F478358
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 737 | 343 | 1474 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300053120|Ga0500597_034210|Ga0500597_034210_708_1745 |
| Length | 345 |
| Sequence | VADRTIELKLSENSTVRRIKPNRWFQFIRHFETILAKVLLNTGILESNCSETVRLSIMAQQNDNRPFGAAEDWTIPQDWARYTAVEHAMWDRLFERQSAILPGRVASEFLAGLDILRLSKPGIPDFEELSERLMAATGWQVVAVPGLVPDAVFFDHLANRRFVAGRFIRTPDQLDYLQEPDIFHDVFGHVPLLANPVFADYMQAYGMGGQRAAGLGSIEKLARLYWYTVEFGLIRSGDDLRIYGSGIVSSYGESVFALDDPSPNRLGFNLQRLMRTKYRIDDYQQNYFVIDSFEDLLRQTQETDFGPLYAALENQSDIEIEAILPSDEVYTRGTQSYAKAKLVTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 14 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 194 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 195 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 196 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 200 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 201 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 264 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 275 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 281 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 284 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 285 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 286 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 287 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 299 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 301 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 302 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 307 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 308 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 312 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 313 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 316 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 317 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 319 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 322 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 323 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 324 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 325 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 326 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 327 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 328 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 329 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 330 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 331 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 332 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 333 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 334 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 335 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 336 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 337 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 338 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 339 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 340 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 341 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 342 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 343 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.56 |
| Metatranscriptomes | 0.14 |
| Isolates | 2.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.72 |
| Nodule | 0.27 |
| Rhizoplane | 4.48 |
| Rhizosphere | 67.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500597_034210 | 3300053120 | Bacteria | 2107 |
| 2 | SwRhRL2b_contig_1233908 | 2162886007 | Bacteria | 5725 |
| 3 | SwRhRL2b_contig_3308639 | 2162886007 | Bacteria | 12228 |
| 4 | JGI24736J21556_1000004 | 3300001904 | Bacteria | 55308 |
| 5 | JGI24736J21556_1000158 | 3300001904 | Bacteria | 11955 |
| 6 | JGI24741J21665_1000027 | 3300001915 | Bacteria | 34739 |
| 7 | JGI24740J21852_10005199 | 3300001979 | Bacteria | 5524 |
| 8 | JGI24740J21852_10009996 | 3300001979 | Bacteria | 3677 |
| 9 | JGI24739J22299_10006854 | 3300001989 | Bacteria | 4290 |
| 10 | JGI24739J22299_10018201 | 3300001989 | Bacteria | 2528 |
| 11 | JGI24737J22298_10003710 | 3300001990 | Bacteria | 5376 |
| 12 | JGI24737J22298_10005046 | 3300001990 | Bacteria | 4575 |
| 13 | JGI24737J22298_10009302 | 3300001990 | Bacteria | 3273 |
| 14 | JGI24743J22301_10006315 | 3300001991 | Bacteria | 2015 |
| 15 | JGI24735J21928_10002350 | 3300002067 | Bacteria | 6589 |
| 16 | JGI24735J21928_10005878 | 3300002067 | Bacteria | 4056 |
| 17 | JGI24750J21931_1000060 | 3300002070 | Bacteria | 15589 |
| 18 | JGI24748J21848_1000083 | 3300002074 | Bacteria | 28195 |
| 19 | JGI24738J21930_10000860 | 3300002075 | Bacteria | 8715 |
| 20 | JGI24738J21930_10028035 | 3300002075 | Bacteria | 1153 |
| 21 | JGI24749J21850_1000053 | 3300002076 | Bacteria | 22163 |
| 22 | JGI24749J21850_1000625 | 3300002076 | Bacteria | 5147 |
| 23 | JGI24744J21845_10014295 | 3300002077 | Bacteria | 1595 |
| 24 | JGI24034J26672_10000021 | 3300002239 | Bacteria | 118553 |
| 25 | JGI24742J22300_10005615 | 3300002244 | Bacteria | 2062 |
| 26 | JGI24751J29686_10000172 | 3300002459 | Bacteria | 30053 |
| 27 | JGI24751J29686_10003922 | 3300002459 | Bacteria | 3005 |
| 28 | JGI25150J39212_1000313 | 3300002774 | Bacteria | 23995 |
| 29 | JGI25153J46596_10000027 | 3300003215 | Bacteria | 210760 |
| 30 | Ga0055542_1005309 | 3300003762 | Bacteria | 2935 |
| 31 | Ga0055526_1006101 | 3300003771 | Bacteria | 6654 |
| 32 | Ga0055536_1000580 | 3300003781 | Bacteria | 24917 |
| 33 | Ga0055530_10000017 | 3300003791 | Bacteria | 144027 |
| 34 | Ga0055530_10000638 | 3300003791 | Bacteria | 30190 |
| 35 | Ga0055530_10013388 | 3300003791 | Bacteria | 2803 |
| 36 | Ga0055540_1003210 | 3300003792 | Bacteria | 8028 |
| 37 | Ga0055531_10000129 | 3300003794 | Bacteria | 85460 |
| 38 | Ga0055531_10000640 | 3300003794 | Bacteria | 30187 |
| 39 | Ga0055531_10030489 | 3300003794 | Bacteria | 1809 |
| 40 | Ga0065165_1001477 | 3300005262 | Bacteria | 25096 |
| 41 | Ga0065165_1032230 | 3300005262 | Bacteria | 1645 |
| 42 | Ga0065704_10016101 | 3300005289 | Bacteria | 1316 |
| 43 | Ga0065704_10024609 | 3300005289 | Bacteria | 1696 |
| 44 | Ga0065704_10027091 | 3300005289 | Bacteria | 2399 |
| 45 | Ga0065704_10070288 | 3300005289 | Bacteria | 39072 |
| 46 | Ga0065704_10070363 | 3300005289 | Bacteria | 29943 |
| 47 | Ga0065704_10081727 | 3300005289 | Bacteria | 3709 |
| 48 | Ga0065704_10090763 | 3300005289 | Bacteria | 2765 |
| 49 | Ga0065707_10004435 | 3300005295 | Bacteria | 6895 |
| 50 | Ga0065707_10081814 | 3300005295 | Bacteria | 36963 |
| 51 | Ga0065707_10091000 | 3300005295 | Bacteria | 4024 |
| 52 | Ga0070658_10000678 | 3300005327 | Bacteria | 29438 |
| 53 | Ga0070658_10007974 | 3300005327 | Bacteria | 8521 |
| 54 | Ga0070676_10000947 | 3300005328 | Bacteria | 14413 |
| 55 | Ga0070676_10264286 | 3300005328 | Bacteria | 1153 |
| 56 | Ga0070683_100308388 | 3300005329 | Bacteria | 1506 |
| 57 | Ga0070690_100000005 | 3300005330 | Bacteria | 142006 |
| 58 | Ga0070690_100021439 | 3300005330 | Bacteria | 3945 |
| 59 | Ga0070670_100000008 | 3300005331 | Bacteria | 292132 |
| 60 | Ga0070670_100048027 | 3300005331 | Bacteria | 3674 |
| 61 | Ga0068869_100036969 | 3300005334 | Bacteria | 3470 |
| 62 | Ga0070666_10000021 | 3300005335 | Bacteria | 167450 |
| 63 | Ga0070666_10271778 | 3300005335 | Bacteria | 1203 |
| 64 | Ga0070680_100037860 | 3300005336 | Bacteria | 3899 |
| 65 | Ga0068868_100008798 | 3300005338 | Bacteria | 7233 |
| 66 | Ga0070660_100058904 | 3300005339 | Bacteria | 2977 |
| 67 | Ga0070660_100238560 | 3300005339 | Bacteria | 1480 |
