Bacteria 1477
698 Ga0500604_0087397 3300053151 Bacteria 1014
699 Ga0500616_0000122 3300053153 Bacteria 140228
700 Ga0500622_0001122 3300053156 Bacteria 22313
701 Ga0500622_0001260 3300053156 Bacteria 20664
702 Ga0500622_0004003 3300053156 Bacteria 9497
703 Ga0500622_0020907 3300053156 Bacteria 3473
704 Ga0500624_000018 3300053157 Bacteria 131677
705 Ga0500624_000182 3300053157 Bacteria 24939
706 Ga0500624_000205 3300053157 Bacteria 22830
707 Ga0500627_0000687 3300053158 Bacteria 8973
708 Ga0500627_0003265 3300053158 Bacteria 4989
709 Ga0500633_0001786 3300053160 Bacteria 4207
710 Ga0500634_0076613 3300053161 Bacteria 1735
711 Ga0500636_0009686 3300053177 Bacteria 5608
712 Ga0500636_0051013 3300053177 Bacteria 2432
713 Ga0500637_0020659 3300053178 Bacteria 3569
714 Ga0500637_0044358 3300053178 Bacteria 2519
715 Ga0500567_002415 3300053723 Bacteria 8001
716 Ga0500570_000052 3300053724 Bacteria 28845
717 Ga0500625_000009 3300053729 Bacteria 159296
718 Ga0500645_006451 3300053730 Bacteria 4186
719 Ga0500645_007832 3300053730 Bacteria 3693
720 Ga0500661_015067 3300055283 Bacteria 1388
721 2512644270 2512564014 Bacteria 4639632
722 2603861073 2602042107 Bacteria 6226103
723 2644036830 2643221605 Bacteria 4772303
724 2739650098 2739367664 Bacteria 4114334
725 2740028571 2739367865 Bacteria 4114482
726 2753766278 2751185897 Bacteria 5322941
727 2778126989 2775507255 Bacteria 3945731
728 2809078669 2808606404 Bacteria 4652788
729 2809083036 2808606405 Bacteria 4586632
730 2857528800 2857524615 Bacteria 6615449
731 2880521547 2880518877 Bacteria 5012590
732 2893068994 2893066018 Bacteria 6158120
733 2919079227 2919073203 Bacteria 6531949
734 2919140998 2919138771 Bacteria 5281312
735 2919711065 2919709256 Bacteria 4318106
736 2929200432 2929199973 Bacteria 7260745
737 8055914748 8055909800 Bacteria 7278581
738 Ga0500597_034210
739 SwRhRL2b_contig_1233908
740 SwRhRL2b_contig_3308639
741 JGI24736J21556_1000004
742 JGI24736J21556_1000158
743 JGI24741J21665_1000027
744 JGI24740J21852_10005199
745 JGI24740J21852_10009996
746 JGI24739J22299_10006854
747 JGI24739J22299_10018201
748 JGI24737J22298_10003710
749 JGI24737J22298_10005046
750 JGI24737J22298_10009302
751 JGI24743J22301_10006315
752 JGI24735J21928_10002350
753 JGI24735J21928_10005878
754 JGI24750J21931_1000060
755 JGI24748J21848_1000083
756 JGI24738J21930_10000860
757 JGI24738J21930_10028035
758 JGI24749J21850_1000053
759 JGI24749J21850_1000625
760 JGI24744J21845_10014295
761 JGI24034J26672_10000021
762 JGI24742J22300_10005615
763 JGI24751J29686_10000172
764 JGI24751J29686_10003922
765 JGI25150J39212_1000313
766 JGI25153J46596_10000027
767 Ga0055542_1005309
768 Ga0055526_1006101
769 Ga0055536_1000580
770 Ga0055530_10000017
771 Ga0055530_10000638
772 Ga0055530_10013388
773 Ga0055540_1003210
774 Ga0055531_10000129
775 Ga0055531_10000640
776 Ga0055531_10030489
777 Ga0065165_1001477
778 Ga0065165_1032230
779 Ga0065704_10016101
780 Ga0065704_10024609
781 Ga0065704_10027091
782 Ga0065704_10070288