| 68 | Ga0070661_100088897 | 3300005344 | Bacteria | 2287 |
| 69 | Ga0070668_100000172 | 3300005347 | Bacteria | 41511 |
| 70 | Ga0070668_100046209 | 3300005347 | Bacteria | 3342 |
| 71 | Ga0070668_100069013 | 3300005347 | Bacteria | 2749 |
| 72 | Ga0070668_100101697 | 3300005347 | Bacteria | 2278 |
| 73 | Ga0070669_100000045 | 3300005353 | Bacteria | 119932 |
| 74 | Ga0070669_100000357 | 3300005353 | Bacteria | 35454 |
| 75 | Ga0070669_100000362 | 3300005353 | Bacteria | 35206 |
| 76 | Ga0070669_100057186 | 3300005353 | Bacteria | 2861 |
| 77 | Ga0070669_100091330 | 3300005353 | Bacteria | 2283 |
| 78 | Ga0070669_100094664 | 3300005353 | Bacteria | 2245 |
| 79 | Ga0070671_100001370 | 3300005355 | Bacteria | 18264 |
| 80 | Ga0070671_100005700 | 3300005355 | Bacteria | 9923 |
| 81 | Ga0070671_100058641 | 3300005355 | Bacteria | 3204 |
| 82 | Ga0070671_100084707 | 3300005355 | Bacteria | 2651 |
| 83 | Ga0070671_100182132 | 3300005355 | Bacteria | 1779 |
| 84 | Ga0070671_100506634 | 3300005355 | Bacteria | 1038 |
| 85 | Ga0070674_100031853 | 3300005356 | Bacteria | 3498 |
| 86 | Ga0070674_100107308 | 3300005356 | Bacteria | 2044 |
| 87 | Ga0070673_100000009 | 3300005364 | Bacteria | 155005 |
| 88 | Ga0070659_100031293 | 3300005366 | Bacteria | 4121 |
| 89 | Ga0070659_100093398 | 3300005366 | Bacteria | 2414 |
| 90 | Ga0070659_100624851 | 3300005366 | Bacteria | 927 |
| 91 | Ga0070667_100000199 | 3300005367 | Bacteria | 71115 |
| 92 | Ga0070667_100000552 | 3300005367 | Bacteria | 37288 |
| 93 | Ga0070667_100000635 | 3300005367 | Bacteria | 34114 |
| 94 | Ga0070667_100004904 | 3300005367 | Bacteria | 11210 |
| 95 | Ga0070705_100065893 | 3300005440 | Bacteria | 2170 |
| 96 | Ga0070663_100016515 | 3300005455 | Bacteria | 4798 |
| 97 | Ga0070663_100047309 | 3300005455 | Bacteria | 3047 |
| 98 | Ga0070663_100053630 | 3300005455 | Bacteria | 2879 |
| 99 | Ga0070681_10104220 | 3300005458 | Bacteria | 2779 |
| 100 | Ga0068867_100000002 | 3300005459 | Bacteria | 247206 |
| 101 | Ga0070685_10031457 | 3300005466 | Bacteria | 2965 |
| 102 | Ga0070679_100008895 | 3300005530 | Bacteria | 9477 |
| 103 | Ga0068853_100001276 | 3300005539 | Bacteria | 18049 |
| 104 | Ga0068853_100079368 | 3300005539 | Bacteria | 2870 |
| 105 | Ga0070686_100000001 | 3300005544 | Bacteria | 515830 |
| 106 | Ga0070686_100349754 | 3300005544 | Bacteria | 1110 |
| 107 | Ga0070665_100006376 | 3300005548 | Bacteria | 12025 |
| 108 | Ga0070665_100053577 | 3300005548 | Bacteria | 4046 |
| 109 | Ga0070665_100086809 | 3300005548 | Bacteria | 3134 |
| 110 | Ga0070704_100074562 | 3300005549 | Bacteria | 2475 |
| 111 | Ga0068855_100001880 | 3300005563 | Bacteria | 26079 |
| 112 | Ga0068855_100033473 | 3300005563 | Bacteria | 6133 |
| 113 | Ga0068855_100055513 | 3300005563 | Bacteria | 4652 |
| 114 | Ga0068855_100071686 | 3300005563 | Bacteria | 4028 |
| 115 | Ga0068855_100451480 | 3300005563 | Bacteria | 1403 |
| 116 | Ga0070664_100080535 | 3300005564 | Bacteria | 2805 |
| 117 | Ga0070664_100336447 | 3300005564 | Bacteria | 1370 |
| 118 | Ga0068857_100300966 | 3300005577 | Bacteria | 1478 |
| 119 | Ga0068857_100523521 | 3300005577 | Bacteria | 1115 |
| 120 | Ga0068854_100006328 | 3300005578 | Bacteria | 7529 |
| 121 | Ga0068854_100170689 | 3300005578 | Bacteria | 1692 |
| 122 | Ga0068856_100175056 | 3300005614 | Bacteria | 2158 |
| 123 | Ga0068856_100802469 | 3300005614 | Bacteria | 961 |
| 124 | Ga0068852_100034855 | 3300005616 | Bacteria | 4192 |
| 125 | Ga0068859_100217309 | 3300005617 | Bacteria | 1999 |
| 126 | Ga0068859_100384209 | 3300005617 | Bacteria | 1499 |
| 127 | Ga0068864_100000476 | 3300005618 | Bacteria | 34760 |
| 128 | Ga0068864_100005296 | 3300005618 | Bacteria | 10556 |
| 129 | Ga0068864_100037970 | 3300005618 | Bacteria | 4111 |
| 130 | Ga0068864_100070930 | 3300005618 | Bacteria | 3033 |
| 131 | Ga0068861_100001596 | 3300005719 | Bacteria | 14429 |
| 132 | Ga0068861_100166470 | 3300005719 | Bacteria | 1823 |
| 133 | Ga0068861_100430605 | 3300005719 | Bacteria | 1177 |
| 134 | Ga0068851_10013340 | 3300005834 | Bacteria | 3890 |
| 135 | Ga0068851_10180067 | 3300005834 | Bacteria | 1170 |
| 136 | Ga0068863_100000029 | 3300005841 | Bacteria | 177191 |
| 137 | Ga0068863_100000046 | 3300005841 | Bacteria | 143895 |
| 138 | Ga0068863_100004290 | 3300005841 | Bacteria | 14042 |
| 139 | Ga0068863_100042061 | 3300005841 | Bacteria | 4343 |
| 140 | Ga0068863_100051764 | 3300005841 | Bacteria | 3891 |
| 141 | Ga0068858_100019555 | 3300005842 | Bacteria | 6333 |
| 142 | Ga0068858_100326910 | 3300005842 | Bacteria | 1466 |
| 143 | Ga0068860_100000084 | 3300005843 | Bacteria | 167450 |
| 144 | Ga0068860_100000288 | 3300005843 | Bacteria | 71737 |
| 145 | Ga0068860_100013683 | 3300005843 | Bacteria | 7955 |
| 146 | Ga0068860_100015185 | 3300005843 | Bacteria | 7522 |
| 147 | Ga0068862_100001635 | 3300005844 | Bacteria | 20398 |
| 148 | Ga0068862_100023508 | 3300005844 | Bacteria | 5165 |
| 149 | Ga0068862_100189389 | 3300005844 | Bacteria | 1850 |
| 150 | Ga0075368_10000225 | 3300006042 | Bacteria | 15895 |
| 151 | Ga0075368_10000346 | 3300006042 | Bacteria | 13571 |
| 152 | Ga0075368_10096929 | 3300006042 | Bacteria | 1209 |
| 153 | Ga0075363_100074097 | 3300006048 | Bacteria | 1853 |
| 154 | Ga0075364_10013544 | 3300006051 | Bacteria | 5018 |
| 155 | Ga0075364_10227958 | 3300006051 | Bacteria | 1265 |
| 156 | Ga0075362_10007630 | 3300006177 | Bacteria | 4108 |
| 157 | Ga0075367_10001261 | 3300006178 | Bacteria | 10679 |
| 158 | Ga0075367_10037372 | 3300006178 | Bacteria | 2821 |
| 159 | Ga0075367_10045197 | 3300006178 | Bacteria | 2584 |
| 160 | Ga0075369_10013681 | 3300006186 | Bacteria | 3227 |
| 161 | Ga0075366_10083426 | 3300006195 | Bacteria | 1910 |
| 162 | Ga0097621_100174042 | 3300006237 | Bacteria | 1857 |
| 163 | Ga0075370_10002969 | 3300006353 | Bacteria | 7971 |
| 164 | Ga0075370_10008165 | 3300006353 | Bacteria | 5373 |
| 165 | Ga0075370_10151124 | 3300006353 | Bacteria | 1361 |
| 166 | Ga0075430_100009875 | 3300006846 | Bacteria | 8072 |
| 167 | Ga0068865_100000905 | 3300006881 | Bacteria | 16830 |
| 168 | Ga0068865_100134524 | 3300006881 | Bacteria | 1856 |
| 169 | Ga0068865_100161765 | 3300006881 | Bacteria | 1708 |
| 170 | Ga0097620_100016987 | 3300006931 | Bacteria | 7305 |
| 171 | Ga0097620_100217304 | 3300006931 | Bacteria | 1999 |
| 172 | Ga0097620_100384209 | 3300006931 | Bacteria | 1499 |
| 173 | Ga0079104_1027728 | 3300006946 | Bacteria | 1448 |
| 174 | Ga0105251_10001436 | 3300009011 | Bacteria | 20478 |
| 175 | Ga0105240_10000052 | 3300009093 | Bacteria | 232583 |
| 176 | Ga0105240_10001171 | 3300009093 | Bacteria | 45972 |
| 177 | Ga0105240_10016191 | 3300009093 | Bacteria | 10104 |
| 178 | Ga0105240_10128111 | 3300009093 | Bacteria | 3047 |
| 179 | Ga0105245_10162780 | 3300009098 | Bacteria | 2118 |
| 180 | Ga0105247_10000842 | 3300009101 | Bacteria | 23321 |
| 181 | Ga0105247_10034498 | 3300009101 | Bacteria | 3082 |
| 182 | Ga0105243_10002796 | 3300009148 | Bacteria | 14485 |
| 183 | Ga0105243_10036973 | 3300009148 | Bacteria | 3792 |
| 184 | Ga0105241_10138735 | 3300009174 | Bacteria | 1977 |
| 185 | Ga0105241_10242760 | 3300009174 | Bacteria | 1523 |
| 186 | Ga0105242_10000742 | 3300009176 | Bacteria | 25399 |
| 187 | Ga0105248_10002057 | 3300009177 | Bacteria | 22278 |
| 188 | Ga0105248_10287345 | 3300009177 | Bacteria | 1852 |
| 189 | Ga0105248_10344681 | 3300009177 | Bacteria | 1677 |
| 190 | Ga0105237_10016895 | 3300009545 | Bacteria | 7572 |
| 191 | Ga0105237_10020246 | 3300009545 | Bacteria | 6864 |