783 Ga0065704_10070363
784 Ga0065704_10081727
785 Ga0065704_10090763
786 Ga0065707_10004435
787 Ga0065707_10081814
788 Ga0065707_10091000
789 Ga0070658_10000678
790 Ga0070658_10007974
791 Ga0070676_10000947
792 Ga0070676_10264286
793 Ga0070683_100308388
794 Ga0070690_100000005
795 Ga0070690_100021439
796 Ga0070670_100000008
797 Ga0070670_100048027
798 Ga0068869_100036969
799 Ga0070666_10000021
800 Ga0070666_10271778
801 Ga0070680_100037860
802 Ga0068868_100008798
803 Ga0070660_100058904
804 Ga0070660_100238560
805 Ga0070661_100088897
806 Ga0070668_100000172
807 Ga0070668_100046209
808 Ga0070668_100069013
809 Ga0070668_100101697
810 Ga0070669_100000045
811 Ga0070669_100000357
812 Ga0070669_100000362
813 Ga0070669_100057186
814 Ga0070669_100091330
815 Ga0070669_100094664
816 Ga0070671_100001370
817 Ga0070671_100005700
818 Ga0070671_100058641
819 Ga0070671_100084707
820 Ga0070671_100182132
821 Ga0070671_100506634
822 Ga0070674_100031853
823 Ga0070674_100107308
824 Ga0070673_100000009
825 Ga0070659_100031293
826 Ga0070659_100093398
827 Ga0070659_100624851
828 Ga0070667_100000199
829 Ga0070667_100000552
830 Ga0070667_100000635
831 Ga0070667_100004904
832 Ga0070705_100065893
833 Ga0070663_100016515
834 Ga0070663_100047309
835 Ga0070663_100053630
836 Ga0070681_10104220
837 Ga0068867_100000002
838 Ga0070685_10031457
839 Ga0070679_100008895
840 Ga0068853_100001276
841 Ga0068853_100079368
842 Ga0070686_100000001
843 Ga0070686_100349754
844 Ga0070665_100006376
845 Ga0070665_100053577
846 Ga0070665_100086809
847 Ga0070704_100074562
848 Ga0068855_100001880
849 Ga0068855_100033473
850 Ga0068855_100055513
851 Ga0068855_100071686
852 Ga0068855_100451480
853 Ga0070664_100080535
854 Ga0070664_100336447
855 Ga0068857_100300966
856 Ga0068857_100523521
857 Ga0068854_100006328
858 Ga0068854_100170689
859 Ga0068856_100175056
860 Ga0068856_100802469
861 Ga0068852_100034855
862 Ga0068859_100217309
863 Ga0068859_100384209
864 Ga0068864_100000476
865 Ga0068864_100005296
866 Ga0068864_100037970
867 Ga0068864_100070930
868 Ga0068861_100001596
869 Ga0068861_100166470
870 Ga0068861_100430605
871 Ga0068851_10013340
872 Ga0068851_10180067
873 Ga0068863_100000029
874 Ga0068863_100000046
875 Ga0068863_100004290
876 Ga0068863_100042061
877 Ga0068863_100051764
878 Ga0068858_100019555
879 Ga0068858_100326910
880 Ga0068860_100000084
881 Ga0068860_100000288
882 Ga0068860_100013683
883 Ga0068860_100015185
884 Ga0068862_100001635
885 Ga0068862_100023508
886 Ga0068862_100189389
887 Ga0075368_10000225
888 Ga0075368_10000346
889 Ga0075368_10096929
890 Ga0075363_100074097
891 Ga0075364_10013544
892 Ga0075364_10227958
893 Ga0075362_10007630
894 Ga0075367_10001261
895 Ga0075367_10037372
896 Ga0075367_10045197
897 Ga0075369_10013681
898 Ga0075366_10083426
899 Ga0097621_100174042
900 Ga0075370_10002969
901 Ga0075370_10008165
902 Ga0075370_10151124
903 Ga0075430_100009875
904 Ga0068865_100000905
905 Ga0068865_100134524
906 Ga0068865_100161765
907 Ga0097620_100016987
908 Ga0097620_100217304