| 192 | Ga0105237_10069377 | 3300009545 | Bacteria | 3520 |
| 193 | Ga0105237_10072066 | 3300009545 | Bacteria | 3449 |
| 194 | Ga0105237_10077788 | 3300009545 | Bacteria | 3307 |
| 195 | Ga0105237_10122496 | 3300009545 | Bacteria | 2594 |
| 196 | Ga0105237_10263128 | 3300009545 | Bacteria | 1727 |
| 197 | Ga0105238_10188550 | 3300009551 | Bacteria | 2038 |
| 198 | Ga0105238_10438722 | 3300009551 | Bacteria | 1302 |
| 199 | Ga0105249_10000047 | 3300009553 | Bacteria | 176249 |
| 200 | Ga0105249_10045356 | 3300009553 | Bacteria | 3998 |
| 201 | Ga0105249_10199350 | 3300009553 | Bacteria | 1958 |
| 202 | Ga0105249_10308035 | 3300009553 | Bacteria | 1591 |
| 203 | Ga0105148_100009 | 3300009978 | Bacteria | 31431 |
| 204 | Ga0105148_100052 | 3300009978 | Bacteria | 17846 |
| 205 | Ga0105239_10005594 | 3300010375 | Bacteria | 14694 |
| 206 | Ga0105239_10045376 | 3300010375 | Bacteria | 4816 |
| 207 | Ga0105239_10115174 | 3300010375 | Bacteria | 2982 |
| 208 | Ga0105239_10447254 | 3300010375 | Bacteria | 1465 |
| 209 | Ga0105239_10677694 | 3300010375 | Bacteria | 1178 |
| 210 | Ga0157326_1000840 | 3300012513 | Bacteria | 3556 |
| 211 | Ga0157373_10029414 | 3300013100 | Bacteria | 3957 |
| 212 | Ga0157371_10235102 | 3300013102 | Bacteria | 1317 |
| 213 | Ga0157370_10272263 | 3300013104 | Bacteria | 1564 |
| 214 | Ga0157369_10006710 | 3300013105 | Bacteria | 13284 |
| 215 | Ga0157369_10081086 | 3300013105 | Bacteria | 3473 |
| 216 | Ga0157369_10107360 | 3300013105 | Bacteria | 2970 |
| 217 | Ga0157374_10241537 | 3300013296 | Bacteria | 1776 |
| 218 | Ga0157374_10369448 | 3300013296 | Bacteria | 1427 |
| 219 | Ga0157378_10000484 | 3300013297 | Bacteria | 37864 |
| 220 | Ga0157378_10016172 | 3300013297 | Bacteria | 6533 |
| 221 | Ga0157378_10232488 | 3300013297 | Bacteria | 1757 |
| 222 | Ga0163162_10005403 | 3300013306 | Bacteria | 12343 |
| 223 | Ga0163162_10031244 | 3300013306 | Bacteria | 5282 |
| 224 | Ga0163162_10298101 | 3300013306 | Bacteria | 1744 |
| 225 | Ga0157372_10125236 | 3300013307 | Bacteria | 2954 |
| 226 | Ga0157375_10001290 | 3300013308 | Bacteria | 21614 |
| 227 | Ga0163163_10004110 | 3300014325 | Bacteria | 12412 |
| 228 | Ga0163163_10061962 | 3300014325 | Bacteria | 3706 |
| 229 | Ga0163163_10146244 | 3300014325 | Bacteria | 2407 |
| 230 | Ga0163163_10182414 | 3300014325 | Bacteria | 2146 |
| 231 | Ga0157380_10000062 | 3300014326 | Bacteria | 61714 |
| 232 | Ga0157380_10000995 | 3300014326 | Bacteria | 18016 |
| 233 | Ga0157380_10002327 | 3300014326 | Bacteria | 12762 |
| 234 | Ga0157380_10027469 | 3300014326 | Bacteria | 4329 |
| 235 | Ga0157380_10433192 | 3300014326 | Bacteria | 1258 |
| 236 | Ga0157379_10083461 | 3300014968 | Bacteria | 2864 |
| 237 | Ga0157376_10000134 | 3300014969 | Bacteria | 51135 |
| 238 | Ga0157376_10673620 | 3300014969 | Bacteria | 1037 |
| 239 | Ga0163161_10001074 | 3300017792 | Bacteria | 20688 |
| 240 | Ga0163161_10029919 | 3300017792 | Bacteria | 3872 |
| 241 | Ga0209674_109404 | 3300025226 | Bacteria | 1091 |
| 242 | Ga0209147_101472 | 3300025229 | Bacteria | 8441 |
| 243 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 244 | Ga0209148_1000147 | 3300025254 | Bacteria | 160231 |
| 245 | Ga0209129_1002457 | 3300025258 | Bacteria | 9079 |
| 246 | Ga0209565_1000231 | 3300025263 | Bacteria | 61384 |
| 247 | Ga0209455_1011583 | 3300025272 | Bacteria | 2162 |
| 248 | Ga0209675_1000089 | 3300025291 | Bacteria | 146897 |
| 249 | Ga0209676_1000212 | 3300025292 | Bacteria | 128606 |
| 250 | Ga0209676_1013374 | 3300025292 | Bacteria | 3159 |
| 251 | Ga0209025_1000515 | 3300025294 | Bacteria | 73801 |
| 252 | Ga0209564_1000164 | 3300025295 | Bacteria | 160675 |
| 253 | Ga0209564_1000619 | 3300025295 | Bacteria | 54397 |
| 254 | Ga0209564_1026360 | 3300025295 | Bacteria | 1923 |
| 255 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 256 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 257 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 258 | Ga0209050_1000068 | 3300025298 | Bacteria | 298849 |
| 259 | Ga0209050_1000483 | 3300025298 | Bacteria | 69796 |
| 260 | Ga0209051_1000817 | 3300025303 | Bacteria | 32251 |
| 261 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 262 | Ga0209257_1000193 | 3300025304 | Bacteria | 151777 |
| 263 | Ga0209257_1005709 | 3300025304 | Bacteria | 8543 |
| 264 | Ga0209257_1005767 | 3300025304 | Bacteria | 8454 |
| 265 | Ga0209257_1008265 | 3300025304 | Bacteria | 5979 |
| 266 | Ga0207697_10104306 | 3300025315 | Bacteria | 1211 |
| 267 | Ga0207656_10037846 | 3300025321 | Bacteria | 2032 |
| 268 | Ga0207656_10129298 | 3300025321 | Bacteria | 1182 |
| 269 | Ga0207696_1005813 | 3300025711 | Bacteria | 5065 |
| 270 | Ga0207713_1000601 | 3300025735 | Bacteria | 35469 |
| 271 | Ga0207713_1025852 | 3300025735 | Bacteria | 2702 |
| 272 | Ga0207713_1104579 | 3300025735 | Bacteria | 971 |
| 273 | Ga0207710_10002403 | 3300025900 | Bacteria | 8733 |
| 274 | Ga0207710_10087567 | 3300025900 | Bacteria | 1453 |
| 275 | Ga0207680_10000008 | 3300025903 | Bacteria | 518177 |
| 276 | Ga0207680_10013563 | 3300025903 | Bacteria | 4191 |
| 277 | Ga0207680_10034005 | 3300025903 | Bacteria | 2913 |
| 278 | Ga0207680_10099163 | 3300025903 | Bacteria | 1869 |
| 279 | Ga0207647_10000952 | 3300025904 | Bacteria | 22408 |
| 280 | Ga0207647_10050376 | 3300025904 | Bacteria | 2579 |
| 281 | Ga0207645_10004724 | 3300025907 | Bacteria | 10024 |
| 282 | Ga0207643_10059265 | 3300025908 | Bacteria | 2184 |
| 283 | Ga0207705_10000432 | 3300025909 | Bacteria | 36515 |
| 284 | Ga0207705_10038693 | 3300025909 | Bacteria | 3416 |
| 285 | Ga0207705_10178134 | 3300025909 | Bacteria | 1603 |
| 286 | Ga0207654_10000698 | 3300025911 | Bacteria | 18736 |
| 287 | Ga0207654_10076219 | 3300025911 | Bacteria | 2006 |
| 288 | Ga0207654_10118246 | 3300025911 | Bacteria | 1660 |
| 289 | Ga0207695_10000122 | 3300025913 | Bacteria | 232677 |
| 290 | Ga0207695_10002374 | 3300025913 | Bacteria | 27948 |
| 291 | Ga0207695_10002631 | 3300025913 | Bacteria | 26270 |
| 292 | Ga0207695_10003217 | 3300025913 | Bacteria | 23248 |
| 293 | Ga0207695_10008302 | 3300025913 | Bacteria | 13012 |
| 294 | Ga0207695_10043228 | 3300025913 | Bacteria | 4803 |
| 295 | Ga0207695_10100988 | 3300025913 | Bacteria | 2880 |
| 296 | Ga0207671_10002254 | 3300025914 | Bacteria | 20881 |
| 297 | Ga0207671_10140602 | 3300025914 | Bacteria | 1860 |
| 298 | Ga0207657_10046566 | 3300025919 | Bacteria | 3798 |
| 299 | Ga0207657_10048987 | 3300025919 | Bacteria | 3685 |
| 300 | Ga0207657_10097168 | 3300025919 | Bacteria | 2449 |
| 301 | Ga0207652_10038327 | 3300025921 | Bacteria | 4062 |
| 302 | Ga0207681_10000022 | 3300025923 | Bacteria | 230079 |
| 303 | Ga0207681_10000321 | 3300025923 | Bacteria | 34677 |
| 304 | Ga0207681_10055994 | 3300025923 | Bacteria | 2688 |
| 305 | Ga0207681_10082706 | 3300025923 | Bacteria | 2270 |
| 306 | Ga0207681_10087461 | 3300025923 | Bacteria | 2217 |
| 307 | Ga0207694_10001423 | 3300025924 | Bacteria | 20509 |
| 308 | Ga0207694_10206858 | 3300025924 | Bacteria | 1598 |
| 309 | Ga0207694_10376114 | 3300025924 | Bacteria | 1178 |
| 310 | Ga0207650_10000019 | 3300025925 | Bacteria | 344751 |
| 311 | Ga0207650_10000020 | 3300025925 | Bacteria | 342596 |
| 312 | Ga0207650_10122540 | 3300025925 | Bacteria | 2026 |
| 313 | Ga0207650_10232956 | 3300025925 | Bacteria | 1486 |
| 314 | Ga0207650_10296167 | 3300025925 | Bacteria | 1320 |
| 315 | Ga0207650_10578492 | 3300025925 | Bacteria | 943 |
| 316 | Ga0207687_10484789 | 3300025927 | Bacteria | 1030 |
| 317 | Ga0207644_10000318 | 3300025931 | Bacteria | 31448 |
| 318 | Ga0207644_10003990 | 3300025931 | Bacteria | 9585 |
| 319 | Ga0207644_10007674 | 3300025931 | Bacteria | 7036 |
| 320 | Ga0207644_10039068 | 3300025931 | Bacteria | 3348 |
| 321 | Ga0207644_10165761 | 3300025931 | Bacteria | 1721 |
| 322 | Ga0207644_10176310 | 3300025931 | Bacteria | 1673 |
| 323 | Ga0207644_10336098 | 3300025931 | Bacteria | 1224 |
| 324 | Ga0207706_10005149 | 3300025933 | Bacteria | 12202 |
| 325 | Ga0207706_10022957 | 3300025933 | Bacteria | 5602 |
| 326 | Ga0207706_10239128 | 3300025933 | Bacteria | 1587 |
| 327 | Ga0207686_10021120 | 3300025934 | Bacteria | 3731 |
| 328 | Ga0207686_10095554 | 3300025934 | Bacteria | 1972 |
| 329 | Ga0207709_10000066 | 3300025935 | Bacteria | 189194 |
| 330 | Ga0207670_10001974 | 3300025936 | Bacteria | 10750 |
| 331 | Ga0207669_10126409 | 3300025937 | Bacteria | 1747 |
| 332 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 333 | Ga0207704_10000007 | 3300025938 | Bacteria | 211230 |
| 334 | Ga0207704_10082966 | 3300025938 | Bacteria | 2078 |
| 335 | Ga0207704_10273171 | 3300025938 | Bacteria | 1281 |
| 336 | Ga0207711_10000838 | 3300025941 | Bacteria | 29705 |
| 337 | Ga0207711_10000889 | 3300025941 | Bacteria | 28799 |
| 338 | Ga0207711_10020165 | 3300025941 | Bacteria | 5555 |
| 339 | Ga0207711_10057297 | 3300025941 | Bacteria | 3350 |
| 340 | Ga0207711_10193183 | 3300025941 | Bacteria | 1856 |
| 341 | Ga0207689_10097142 | 3300025942 | Bacteria | 2419 |
| 342 | Ga0207689_10125075 | 3300025942 | Bacteria | 2115 |
| 343 | Ga0207667_10000343 | 3300025949 | Bacteria | 63689 |
| 344 | Ga0207667_10003138 | 3300025949 | Bacteria | 20458 |
| 345 | Ga0207667_10016393 | 3300025949 | Bacteria | 8375 |
| 346 | Ga0207667_10019137 | 3300025949 | Bacteria | 7657 |
| 347 | Ga0207667_10138056 | 3300025949 | Bacteria | 2510 |
| 348 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 349 | Ga0207712_10000009 | 3300025961 | Bacteria | 518177 |
| 350 | Ga0207712_10000508 | 3300025961 | Bacteria | 32312 |
| 351 | Ga0207712_10598853 | 3300025961 | Bacteria | 953 |
| 352 | Ga0207668_10000313 | 3300025972 | Bacteria | 31786 |
| 353 | Ga0207668_10010339 | 3300025972 | Bacteria | 5637 |
| 354 | Ga0207668_10014571 | 3300025972 | Bacteria | 4866 |
| 355 | Ga0207668_10033540 | 3300025972 | Bacteria | 3401 |
| 356 | Ga0207668_10041609 | 3300025972 | Bacteria | 3108 |
| 357 | Ga0207668_10043901 | 3300025972 | Bacteria | 3037 |
| 358 | Ga0207668_10051540 | 3300025972 | Bacteria | 2843 |
| 359 | Ga0207668_10343950 | 3300025972 | Bacteria | 1245 |
| 360 | Ga0207640_10009834 | 3300025981 | Bacteria | 5365 |
| 361 | Ga0207640_10068894 | 3300025981 | Bacteria | 2373 |
| 362 | Ga0207658_10000159 | 3300025986 | Bacteria | 71280 |
| 363 | Ga0207658_10000332 | 3300025986 | Bacteria | 47441 |
| 364 | Ga0207658_10001467 | 3300025986 | Bacteria | 18396 |
| 365 | Ga0207658_10002324 | 3300025986 | Bacteria | 13966 |
| 366 | Ga0207658_10023400 | 3300025986 | Bacteria | 4311 |
| 367 | Ga0207658_10085721 | 3300025986 | Bacteria | 2427 |
| 368 | Ga0207677_10000060 | 3300026023 | Bacteria | 93186 |
| 369 | Ga0207703_10071066 | 3300026035 | Bacteria | 2874 |
| 370 | Ga0207703_10124791 | 3300026035 | Bacteria | 2215 |
| 371 | Ga0207639_10004001 | 3300026041 | Bacteria | 9953 |
| 372 | Ga0207639_10124821 | 3300026041 | Bacteria | 2121 |
| 373 | Ga0207678_10002216 | 3300026067 | Bacteria | 17553 |
| 374 | Ga0207678_10004471 | 3300026067 | Bacteria | 12567 |
| 375 | Ga0207678_10005410 | 3300026067 | Bacteria | 11434 |
| 376 | Ga0207702_10001800 | 3300026078 | Bacteria | 21115 |
| 377 | Ga0207702_10012724 | 3300026078 | Bacteria | 7002 |
| 378 | Ga0207641_10000049 | 3300026088 | Bacteria | 177222 |
| 379 | Ga0207641_10000517 | 3300026088 | Bacteria | 43309 |
| 380 | Ga0207641_10001931 | 3300026088 | Bacteria | 19887 |
| 381 | Ga0207641_10003674 | 3300026088 | Bacteria | 13511 |
| 382 | Ga0207641_10027854 | 3300026088 | Bacteria | 4667 |
| 383 | Ga0207641_10157734 | 3300026088 | Bacteria | 2060 |
| 384 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 385 | Ga0207676_10000022 | 3300026095 | Bacteria | 296286 |
| 386 | Ga0207676_10001436 | 3300026095 | Bacteria | 17716 |
| 387 | Ga0207676_10135394 | 3300026095 | Bacteria | 2101 |
| 388 | Ga0207676_10257235 | 3300026095 | Bacteria | 1574 |
| 389 | Ga0207674_10025551 | 3300026116 | Bacteria | 6294 |
| 390 | Ga0207674_10056234 | 3300026116 | Bacteria | 3997 |
| 391 | Ga0207674_10057470 | 3300026116 | Bacteria | 3944 |
| 392 | Ga0207674_10204851 | 3300026116 | Bacteria | 1922 |
| 393 | Ga0207675_100000841 | 3300026118 | Bacteria | 30545 |
| 394 | Ga0207675_100013085 | 3300026118 | Bacteria | 7744 |
| 395 | Ga0207675_100215995 | 3300026118 | Bacteria | 1846 |
| 396 | Ga0207675_100630334 | 3300026118 | Bacteria | 1077 |
| 397 | Ga0207683_10053530 | 3300026121 | Bacteria | 3539 |
| 398 | Ga0207698_10032795 | 3300026142 | Bacteria | 3767 |
| 399 | Ga0207698_10061912 | 3300026142 | Bacteria | 2919 |
| 400 | Ga0207698_10105310 | 3300026142 | Bacteria | 2350 |
| 401 | Ga0209281_1025812 | 3300027111 | Bacteria | 1091 |
| 402 | Ga0209813_10000180 | 3300027866 | Bacteria | 20487 |
| 403 | Ga0209813_10000872 | 3300027866 | Bacteria | 6798 |
| 404 | Ga0268266_10000341 | 3300028379 | Bacteria | 72917 |
| 405 | Ga0268266_10054982 | 3300028379 | Bacteria | 3421 |
| 406 | Ga0268266_10092933 | 3300028379 | Bacteria | 2647 |
| 407 | Ga0268266_10210882 | 3300028379 | Bacteria | 1781 |
| 408 | Ga0268265_10001114 | 3300028380 | Bacteria | 23815 |
| 409 | Ga0268265_10003238 | 3300028380 | Bacteria | 11825 |
| 410 | Ga0268265_10005512 | 3300028380 | Bacteria | 8637 |
| 411 | Ga0268265_10040218 | 3300028380 | Bacteria | 3452 |
| 412 | Ga0268265_10089087 | 3300028380 | Bacteria | 2460 |
| 413 | Ga0268265_10152606 | 3300028380 | Bacteria | 1950 |
| 414 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 415 | Ga0268264_10000342 | 3300028381 | Bacteria | 71753 |
| 416 | Ga0268264_10006007 | 3300028381 | Bacteria | 10275 |
| 417 | Ga0268264_10006643 | 3300028381 | Bacteria | 9728 |
| 418 | Ga0268264_10011266 | 3300028381 | Bacteria | 7389 |
| 419 | Ga0268264_10062999 | 3300028381 | Bacteria | 3116 |
| 420 | Ga0307515_10001181 | 3300028794 | Bacteria | 59747 |
| 421 | Ga0307515_10133963 | 3300028794 | Bacteria | 2708 |
| 422 | Ga0265327_10000275 | 3300031251 | Bacteria | 101668 |
| 423 | Ga0265316_10229308 | 3300031344 | Bacteria | 1368 |
| 424 | Ga0307516_10000051 | 3300031730 | Bacteria | 129126 |
| 425 | Ga0307405_10068585 | 3300031731 | Bacteria | 2270 |
| 426 | Ga0307410_10061941 | 3300031852 | Bacteria | 2561 |
| 427 | Ga0307410_10507802 | 3300031852 | Bacteria | 993 |
| 428 | Ga0307412_10000515 | 3300031911 | Bacteria | 23070 |
| 429 | Ga0307412_10014120 | 3300031911 | Bacteria | 4703 |
| 430 | Ga0307412_10029669 | 3300031911 | Bacteria | 3435 |
| 431 | Ga0307412_10039260 | 3300031911 | Bacteria | 3055 |
| 432 | Ga0307416_100171098 | 3300032002 | Bacteria | 2022 |
| 433 | Ga0307416_100438077 | 3300032002 | Bacteria | 1356 |
| 434 | Ga0307414_10000328 | 3300032004 | Bacteria | 27172 |
| 435 | Ga0307411_10055828 | 3300032005 | Bacteria | 2600 |
| 436 | Ga0307411_10084352 | 3300032005 | Bacteria | 2197 |
| 437 | Ga0373932_0025429 | 3300035112 | Bacteria | 1603 |
| 438 | Ga0395900_0343419 | 3300037418 | Bacteria | 1468 |
| 439 | Ga0395898_0235205 | 3300037466 | Bacteria | 1747 |
| 440 | Ga0395905_0400057 | 3300037471 | Bacteria | 1268 |
| 441 | Ga0395901_0043629 | 3300038443 | Bacteria | 4651 |
| 442 | Ga0237819_00134 | 3300038705 | Bacteria | 27766 |