909 Ga0097620_100384209
910 Ga0079104_1027728
911 Ga0105251_10001436
912 Ga0105240_10000052
913 Ga0105240_10001171
914 Ga0105240_10016191
915 Ga0105240_10128111
916 Ga0105245_10162780
917 Ga0105247_10000842
918 Ga0105247_10034498
919 Ga0105243_10002796
920 Ga0105243_10036973
921 Ga0105241_10138735
922 Ga0105241_10242760
923 Ga0105242_10000742
924 Ga0105248_10002057
925 Ga0105248_10287345
926 Ga0105248_10344681
927 Ga0105237_10016895
928 Ga0105237_10020246
929 Ga0105237_10069377
930 Ga0105237_10072066
931 Ga0105237_10077788
932 Ga0105237_10122496
933 Ga0105237_10263128
934 Ga0105238_10188550
935 Ga0105238_10438722
936 Ga0105249_10000047
937 Ga0105249_10045356
938 Ga0105249_10199350
939 Ga0105249_10308035
940 Ga0105148_100009
941 Ga0105148_100052
942 Ga0105239_10005594
943 Ga0105239_10045376
944 Ga0105239_10115174
945 Ga0105239_10447254
946 Ga0105239_10677694
947 Ga0157326_1000840
948 Ga0157373_10029414
949 Ga0157371_10235102
950 Ga0157370_10272263
951 Ga0157369_10006710
952 Ga0157369_10081086
953 Ga0157369_10107360
954 Ga0157374_10241537
955 Ga0157374_10369448
956 Ga0157378_10000484
957 Ga0157378_10016172
958 Ga0157378_10232488
959 Ga0163162_10005403
960 Ga0163162_10031244
961 Ga0163162_10298101
962 Ga0157372_10125236
963 Ga0157375_10001290
964 Ga0163163_10004110
965 Ga0163163_10061962
966 Ga0163163_10146244
967 Ga0163163_10182414
968 Ga0157380_10000062
969 Ga0157380_10000995
970 Ga0157380_10002327
971 Ga0157380_10027469
972 Ga0157380_10433192
973 Ga0157379_10083461
974 Ga0157376_10000134
975 Ga0157376_10673620
976 Ga0163161_10001074
977 Ga0163161_10029919
978 Ga0209674_109404
979 Ga0209147_101472
980 Ga0207425_1000005
981 Ga0209148_1000147
982 Ga0209129_1002457
983 Ga0209565_1000231
984 Ga0209455_1011583
985 Ga0209675_1000089
986 Ga0209676_1000212
987 Ga0209676_1013374
988 Ga0209025_1000515
989 Ga0209564_1000164
990 Ga0209564_1000619
991 Ga0209564_1026360
992 Ga0209758_1000002
993 Ga0209050_1000001
994 Ga0209050_1000010
995 Ga0209050_1000068
996 Ga0209050_1000483
997 Ga0209051_1000817
998 Ga0209257_1000027
999 Ga0209257_1000193
1000 Ga0209257_1005709
1001 Ga0209257_1005767
1002 Ga0209257_1008265
1003 Ga0207697_10104306
1004 Ga0207656_10037846
1005 Ga0207656_10129298
1006 Ga0207696_1005813
1007 Ga0207713_1000601
1008 Ga0207713_1025852
1009 Ga0207713_1104579
1010 Ga0207710_10002403
1011 Ga0207710_10087567
1012 Ga0207680_10000008
1013 Ga0207680_10013563
1014 Ga0207680_10034005
1015 Ga0207680_10099163
1016 Ga0207647_10000952
1017 Ga0207647_10050376
1018 Ga0207645_10004724
1019 Ga0207643_10059265
1020 Ga0207705_10000432
1021 Ga0207705_10038693
1022 Ga0207705_10178134
1023 Ga0207654_10000698
1024 Ga0207654_10076219
1025 Ga0207654_10118246
1026 Ga0207695_10000122
1027 Ga0207695_10002374
1028 Ga0207695_10002631
1029 Ga0207695_10003217
1030 Ga0207695_10008302
1031 Ga0207695_10043228
1032 Ga0207695_10100988
1033 Ga0207671_10002254
1034 Ga0207671_10140602
1035 Ga0207657_10046566
1036 Ga0207657_10048987
1037 Ga0207657_10097168
1038 Ga0207652_10038327