| 443 | Ga0436362_1026846 | 3300039453 | Bacteria | 1359 |
| 444 | Ga0439436_0018614 | 3300041404 | Bacteria | 2076 |
| 445 | Ga0439461_0011817 | 3300041410 | Bacteria | 1625 |
| 446 | Ga0439465_0010873 | 3300041413 | Bacteria | 2855 |
| 447 | Ga0451802_0643022 | 3300041460 | Bacteria | 3891 |
| 448 | Ga0439431_0035978 | 3300041997 | Bacteria | 1245 |
| 449 | Ga0439432_021508 | 3300042006 | Bacteria | 2137 |
| 450 | Ga0439457_007618 | 3300042014 | Bacteria | 2593 |
| 451 | Ga0466964_0028108 | 3300044706 | Bacteria | 2213 |
| 452 | Ga0466968_0006657 | 3300044735 | Bacteria | 4364 |
| 453 | Ga0495627_000113 | 3300046453 | Bacteria | 100542 |
| 454 | Ga0495638_0000012 | 3300046460 | Bacteria | 435577 |
| 455 | Ga0495638_0000123 | 3300046460 | Bacteria | 125420 |
| 456 | Ga0495650_0000093 | 3300046471 | Bacteria | 221558 |
| 457 | Ga0495650_0001327 | 3300046471 | Bacteria | 24827 |
| 458 | Ga0495650_0069138 | 3300046471 | Bacteria | 1391 |
| 459 | Ga0495584_0020356 | 3300046491 | Bacteria | 3372 |
| 460 | Ga0495583_0000474 | 3300046506 | Bacteria | 58751 |
| 461 | Ga0495583_0001160 | 3300046506 | Bacteria | 28668 |
| 462 | Ga0495606_0000272 | 3300046507 | Bacteria | 90684 |
| 463 | Ga0495606_0000382 | 3300046507 | Bacteria | 75382 |
| 464 | Ga0495606_0000443 | 3300046507 | Bacteria | 67796 |
| 465 | Ga0495606_0002643 | 3300046507 | Bacteria | 20453 |
| 466 | Ga0495606_0046954 | 3300046507 | Bacteria | 2850 |
| 467 | Ga0495610_0001282 | 3300046512 | Bacteria | 22474 |
| 468 | Ga0495610_0008306 | 3300046512 | Bacteria | 6741 |
| 469 | Ga0495616_0000176 | 3300046513 | Bacteria | 54755 |
| 470 | Ga0495616_0062116 | 3300046513 | Bacteria | 1830 |
| 471 | Ga0495616_0131471 | 3300046513 | Bacteria | 1147 |
| 472 | Ga0495620_0018265 | 3300046515 | Bacteria | 3475 |
| 473 | Ga0495631_0004640 | 3300046518 | Bacteria | 7271 |
| 474 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 475 | Ga0495632_0000773 | 3300046519 | Bacteria | 28703 |
| 476 | Ga0495637_0000809 | 3300046520 | Bacteria | 20718 |
| 477 | Ga0495637_0013583 | 3300046520 | Bacteria | 3862 |
| 478 | Ga0495637_0056792 | 3300046520 | Unclassified | 1619 |
| 479 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 480 | Ga0495643_0011649 | 3300046522 | Bacteria | 5343 |
| 481 | Ga0495643_0062648 | 3300046522 | Bacteria | 1968 |
| 482 | Ga0495648_0000295 | 3300046524 | Bacteria | 55574 |
| 483 | Ga0495648_0001990 | 3300046524 | Bacteria | 19425 |
| 484 | Ga0495648_0041808 | 3300046524 | Bacteria | 2891 |
| 485 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 486 | Ga0495642_0005393 | 3300046528 | Bacteria | 4908 |
| 487 | Ga0495654_0001238 | 3300046530 | Bacteria | 18023 |
| 488 | Ga0495587_0078108 | 3300046536 | Bacteria | 1921 |
| 489 | Ga0495609_0036465 | 3300046538 | Bacteria | 2220 |
| 490 | Ga0495609_0041526 | 3300046538 | Bacteria | 2067 |
| 491 | Ga0495597_0005293 | 3300046542 | Bacteria | 6852 |
| 492 | Ga0495597_0029662 | 3300046542 | Bacteria | 2497 |
| 493 | Ga0495622_0002978 | 3300046557 | Bacteria | 8051 |
| 494 | Ga0495622_0020902 | 3300046557 | Bacteria | 3048 |
| 495 | Ga0495633_0000053 | 3300046558 | Bacteria | 152374 |
| 496 | Ga0495633_0000160 | 3300046558 | Bacteria | 88116 |
| 497 | Ga0495633_0001046 | 3300046558 | Bacteria | 22624 |
| 498 | Ga0495633_0005525 | 3300046558 | Bacteria | 7696 |
| 499 | Ga0495668_0002823 | 3300046616 | Bacteria | 13813 |
| 500 | Ga0495668_0013682 | 3300046616 | Bacteria | 4776 |
| 501 | Ga0495668_0027073 | 3300046616 | Bacteria | 3249 |
| 502 | Ga0495668_0042439 | 3300046616 | Bacteria | 2532 |
| 503 | Ga0495668_0200403 | 3300046616 | Bacteria | 1093 |
| 504 | Ga0495634_0115611 | 3300046642 | Bacteria | 1722 |
| 505 | Ga0495625_0006257 | 3300046660 | Bacteria | 10656 |
| 506 | Ga0495625_0178507 | 3300046660 | Bacteria | 1414 |
| 507 | Ga0495625_0183568 | 3300046660 | Bacteria | 1389 |
| 508 | Ga0495588_0213298 | 3300046674 | Bacteria | 1019 |
| 509 | Ga0495599_0047019 | 3300046678 | Bacteria | 2705 |
| 510 | Ga0495646_0168617 | 3300046680 | Bacteria | 1208 |
| 511 | Ga0495669_0000639 | 3300046684 | Bacteria | 15243 |
| 512 | Ga0495669_0024103 | 3300046684 | Bacteria | 2652 |
| 513 | Ga0495613_0204739 | 3300046689 | Bacteria | 1390 |
| 514 | Ga0495670_0000036 | 3300046691 | Bacteria | 78512 |
| 515 | Ga0495670_0020373 | 3300046691 | Bacteria | 3270 |
| 516 | Ga0495670_0021440 | 3300046691 | Bacteria | 3186 |
| 517 | Ga0495670_0025856 | 3300046691 | Bacteria | 2905 |
| 518 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 519 | Ga0495671_0000111 | 3300046692 | Bacteria | 72744 |
| 520 | Ga0495600_0033760 | 3300046809 | Bacteria | 3321 |
| 521 | Ga0495660_0032948 | 3300046810 | Bacteria | 2908 |
| 522 | Ga0495687_000084 | 3300047443 | Bacteria | 145072 |
| 523 | Ga0495687_052898 | 3300047443 | Bacteria | 1714 |
| 524 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 525 | Ga0495673_0007717 | 3300047469 | Bacteria | 6144 |
| 526 | Ga0495681_0000058 | 3300047470 | Bacteria | 103041 |
| 527 | Ga0495681_0002650 | 3300047470 | Bacteria | 12688 |
| 528 | Ga0495686_0000433 | 3300047472 | Bacteria | 64805 |
| 529 | Ga0495686_0002518 | 3300047472 | Bacteria | 17169 |
| 530 | Ga0495686_0010639 | 3300047472 | Bacteria | 6533 |
| 531 | Ga0495686_0045272 | 3300047472 | Bacteria | 2784 |
| 532 | Ga0495686_0047711 | 3300047472 | Bacteria | 2703 |
| 533 | Ga0496100_0147609 | 3300048903 | Bacteria | 1674 |
| 534 | Ga0496101_0351262 | 3300048904 | Bacteria | 1159 |
| 535 | Ga0496101_0363113 | 3300048904 | Bacteria | 1138 |
| 536 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 537 | Ga0496102_0000143 | 3300048905 | Bacteria | 96813 |
| 538 | Ga0496102_0508198 | 3300048905 | Bacteria | 1127 |
| 539 | Ga0496103_0000095 | 3300048906 | Bacteria | 98260 |
| 540 | Ga0496103_0000098 | 3300048906 | Bacteria | 96109 |
| 541 | Ga0496103_0000924 | 3300048906 | Bacteria | 21086 |
| 542 | Ga0496103_0015455 | 3300048906 | Bacteria | 4542 |
| 543 | Ga0496104_0019175 | 3300048907 | Bacteria | 6253 |
| 544 | Ga0496104_0129301 | 3300048907 | Bacteria | 2426 |
| 545 | Ga0496104_0152808 | 3300048907 | Bacteria | 2215 |
| 546 | Ga0496105_0189572 | 3300048908 | Bacteria | 1682 |
| 547 | Ga0496105_0381490 | 3300048908 | Bacteria | 1121 |
| 548 | Ga0496106_0013364 | 3300048909 | Bacteria | 6061 |
| 549 | Ga0496106_0091425 | 3300048909 | Bacteria | 2350 |
| 550 | Ga0496106_0097613 | 3300048909 | Bacteria | 2275 |
| 551 | Ga0496108_0006555 | 3300048911 | Bacteria | 9443 |
| 552 | Ga0496109_0023726 | 3300048912 | Bacteria | 5445 |
| 553 | Ga0496110_0070177 | 3300048913 | Bacteria | 3104 |
| 554 | Ga0496110_0130597 | 3300048913 | Bacteria | 2268 |
| 555 | Ga0496111_0226626 | 3300048914 | Bacteria | 1388 |
| 556 | Ga0496112_0002555 | 3300048915 | Bacteria | 14702 |
| 557 | Ga0496112_0004022 | 3300048915 | Bacteria | 12332 |
| 558 | Ga0496113_0000022 | 3300048916 | Bacteria | 68269 |
| 559 | Ga0496113_0023762 | 3300048916 | Bacteria | 4349 |
| 560 | Ga0496113_0107503 | 3300048916 | Bacteria | 2168 |
| 561 | Ga0496113_0361267 | 3300048916 | Bacteria | 1165 |
| 562 | Ga0496114_0082909 | 3300048917 | Bacteria | 2711 |
| 563 | Ga0496115_0069307 | 3300048918 | Bacteria | 2856 |
| 564 | Ga0496116_0001473 | 3300048919 | Bacteria | 26338 |
| 565 | Ga0496116_0052511 | 3300048919 | Bacteria | 2700 |
| 566 | Ga0496116_0066591 | 3300048919 | Bacteria | 2304 |
| 567 | Ga0496117_0000121 | 3300048920 | Bacteria | 171532 |
| 568 | Ga0496117_0002347 | 3300048920 | Bacteria | 24194 |
| 569 | Ga0496117_0004218 | 3300048920 | Bacteria | 16055 |