1039 Ga0207681_10000022
1040 Ga0207681_10000321
1041 Ga0207681_10055994
1042 Ga0207681_10082706
1043 Ga0207681_10087461
1044 Ga0207694_10001423
1045 Ga0207694_10206858
1046 Ga0207694_10376114
1047 Ga0207650_10000019
1048 Ga0207650_10000020
1049 Ga0207650_10122540
1050 Ga0207650_10232956
1051 Ga0207650_10296167
1052 Ga0207650_10578492
1053 Ga0207687_10484789
1054 Ga0207644_10000318
1055 Ga0207644_10003990
1056 Ga0207644_10007674
1057 Ga0207644_10039068
1058 Ga0207644_10165761
1059 Ga0207644_10176310
1060 Ga0207644_10336098
1061 Ga0207706_10005149
1062 Ga0207706_10022957
1063 Ga0207706_10239128
1064 Ga0207686_10021120
1065 Ga0207686_10095554
1066 Ga0207709_10000066
1067 Ga0207670_10001974
1068 Ga0207669_10126409
1069 Ga0207704_10000002
1070 Ga0207704_10000007
1071 Ga0207704_10082966
1072 Ga0207704_10273171
1073 Ga0207711_10000838
1074 Ga0207711_10000889
1075 Ga0207711_10020165
1076 Ga0207711_10057297
1077 Ga0207711_10193183
1078 Ga0207689_10097142
1079 Ga0207689_10125075
1080 Ga0207667_10000343
1081 Ga0207667_10003138
1082 Ga0207667_10016393
1083 Ga0207667_10019137
1084 Ga0207667_10138056
1085 Ga0207651_10000004
1086 Ga0207712_10000009
1087 Ga0207712_10000508
1088 Ga0207712_10598853
1089 Ga0207668_10000313
1090 Ga0207668_10010339
1091 Ga0207668_10014571
1092 Ga0207668_10033540
1093 Ga0207668_10041609
1094 Ga0207668_10043901
1095 Ga0207668_10051540
1096 Ga0207668_10343950
1097 Ga0207640_10009834
1098 Ga0207640_10068894
1099 Ga0207658_10000159
1100 Ga0207658_10000332
1101 Ga0207658_10001467
1102 Ga0207658_10002324
1103 Ga0207658_10023400
1104 Ga0207658_10085721
1105 Ga0207677_10000060
1106 Ga0207703_10071066
1107 Ga0207703_10124791
1108 Ga0207639_10004001
1109 Ga0207639_10124821
1110 Ga0207678_10002216
1111 Ga0207678_10004471
1112 Ga0207678_10005410
1113 Ga0207702_10001800
1114 Ga0207702_10012724
1115 Ga0207641_10000049
1116 Ga0207641_10000517
1117 Ga0207641_10001931
1118 Ga0207641_10003674
1119 Ga0207641_10027854
1120 Ga0207641_10157734
1121 Ga0207648_10000003
1122 Ga0207676_10000022
1123 Ga0207676_10001436
1124 Ga0207676_10135394
1125 Ga0207676_10257235
1126 Ga0207674_10025551
1127 Ga0207674_10056234
1128 Ga0207674_10057470
1129 Ga0207674_10204851
1130 Ga0207675_100000841
1131 Ga0207675_100013085
1132 Ga0207675_100215995
1133 Ga0207675_100630334
1134 Ga0207683_10053530
1135 Ga0207698_10032795
1136 Ga0207698_10061912
1137 Ga0207698_10105310
1138 Ga0209281_1025812
1139 Ga0209813_10000180
1140 Ga0209813_10000872
1141 Ga0268266_10000341
1142 Ga0268266_10054982
1143 Ga0268266_10092933
1144 Ga0268266_10210882
1145 Ga0268265_10001114
1146 Ga0268265_10003238
1147 Ga0268265_10005512
1148 Ga0268265_10040218
1149 Ga0268265_10089087
1150 Ga0268265_10152606
1151 Ga0268264_10000003
1152 Ga0268264_10000342
1153 Ga0268264_10006007
1154 Ga0268264_10006643
1155 Ga0268264_10011266
1156 Ga0268264_10062999
1157 Ga0307515_10001181
1158 Ga0307515_10133963
1159 Ga0265327_10000275
1160 Ga0265316_10229308
1161 Ga0307516_10000051
1162 Ga0307405_10068585
1163 Ga0307410_10061941
1164 Ga0307410_10507802
1165 Ga0307412_10000515
1166 Ga0307412_10014120
1167 Ga0307412_10029669
1168 Ga0307412_10039260
1169 Ga0307416_100171098
1170 Ga0307416_100438077
1171 Ga0307414_10000328
1172 Ga0307411_10055828
1173 Ga0307411_10084352
1174 Ga0373932_0025429
1175 Ga0395900_0343419
1176 Ga0395898_0235205
1177 Ga0395905_0400057
1178 Ga0395901_0043629
1179 Ga0237819_00134
1180 Ga0436362_1026846
1181 Ga0439436_0018614
1182 Ga0439461_0011817
1183 Ga0439465_0010873
1184 Ga0451802_0643022
1185 Ga0439431_0035978
1186 Ga0439432_021508
1187 Ga0439457_007618
1188 Ga0466964_0028108
1189 Ga0466968_0006657
1190 Ga0495627_000113
1191 Ga0495638_0000012
1192 Ga0495638_0000123
1193 Ga0495650_0000093
1194 Ga0495650_0001327
1195 Ga0495650_0069138
1196 Ga0495584_0020356
1197 Ga0495583_0000474
1198 Ga0495583_0001160
1199 Ga0495606_0000272
1200 Ga0495606_0000382
1201 Ga0495606_0000443
1202 Ga0495606_0002643
1203 Ga0495606_0046954
1204 Ga0495610_0001282
1205 Ga0495610_0008306
1206 Ga0495616_0000176
1207 Ga0495616_0062116
1208 Ga0495616_0131471
1209 Ga0495620_0018265
1210 Ga0495631_0004640
1211 Ga0495632_0000001
1212 Ga0495632_0000773
1213 Ga0495637_0000809
1214 Ga0495637_0013583
1215 Ga0495637_0056792
1216 Ga0495643_0000006
1217 Ga0495643_0011649
1218 Ga0495643_0062648
1219 Ga0495648_0000295
1220 Ga0495648_0001990
1221 Ga0495648_0041808
1222 Ga0495663_0000002
1223 Ga0495642_0005393
1224 Ga0495654_0001238
1225 Ga0495587_0078108
1226 Ga0495609_0036465
1227 Ga0495609_0041526
1228 Ga0495597_0005293
1229 Ga0495597_0029662
1230 Ga0495622_0002978
1231 Ga0495622_0020902
1232 Ga0495633_0000053
1233 Ga0495633_0000160
1234 Ga0495633_0001046
1235 Ga0495633_0005525
1236 Ga0495668_0002823
1237 Ga0495668_0013682
1238 Ga0495668_0027073
1239 Ga0495668_0042439
1240 Ga0495668_0200403
1241 Ga0495634_0115611
1242 Ga0495625_0006257
1243 Ga0495625_0178507
1244 Ga0495625_0183568
1245 Ga0495588_0213298
1246 Ga0495599_0047019
1247 Ga0495646_0168617
1248 Ga0495669_0000639
1249 Ga0495669_0024103
1250 Ga0495613_0204739
1251 Ga0495670_0000036
1252 Ga0495670_0020373
1253 Ga0495670_0021440
1254 Ga0495670_0025856
1255 Ga0495671_0000008
1256 Ga0495671_0000111
1257 Ga0495600_0033760
1258 Ga0495660_0032948
1259 Ga0495687_000084
1260 Ga0495687_052898
1261 Ga0495673_0000013
1262 Ga0495673_0007717
1263 Ga0495681_0000058
1264 Ga0495681_0002650
1265 Ga0495686_0000433
1266 Ga0495686_0002518
1267 Ga0495686_0010639
1268 Ga0495686_0045272
1269 Ga0495686_0047711
1270 Ga0496100_0147609
1271 Ga0496101_0351262
1272 Ga0496101_0363113
1273 Ga0496102_0000106
1274 Ga0496102_0000143
1275 Ga0496102_0508198
1276 Ga0496103_0000095
1277 Ga0496103_0000098
1278 Ga0496103_0000924
1279 Ga0496103_0015455
1280 Ga0496104_0019175
1281 Ga0496104_0129301
1282 Ga0496104_0152808
1283 Ga0496105_0189572
1284 Ga0496105_0381490
1285 Ga0496106_0013364
1286 Ga0496106_0091425
1287 Ga0496106_0097613
1288 Ga0496108_0006555
1289 Ga0496109_0023726
1290 Ga0496110_0070177
1291 Ga0496110_0130597
1292 Ga0496111_0226626