| 570 | Ga0496117_0013111 | 3300048920 | Bacteria | 7255 |
| 571 | Ga0496117_0034039 | 3300048920 | Bacteria | 3845 |
| 572 | Ga0496118_0000095 | 3300048921 | Bacteria | 164850 |
| 573 | Ga0496118_0002332 | 3300048921 | Bacteria | 25731 |
| 574 | Ga0496118_0004877 | 3300048921 | Bacteria | 15615 |
| 575 | Ga0496118_0004878 | 3300048921 | Bacteria | 15615 |
| 576 | Ga0496118_0029869 | 3300048921 | Bacteria | 4562 |
| 577 | Ga0496118_0064346 | 3300048921 | Bacteria | 2692 |
| 578 | Ga0496118_0118962 | 3300048921 | Bacteria | 1728 |
| 579 | Ga0496118_0124746 | 3300048921 | Bacteria | 1669 |
| 580 | Ga0496118_0143926 | 3300048921 | Bacteria | 1505 |
| 581 | Ga0496119_0001217 | 3300048922 | Bacteria | 32132 |
| 582 | Ga0496119_0014522 | 3300048922 | Bacteria | 6153 |
| 583 | Ga0496119_0026090 | 3300048922 | Bacteria | 4061 |
| 584 | Ga0496119_0042198 | 3300048922 | Bacteria | 2896 |
| 585 | Ga0496119_0141446 | 3300048922 | Bacteria | 1299 |
| 586 | Ga0496120_0029409 | 3300048923 | Bacteria | 3354 |
| 587 | Ga0496121_0000272 | 3300048924 | Bacteria | 108051 |
| 588 | Ga0496121_0004371 | 3300048924 | Bacteria | 19103 |
| 589 | Ga0496121_0004952 | 3300048924 | Bacteria | 17471 |
| 590 | Ga0496121_0028429 | 3300048924 | Bacteria | 5203 |
| 591 | Ga0496121_0029618 | 3300048924 | Bacteria | 5055 |
| 592 | Ga0496121_0029998 | 3300048924 | Bacteria | 5006 |
| 593 | Ga0496122_0054539 | 3300048925 | Bacteria | 3001 |
| 594 | Ga0496122_0065917 | 3300048925 | Bacteria | 2621 |
| 595 | Ga0496122_0121086 | 3300048925 | Bacteria | 1687 |
| 596 | Ga0496122_0189059 | 3300048925 | Bacteria | 1218 |
| 597 | Ga0496123_0010012 | 3300048926 | Bacteria | 8446 |
| 598 | Ga0496123_0025209 | 3300048926 | Bacteria | 4490 |
| 599 | Ga0496123_0058779 | 3300048926 | Bacteria | 2491 |
| 600 | Ga0496123_0091348 | 3300048926 | Bacteria | 1806 |
| 601 | Ga0496123_0151834 | 3300048926 | Bacteria | 1248 |
| 602 | Ga0496123_0169219 | 3300048926 | Bacteria | 1155 |
| 603 | Ga0496124_0000119 | 3300048927 | Bacteria | 163996 |
| 604 | Ga0496124_0000417 | 3300048927 | Bacteria | 76104 |
| 605 | Ga0496124_0005450 | 3300048927 | Bacteria | 14302 |
| 606 | Ga0496124_0113541 | 3300048927 | Bacteria | 2176 |
| 607 | Ga0496124_0117893 | 3300048927 | Bacteria | 2126 |
| 608 | Ga0496125_0000953 | 3300048928 | Bacteria | 45480 |
| 609 | Ga0496125_0002341 | 3300048928 | Bacteria | 24847 |
| 610 | Ga0496125_0012810 | 3300048928 | Bacteria | 8291 |
| 611 | Ga0496125_0064504 | 3300048928 | Bacteria | 2910 |
| 612 | Ga0496125_0076259 | 3300048928 | Bacteria | 2589 |
| 613 | Ga0496126_0009286 | 3300048929 | Bacteria | 10475 |
| 614 | Ga0496126_0042375 | 3300048929 | Bacteria | 4204 |
| 615 | Ga0496126_0059050 | 3300048929 | Bacteria | 3455 |
| 616 | Ga0496126_0310704 | 3300048929 | Bacteria | 1298 |
| 617 | Ga0495678_069590 | 3300049459 | Bacteria | 1294 |
| 618 | Ga0495682_0006896 | 3300049460 | Bacteria | 4564 |
| 619 | Ga0501335_003397 | 3300049551 | Bacteria | 1347 |
| 620 | Ga0501034_0061308 | 3300049571 | Bacteria | 3777 |
| 621 | Ga0501070_0413397 | 3300049586 | Bacteria | 1090 |
| 622 | Ga0501198_011888 | 3300049649 | Bacteria | 1304 |
| 623 | Ga0501211_001542 | 3300049658 | Bacteria | 2468 |
| 624 | Ga0501223_000006 | 3300049663 | Bacteria | 133378 |
| 625 | Ga0501223_000100 | 3300049663 | Bacteria | 24668 |
| 626 | Ga0501224_000002 | 3300049664 | Bacteria | 229331 |
| 627 | Ga0501233_000375 | 3300049668 | Bacteria | 7069 |
| 628 | Ga0501235_000453 | 3300049669 | Bacteria | 8013 |
| 629 | Ga0501235_000617 | 3300049669 | Bacteria | 7167 |
| 630 | Ga0501246_000655 | 3300049676 | Bacteria | 2532 |
| 631 | Ga0501249_000095 | 3300049679 | Bacteria | 27655 |
| 632 | Ga0501225_0000032 | 3300049705 | Bacteria | 47166 |
| 633 | Ga0501225_0000120 | 3300049705 | Bacteria | 24331 |
| 634 | Ga0501225_0001607 | 3300049705 | Bacteria | 7065 |
| 635 | Ga0501225_0030924 | 3300049705 | Bacteria | 1473 |
| 636 | Ga0501234_000367 | 3300049707 | Bacteria | 6686 |
| 637 | Ga0501204_002066 | 3300049850 | Bacteria | 2021 |
| 638 | Ga0501226_000089 | 3300049853 | Bacteria | 25215 |
| 639 | nmdc:mga03683_1401_c1 | 3300050489 | Bacteria | 7178 |
| 640 | nmdc:mga03n38_3421_c1 | 3300050490 | Bacteria | 5094 |
| 641 | nmdc:mga00v17_59624_c1 | 3300050491 | Bacteria | 2342 |
| 642 | nmdc:mga00v17_9340_c1 | 3300050491 | Bacteria | 5302 |
| 643 | nmdc:mga0yw44_5062_c1 | 3300050492 | Bacteria | 4537 |
| 644 | nmdc:mga0yw44_76938_c1 | 3300050492 | Bacteria | 2084 |
| 645 | nmdc:mga06z11_100_c1 | 3300050494 | Bacteria | 36184 |
| 646 | nmdc:mga06z11_108_c1 | 3300050494 | Bacteria | 33977 |
| 647 | nmdc:mga04h51_11_c1 | 3300050495 | Bacteria | 101578 |
| 648 | nmdc:mga04h51_181_c1 | 3300050495 | Bacteria | 17738 |
| 649 | nmdc:mga07m45_114364_c1 | 3300050496 | Bacteria | 1556 |
| 650 | nmdc:mga07m45_15_c1 | 3300050496 | Bacteria | 152740 |
| 651 | nmdc:mga07m45_31802_c1 | 3300050496 | Bacteria | 2924 |
| 652 | nmdc:mga07m45_4041_c1 | 3300050496 | Bacteria | 7146 |
| 653 | nmdc:mga07m45_40709_c1 | 3300050496 | Bacteria | 2600 |
| 654 | nmdc:mga0qj67_27752_c1 | 3300050509 | Bacteria | 4390 |
| 655 | nmdc:mga0sz30_109_c1 | 3300050516 | Bacteria | 31084 |
| 656 | nmdc:mga0sz30_36836_c1 | 3300050516 | Bacteria | 2046 |
| 657 | Ga0500578_0020670 | 3300053086 | Bacteria | 4232 |
| 658 | Ga0500651_0039143 | 3300053093 | Bacteria | 2986 |
| 659 | Ga0500651_0163430 | 3300053093 | Bacteria | 1330 |
| 660 | Ga0500566_0007265 | 3300053094 | Bacteria | 6565 |
| 661 | Ga0500566_0014559 | 3300053094 | Bacteria | 4622 |
| 662 | Ga0500566_0059490 | 3300053094 | Bacteria | 2166 |
| 663 | Ga0500650_0006230 | 3300053098 | Bacteria | 4533 |
| 664 | Ga0500555_000477 | 3300053103 | Bacteria | 16617 |
| 665 | Ga0500555_064078 | 3300053103 | Bacteria | 982 |
| 666 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 667 | Ga0500569_013432 | 3300053109 | Bacteria | 2004 |
| 668 | Ga0500595_005233 | 3300053119 | Bacteria | 5685 |
| 669 | Ga0500607_000065 | 3300053121 | Bacteria | 74437 |
| 670 | Ga0500607_000168 | 3300053121 | Bacteria | 57382 |
| 671 | Ga0500607_030204 | 3300053121 | Bacteria | 2989 |
| 672 | Ga0500608_025822 | 3300053122 | Bacteria | 2753 |
| 673 | Ga0500618_000092 | 3300053125 | Bacteria | 73216 |
| 674 | Ga0500618_004379 | 3300053125 | Bacteria | 4538 |
| 675 | Ga0500618_014931 | 3300053125 | Bacteria | 1973 |
| 676 | Ga0500618_035729 | 3300053125 | Bacteria | 1153 |
| 677 | Ga0500642_0000035 | 3300053130 | Bacteria | 106656 |
| 678 | Ga0500642_0001609 | 3300053130 | Bacteria | 6511 |
| 679 | Ga0500652_000134 | 3300053131 | Bacteria | 27819 |
| 680 | Ga0500655_000399 | 3300053133 | Bacteria | 9184 |
| 681 | Ga0500658_0000598 | 3300053134 | Bacteria | 14978 |
| 682 | Ga0500559_0000668 | 3300053136 | Bacteria | 22938 |
| 683 | Ga0500559_0001329 | 3300053136 | Bacteria | 14235 |
| 684 | Ga0500559_0002950 | 3300053136 | Bacteria | 8556 |
| 685 | Ga0500559_0030167 | 3300053136 | Bacteria | 2324 |
| 686 | Ga0500559_0049447 | 3300053136 | Bacteria | 1852 |
| 687 | Ga0500559_0068225 | 3300053136 | Bacteria | 1597 |
| 688 | Ga0500568_0003427 | 3300053139 | Bacteria | 8842 |
| 689 | Ga0500568_0015006 | 3300053139 | Plasmid | 3477 |
| 690 | Ga0500568_0033607 | 3300053139 | Bacteria | 2104 |
| 691 | Ga0500568_0066066 | 3300053139 | Bacteria | 1391 |
| 692 | Ga0500577_0000483 | 3300053142 | Bacteria | 10273 |
| 693 | Ga0500577_0004181 | 3300053142 | Bacteria | 3797 |
| 694 | Ga0500590_043419 | 3300053148 | Bacteria | 2306 |
| 695 | Ga0500590_062176 | 3300053148 | Bacteria | 1874 |