1293 Ga0496112_0002555
1294 Ga0496112_0004022
1295 Ga0496113_0000022
1296 Ga0496113_0023762
1297 Ga0496113_0107503
1298 Ga0496113_0361267
1299 Ga0496114_0082909
1300 Ga0496115_0069307
1301 Ga0496116_0001473
1302 Ga0496116_0052511
1303 Ga0496116_0066591
1304 Ga0496117_0000121
1305 Ga0496117_0002347
1306 Ga0496117_0004218
1307 Ga0496117_0013111
1308 Ga0496117_0034039
1309 Ga0496118_0000095
1310 Ga0496118_0002332
1311 Ga0496118_0004877
1312 Ga0496118_0004878
1313 Ga0496118_0029869
1314 Ga0496118_0064346
1315 Ga0496118_0118962
1316 Ga0496118_0124746
1317 Ga0496118_0143926
1318 Ga0496119_0001217
1319 Ga0496119_0014522
1320 Ga0496119_0026090
1321 Ga0496119_0042198
1322 Ga0496119_0141446
1323 Ga0496120_0029409
1324 Ga0496121_0000272
1325 Ga0496121_0004371
1326 Ga0496121_0004952
1327 Ga0496121_0028429
1328 Ga0496121_0029618
1329 Ga0496121_0029998
1330 Ga0496122_0054539
1331 Ga0496122_0065917
1332 Ga0496122_0121086
1333 Ga0496122_0189059
1334 Ga0496123_0010012
1335 Ga0496123_0025209
1336 Ga0496123_0058779
1337 Ga0496123_0091348
1338 Ga0496123_0151834
1339 Ga0496123_0169219
1340 Ga0496124_0000119
1341 Ga0496124_0000417
1342 Ga0496124_0005450
1343 Ga0496124_0113541
1344 Ga0496124_0117893
1345 Ga0496125_0000953
1346 Ga0496125_0002341
1347 Ga0496125_0012810
1348 Ga0496125_0064504
1349 Ga0496125_0076259
1350 Ga0496126_0009286
1351 Ga0496126_0042375
1352 Ga0496126_0059050
1353 Ga0496126_0310704
1354 Ga0495678_069590
1355 Ga0495682_0006896
1356 Ga0501335_003397
1357 Ga0501034_0061308
1358 Ga0501070_0413397
1359 Ga0501198_011888
1360 Ga0501211_001542
1361 Ga0501223_000006
1362 Ga0501223_000100
1363 Ga0501224_000002
1364 Ga0501233_000375
1365 Ga0501235_000453
1366 Ga0501235_000617
1367 Ga0501246_000655
1368 Ga0501249_000095
1369 Ga0501225_0000032
1370 Ga0501225_0000120
1371 Ga0501225_0001607
1372 Ga0501225_0030924
1373 Ga0501234_000367
1374 Ga0501204_002066
1375 Ga0501226_000089
1376 nmdc:mga03683_1401_c1
1377 nmdc:mga03n38_3421_c1
1378 nmdc:mga00v17_59624_c1
1379 nmdc:mga00v17_9340_c1
1380 nmdc:mga0yw44_5062_c1
1381 nmdc:mga0yw44_76938_c1
1382 nmdc:mga06z11_100_c1
1383 nmdc:mga06z11_108_c1
1384 nmdc:mga04h51_11_c1
1385 nmdc:mga04h51_181_c1
1386 nmdc:mga07m45_114364_c1
1387 nmdc:mga07m45_15_c1
1388 nmdc:mga07m45_31802_c1
1389 nmdc:mga07m45_4041_c1
1390 nmdc:mga07m45_40709_c1
1391 nmdc:mga0qj67_27752_c1
1392 nmdc:mga0sz30_109_c1
1393 nmdc:mga0sz30_36836_c1
1394 Ga0500578_0020670
1395 Ga0500651_0039143
1396 Ga0500651_0163430
1397 Ga0500566_0007265
1398 Ga0500566_0014559
1399 Ga0500566_0059490
1400 Ga0500650_0006230
1401 Ga0500555_000477
1402 Ga0500555_064078
1403 Ga0500556_0000024
1404 Ga0500569_013432
1405 Ga0500595_005233
1406 Ga0500607_000065
1407 Ga0500607_000168
1408 Ga0500607_030204
1409 Ga0500608_025822
1410 Ga0500618_000092
1411 Ga0500618_004379
1412 Ga0500618_014931
1413 Ga0500618_035729
1414 Ga0500642_0000035
1415 Ga0500642_0001609
1416 Ga0500652_000134
1417 Ga0500655_000399
1418 Ga0500658_0000598
1419 Ga0500559_0000668
1420 Ga0500559_0001329