| 696 | Ga0500604_0006540 | 3300053151 | Bacteria | 3082 |
| 697 | Ga0500604_0035841 | 3300053151 | Bacteria | 1477 |
| 698 | Ga0500604_0087397 | 3300053151 | Bacteria | 1014 |
| 699 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 700 | Ga0500622_0001122 | 3300053156 | Bacteria | 22313 |
| 701 | Ga0500622_0001260 | 3300053156 | Bacteria | 20664 |
| 702 | Ga0500622_0004003 | 3300053156 | Bacteria | 9497 |
| 703 | Ga0500622_0020907 | 3300053156 | Bacteria | 3473 |
| 704 | Ga0500624_000018 | 3300053157 | Bacteria | 131677 |
| 705 | Ga0500624_000182 | 3300053157 | Bacteria | 24939 |
| 706 | Ga0500624_000205 | 3300053157 | Bacteria | 22830 |
| 707 | Ga0500627_0000687 | 3300053158 | Bacteria | 8973 |
| 708 | Ga0500627_0003265 | 3300053158 | Bacteria | 4989 |
| 709 | Ga0500633_0001786 | 3300053160 | Bacteria | 4207 |
| 710 | Ga0500634_0076613 | 3300053161 | Bacteria | 1735 |
| 711 | Ga0500636_0009686 | 3300053177 | Bacteria | 5608 |
| 712 | Ga0500636_0051013 | 3300053177 | Bacteria | 2432 |
| 713 | Ga0500637_0020659 | 3300053178 | Bacteria | 3569 |
| 714 | Ga0500637_0044358 | 3300053178 | Bacteria | 2519 |
| 715 | Ga0500567_002415 | 3300053723 | Bacteria | 8001 |
| 716 | Ga0500570_000052 | 3300053724 | Bacteria | 28845 |
| 717 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 718 | Ga0500645_006451 | 3300053730 | Bacteria | 4186 |
| 719 | Ga0500645_007832 | 3300053730 | Bacteria | 3693 |
| 720 | Ga0500661_015067 | 3300055283 | Bacteria | 1388 |
| 721 | 2512644270 | 2512564014 | Bacteria | 4639632 |
| 722 | 2603861073 | 2602042107 | Bacteria | 6226103 |
| 723 | 2644036830 | 2643221605 | Bacteria | 4772303 |
| 724 | 2739650098 | 2739367664 | Bacteria | 4114334 |
| 725 | 2740028571 | 2739367865 | Bacteria | 4114482 |
| 726 | 2753766278 | 2751185897 | Bacteria | 5322941 |
| 727 | 2778126989 | 2775507255 | Bacteria | 3945731 |
| 728 | 2809078669 | 2808606404 | Bacteria | 4652788 |
| 729 | 2809083036 | 2808606405 | Bacteria | 4586632 |
| 730 | 2857528800 | 2857524615 | Bacteria | 6615449 |
| 731 | 2880521547 | 2880518877 | Bacteria | 5012590 |
| 732 | 2893068994 | 2893066018 | Bacteria | 6158120 |
| 733 | 2919079227 | 2919073203 | Bacteria | 6531949 |
| 734 | 2919140998 | 2919138771 | Bacteria | 5281312 |
| 735 | 2919711065 | 2919709256 | Bacteria | 4318106 |
| 736 | 2929200432 | 2929199973 | Bacteria | 7260745 |
| 737 | 8055914748 | 8055909800 | Bacteria | 7278581 |
| 738 | Ga0500597_034210 | |||
| 739 | SwRhRL2b_contig_1233908 | |||
| 740 | SwRhRL2b_contig_3308639 | |||
| 741 | JGI24736J21556_1000004 | |||
| 742 | JGI24736J21556_1000158 | |||
| 743 | JGI24741J21665_1000027 | |||
| 744 | JGI24740J21852_10005199 | |||
| 745 | JGI24740J21852_10009996 | |||
| 746 | JGI24739J22299_10006854 | |||
| 747 | JGI24739J22299_10018201 | |||
| 748 | JGI24737J22298_10003710 | |||
| 749 | JGI24737J22298_10005046 | |||
| 750 | JGI24737J22298_10009302 | |||
| 751 | JGI24743J22301_10006315 | |||
| 752 | JGI24735J21928_10002350 | |||
| 753 | JGI24735J21928_10005878 | |||
| 754 | JGI24750J21931_1000060 | |||
| 755 | JGI24748J21848_1000083 | |||
| 756 | JGI24738J21930_10000860 | |||
| 757 | JGI24738J21930_10028035 | |||
| 758 | JGI24749J21850_1000053 | |||
| 759 | JGI24749J21850_1000625 | |||
| 760 | JGI24744J21845_10014295 | |||
| 761 | JGI24034J26672_10000021 | |||
| 762 | JGI24742J22300_10005615 | |||
| 763 | JGI24751J29686_10000172 | |||
| 764 | JGI24751J29686_10003922 | |||
| 765 | JGI25150J39212_1000313 | |||
| 766 | JGI25153J46596_10000027 | |||
| 767 | Ga0055542_1005309 | |||
| 768 | Ga0055526_1006101 | |||
| 769 | Ga0055536_1000580 | |||
| 770 | Ga0055530_10000017 | |||
| 771 | Ga0055530_10000638 | |||
| 772 | Ga0055530_10013388 | |||
| 773 | Ga0055540_1003210 | |||
| 774 | Ga0055531_10000129 | |||
| 775 | Ga0055531_10000640 | |||
| 776 | Ga0055531_10030489 | |||
| 777 | Ga0065165_1001477 | |||
| 778 | Ga0065165_1032230 | |||
| 779 | Ga0065704_10016101 | |||
| 780 | Ga0065704_10024609 | |||
| 781 | Ga0065704_10027091 | |||
| 782 | Ga0065704_10070288 | |||
| 783 | Ga0065704_10070363 | |||
| 784 | Ga0065704_10081727 | |||
| 785 | Ga0065704_10090763 | |||
| 786 | Ga0065707_10004435 | |||
| 787 | Ga0065707_10081814 | |||
| 788 | Ga0065707_10091000 | |||
| 789 | Ga0070658_10000678 | |||
| 790 | Ga0070658_10007974 | |||
| 791 | Ga0070676_10000947 | |||
| 792 | Ga0070676_10264286 | |||
| 793 | Ga0070683_100308388 | |||
| 794 | Ga0070690_100000005 | |||
| 795 | Ga0070690_100021439 | |||
| 796 | Ga0070670_100000008 | |||
| 797 | Ga0070670_100048027 | |||
| 798 | Ga0068869_100036969 | |||
| 799 | Ga0070666_10000021 | |||
| 800 | Ga0070666_10271778 | |||
| 801 | Ga0070680_100037860 | |||
| 802 | Ga0068868_100008798 | |||
| 803 | Ga0070660_100058904 | |||
| 804 | Ga0070660_100238560 | |||
| 805 | Ga0070661_100088897 | |||
| 806 | Ga0070668_100000172 | |||
| 807 | Ga0070668_100046209 | |||
| 808 | Ga0070668_100069013 | |||
| 809 | Ga0070668_100101697 | |||
| 810 | Ga0070669_100000045 | |||
| 811 | Ga0070669_100000357 | |||
| 812 | Ga0070669_100000362 | |||
| 813 | Ga0070669_100057186 | |||
| 814 | Ga0070669_100091330 | |||
| 815 | Ga0070669_100094664 | |||
| 816 | Ga0070671_100001370 | |||
| 817 | Ga0070671_100005700 | |||
| 818 | Ga0070671_100058641 | |||
| 819 | Ga0070671_100084707 | |||
| 820 | Ga0070671_100182132 | |||
| 821 | Ga0070671_100506634 | |||
| 822 | Ga0070674_100031853 | |||
| 823 | Ga0070674_100107308 | |||
| 824 | Ga0070673_100000009 | |||
| 825 | Ga0070659_100031293 | |||
| 826 | Ga0070659_100093398 | |||
| 827 | Ga0070659_100624851 | |||
| 828 | Ga0070667_100000199 | |||
| 829 | Ga0070667_100000552 | |||
| 830 | Ga0070667_100000635 | |||
| 831 | Ga0070667_100004904 | |||
| 832 | Ga0070705_100065893 | |||
| 833 | Ga0070663_100016515 | |||
| 834 | Ga0070663_100047309 | |||
| 835 | Ga0070663_100053630 | |||
| 836 | Ga0070681_10104220 | |||
| 837 | Ga0068867_100000002 | |||
| 838 | Ga0070685_10031457 | |||
| 839 | Ga0070679_100008895 | |||
| 840 | Ga0068853_100001276 | |||
| 841 | Ga0068853_100079368 | |||
| 842 | Ga0070686_100000001 | |||
| 843 | Ga0070686_100349754 | |||
| 844 | Ga0070665_100006376 | |||
| 845 | Ga0070665_100053577 | |||
| 846 | Ga0070665_100086809 | |||
| 847 | Ga0070704_100074562 | |||
| 848 | Ga0068855_100001880 | |||
| 849 | Ga0068855_100033473 | |||
| 850 | Ga0068855_100055513 | |||
| 851 | Ga0068855_100071686 | |||
| 852 | Ga0068855_100451480 | |||
| 853 | Ga0070664_100080535 | |||
| 854 | Ga0070664_100336447 | |||
| 855 | Ga0068857_100300966 | |||
| 856 | Ga0068857_100523521 | |||
| 857 | Ga0068854_100006328 | |||
| 858 | Ga0068854_100170689 | |||
| 859 | Ga0068856_100175056 | |||
| 860 | Ga0068856_100802469 | |||
| 861 | Ga0068852_100034855 | |||
| 862 | Ga0068859_100217309 | |||
| 863 | Ga0068859_100384209 | |||
| 864 | Ga0068864_100000476 | |||
| 865 | Ga0068864_100005296 | |||
| 866 | Ga0068864_100037970 | |||
| 867 | Ga0068864_100070930 | |||
| 868 | Ga0068861_100001596 | |||
| 869 | Ga0068861_100166470 | |||
| 870 | Ga0068861_100430605 | |||
| 871 | Ga0068851_10013340 | |||
| 872 | Ga0068851_10180067 | |||
| 873 | Ga0068863_100000029 | |||
| 874 | Ga0068863_100000046 | |||
| 875 | Ga0068863_100004290 | |||
| 876 | Ga0068863_100042061 | |||
| 877 | Ga0068863_100051764 | |||
| 878 | Ga0068858_100019555 | |||
| 879 | Ga0068858_100326910 | |||
| 880 | Ga0068860_100000084 | |||
| 881 | Ga0068860_100000288 | |||
| 882 | Ga0068860_100013683 | |||
| 883 | Ga0068860_100015185 | |||
| 884 | Ga0068862_100001635 | |||
| 885 | Ga0068862_100023508 | |||
| 886 | Ga0068862_100189389 | |||
| 887 | Ga0075368_10000225 | |||