1421 Ga0500559_0002950
1422 Ga0500559_0030167
1423 Ga0500559_0049447
1424 Ga0500559_0068225
1425 Ga0500568_0003427
1426 Ga0500568_0015006
1427 Ga0500568_0033607
1428 Ga0500568_0066066
1429 Ga0500577_0000483
1430 Ga0500577_0004181
1431 Ga0500590_043419
1432 Ga0500590_062176
1433 Ga0500604_0006540
1434 Ga0500604_0035841
1435 Ga0500604_0087397
1436 Ga0500616_0000122
1437 Ga0500622_0001122
1438 Ga0500622_0001260
1439 Ga0500622_0004003
1440 Ga0500622_0020907
1441 Ga0500624_000018
1442 Ga0500624_000182
1443 Ga0500624_000205
1444 Ga0500627_0000687
1445 Ga0500627_0003265
1446 Ga0500633_0001786
1447 Ga0500634_0076613
1448 Ga0500636_0009686
1449 Ga0500636_0051013
1450 Ga0500637_0020659
1451 Ga0500637_0044358
1452 Ga0500567_002415
1453 Ga0500570_000052
1454 Ga0500625_000009
1455 Ga0500645_006451
1456 Ga0500645_007832
1457 Ga0500661_015067
1458 2512644270
1459 2603861073
1460 2644036830
1461 2739650098
1462 2740028571
1463 2753766278
1464 2778126989
1465 2809078669
1466 2809083036
1467 2857528800
1468 2880521547
1469 2893068994
1470 2919079227
1471 2919140998
1472 2919711065
1473 2929200432
1474 8055914748

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00351

Biopterin_H

Biopterin-dependent aromatic amino acid hydroxylase

71

313

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jpy-assembly1.cif.gz_A iron and phenylalanine bound crystal structure of phenylalanine hydroxylase from chromobacterium violaceum 0.9829 12 272
4jpx-assembly1.cif.gz_A crystal structure of phenylalanine hydroxylase s203p mutant from chromobacterium violaceum 0.9811 12 272
4q3w-assembly1.cif.gz_A crystal structure of c. violaceum phenylalanine hydroxylase d139e mutation 0.9795 12 272
4etl-assembly1.cif.gz_A crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum f258a mutation 0.9794 12 272
3tk4-assembly1.cif.gz_A crystal structure of phenylalanine hydroxylase from chromobacterium violaceum bound to cobalt 0.9788 12 272
ID Description Score Start End Superfamily
1ltzA00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9702 12 272 1.10.800.10
4bptC00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.939 32 260 1.10.800.10
2v28B00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.924 16 252 1.10.800.10
5jk8B00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9159 23 244 1.10.800.10
4bptC00 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.9156 32 260 1.10.800.10
ID Description Score Start End GO Terms
AF-A0A3D2L969-F1-model_v4 Phenylalanine 4-monooxygenase 0.9979 84 190 GO:0004505
GO:0005506
AF-A0A525JC61-F1-model_v4 Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) 0.9912 8 286 GO:0004505
GO:0005506
GO:0006559
AF-A0A257WQE8-F1-model_v4 Biopterin-dependent aromatic amino acid hydroxylase family profile domain-containing protein 0.9905 11 175 GO:0004505
GO:0005506
AF-A0A520ETB8-F1-model_v4 deleted 0.9894 109 285
AF-A0A537MHB0-F1-model_v4 Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) 0.9893 12 262 GO:0004505
GO:0005506
GO:0006559

Map