| 888 | Ga0075368_10000346 | |||
| 889 | Ga0075368_10096929 | |||
| 890 | Ga0075363_100074097 | |||
| 891 | Ga0075364_10013544 | |||
| 892 | Ga0075364_10227958 | |||
| 893 | Ga0075362_10007630 | |||
| 894 | Ga0075367_10001261 | |||
| 895 | Ga0075367_10037372 | |||
| 896 | Ga0075367_10045197 | |||
| 897 | Ga0075369_10013681 | |||
| 898 | Ga0075366_10083426 | |||
| 899 | Ga0097621_100174042 | |||
| 900 | Ga0075370_10002969 | |||
| 901 | Ga0075370_10008165 | |||
| 902 | Ga0075370_10151124 | |||
| 903 | Ga0075430_100009875 | |||
| 904 | Ga0068865_100000905 | |||
| 905 | Ga0068865_100134524 | |||
| 906 | Ga0068865_100161765 | |||
| 907 | Ga0097620_100016987 | |||
| 908 | Ga0097620_100217304 | |||
| 909 | Ga0097620_100384209 | |||
| 910 | Ga0079104_1027728 | |||
| 911 | Ga0105251_10001436 | |||
| 912 | Ga0105240_10000052 | |||
| 913 | Ga0105240_10001171 | |||
| 914 | Ga0105240_10016191 | |||
| 915 | Ga0105240_10128111 | |||
| 916 | Ga0105245_10162780 | |||
| 917 | Ga0105247_10000842 | |||
| 918 | Ga0105247_10034498 | |||
| 919 | Ga0105243_10002796 | |||
| 920 | Ga0105243_10036973 | |||
| 921 | Ga0105241_10138735 | |||
| 922 | Ga0105241_10242760 | |||
| 923 | Ga0105242_10000742 | |||
| 924 | Ga0105248_10002057 | |||
| 925 | Ga0105248_10287345 | |||
| 926 | Ga0105248_10344681 | |||
| 927 | Ga0105237_10016895 | |||
| 928 | Ga0105237_10020246 | |||
| 929 | Ga0105237_10069377 | |||
| 930 | Ga0105237_10072066 | |||
| 931 | Ga0105237_10077788 | |||
| 932 | Ga0105237_10122496 | |||
| 933 | Ga0105237_10263128 | |||
| 934 | Ga0105238_10188550 | |||
| 935 | Ga0105238_10438722 | |||
| 936 | Ga0105249_10000047 | |||
| 937 | Ga0105249_10045356 | |||
| 938 | Ga0105249_10199350 | |||
| 939 | Ga0105249_10308035 | |||
| 940 | Ga0105148_100009 | |||
| 941 | Ga0105148_100052 | |||
| 942 | Ga0105239_10005594 | |||
| 943 | Ga0105239_10045376 | |||
| 944 | Ga0105239_10115174 | |||
| 945 | Ga0105239_10447254 | |||
| 946 | Ga0105239_10677694 | |||
| 947 | Ga0157326_1000840 | |||
| 948 | Ga0157373_10029414 | |||
| 949 | Ga0157371_10235102 | |||
| 950 | Ga0157370_10272263 | |||
| 951 | Ga0157369_10006710 | |||
| 952 | Ga0157369_10081086 | |||
| 953 | Ga0157369_10107360 | |||
| 954 | Ga0157374_10241537 | |||
| 955 | Ga0157374_10369448 | |||
| 956 | Ga0157378_10000484 | |||
| 957 | Ga0157378_10016172 | |||
| 958 | Ga0157378_10232488 | |||
| 959 | Ga0163162_10005403 | |||
| 960 | Ga0163162_10031244 | |||
| 961 | Ga0163162_10298101 | |||
| 962 | Ga0157372_10125236 | |||
| 963 | Ga0157375_10001290 | |||
| 964 | Ga0163163_10004110 | |||
| 965 | Ga0163163_10061962 | |||
| 966 | Ga0163163_10146244 | |||
| 967 | Ga0163163_10182414 | |||
| 968 | Ga0157380_10000062 | |||
| 969 | Ga0157380_10000995 | |||
| 970 | Ga0157380_10002327 | |||
| 971 | Ga0157380_10027469 | |||
| 972 | Ga0157380_10433192 | |||
| 973 | Ga0157379_10083461 | |||
| 974 | Ga0157376_10000134 | |||
| 975 | Ga0157376_10673620 | |||
| 976 | Ga0163161_10001074 | |||
| 977 | Ga0163161_10029919 | |||
| 978 | Ga0209674_109404 | |||
| 979 | Ga0209147_101472 | |||
| 980 | Ga0207425_1000005 | |||
| 981 | Ga0209148_1000147 | |||
| 982 | Ga0209129_1002457 | |||
| 983 | Ga0209565_1000231 | |||
| 984 | Ga0209455_1011583 | |||
| 985 | Ga0209675_1000089 | |||
| 986 | Ga0209676_1000212 | |||
| 987 | Ga0209676_1013374 | |||
| 988 | Ga0209025_1000515 | |||
| 989 | Ga0209564_1000164 | |||
| 990 | Ga0209564_1000619 | |||
| 991 | Ga0209564_1026360 | |||
| 992 | Ga0209758_1000002 | |||
| 993 | Ga0209050_1000001 | |||
| 994 | Ga0209050_1000010 | |||
| 995 | Ga0209050_1000068 | |||
| 996 | Ga0209050_1000483 | |||
| 997 | Ga0209051_1000817 | |||
| 998 | Ga0209257_1000027 | |||
| 999 | Ga0209257_1000193 | |||
| 1000 | Ga0209257_1005709 | |||
| 1001 | Ga0209257_1005767 | |||
| 1002 | Ga0209257_1008265 | |||
| 1003 | Ga0207697_10104306 | |||
| 1004 | Ga0207656_10037846 | |||
| 1005 | Ga0207656_10129298 | |||
| 1006 | Ga0207696_1005813 | |||
| 1007 | Ga0207713_1000601 | |||
| 1008 | Ga0207713_1025852 | |||
| 1009 | Ga0207713_1104579 | |||
| 1010 | Ga0207710_10002403 | |||
| 1011 | Ga0207710_10087567 | |||
| 1012 | Ga0207680_10000008 | |||
| 1013 | Ga0207680_10013563 | |||
| 1014 | Ga0207680_10034005 | |||
| 1015 | Ga0207680_10099163 | |||
| 1016 | Ga0207647_10000952 | |||
| 1017 | Ga0207647_10050376 | |||
| 1018 | Ga0207645_10004724 | |||
| 1019 | Ga0207643_10059265 | |||
| 1020 | Ga0207705_10000432 | |||
| 1021 | Ga0207705_10038693 | |||
| 1022 | Ga0207705_10178134 | |||
| 1023 | Ga0207654_10000698 | |||
| 1024 | Ga0207654_10076219 | |||
| 1025 | Ga0207654_10118246 | |||
| 1026 | Ga0207695_10000122 | |||
| 1027 | Ga0207695_10002374 | |||
| 1028 | Ga0207695_10002631 | |||
| 1029 | Ga0207695_10003217 | |||
| 1030 | Ga0207695_10008302 | |||
| 1031 | Ga0207695_10043228 | |||
| 1032 | Ga0207695_10100988 | |||
| 1033 | Ga0207671_10002254 | |||
| 1034 | Ga0207671_10140602 | |||
| 1035 | Ga0207657_10046566 | |||
| 1036 | Ga0207657_10048987 | |||
| 1037 | Ga0207657_10097168 | |||
| 1038 | Ga0207652_10038327 | |||
| 1039 | Ga0207681_10000022 | |||
| 1040 | Ga0207681_10000321 | |||
| 1041 | Ga0207681_10055994 | |||
| 1042 | Ga0207681_10082706 | |||
| 1043 | Ga0207681_10087461 | |||
| 1044 | Ga0207694_10001423 | |||
| 1045 | Ga0207694_10206858 | |||
| 1046 | Ga0207694_10376114 | |||
| 1047 | Ga0207650_10000019 | |||
| 1048 | Ga0207650_10000020 | |||
| 1049 | Ga0207650_10122540 | |||
| 1050 | Ga0207650_10232956 | |||
| 1051 | Ga0207650_10296167 | |||
| 1052 | Ga0207650_10578492 | |||
| 1053 | Ga0207687_10484789 | |||
| 1054 | Ga0207644_10000318 | |||
| 1055 | Ga0207644_10003990 | |||
| 1056 | Ga0207644_10007674 | |||
| 1057 | Ga0207644_10039068 | |||
| 1058 | Ga0207644_10165761 | |||
| 1059 | Ga0207644_10176310 | |||
| 1060 | Ga0207644_10336098 | |||
| 1061 | Ga0207706_10005149 | |||
| 1062 | Ga0207706_10022957 | |||
| 1063 | Ga0207706_10239128 | |||
| 1064 | Ga0207686_10021120 | |||
| 1065 | Ga0207686_10095554 | |||
| 1066 | Ga0207709_10000066 | |||
| 1067 | Ga0207670_10001974 | |||
| 1068 | Ga0207669_10126409 | |||
| 1069 | Ga0207704_10000002 | |||
| 1070 | Ga0207704_10000007 | |||
| 1071 | Ga0207704_10082966 | |||
| 1072 | Ga0207704_10273171 | |||
| 1073 | Ga0207711_10000838 | |||
| 1074 | Ga0207711_10000889 | |||
| 1075 | Ga0207711_10020165 | |||
| 1076 | Ga0207711_10057297 | |||
| 1077 | Ga0207711_10193183 | |||
| 1078 | Ga0207689_10097142 | |||
| 1079 | Ga0207689_10125075 | |||
| 1080 | Ga0207667_10000343 | |||
| 1081 | Ga0207667_10003138 | |||
| 1082 | Ga0207667_10016393 | |||
| 1083 | Ga0207667_10019137 | |||
| 1084 | Ga0207667_10138056 | |||
| 1085 | Ga0207651_10000004 | |||
| 1086 | Ga0207712_10000009 | |||
| 1087 | Ga0207712_10000508 | |||
| 1088 | Ga0207712_10598853 | |||
| 1089 | Ga0207668_10000313 | |||
| 1090 | Ga0207668_10010339 | |||
| 1091 | Ga0207668_10014571 | |||
| 1092 | Ga0207668_10033540 | |||
| 1093 | Ga0207668_10041609 | |||
| 1094 | Ga0207668_10043901 | |||
| 1095 | Ga0207668_10051540 | |||
| 1096 | Ga0207668_10343950 | |||
| 1097 | Ga0207640_10009834 | |||
| 1098 | Ga0207640_10068894 | |||
| 1099 | Ga0207658_10000159 | |||
| 1100 | Ga0207658_10000332 | |||
| 1101 | Ga0207658_10001467 | |||
| 1102 | Ga0207658_10002324 | |||
| 1103 | Ga0207658_10023400 | |||
| 1104 | Ga0207658_10085721 | |||
| 1105 | Ga0207677_10000060 | |||
| 1106 | Ga0207703_10071066 | |||
| 1107 | Ga0207703_10124791 | |||
| 1108 | Ga0207639_10004001 | |||
| 1109 | Ga0207639_10124821 | |||
| 1110 | Ga0207678_10002216 | |||
| 1111 | Ga0207678_10004471 | |||
| 1112 | Ga0207678_10005410 | |||
| 1113 | Ga0207702_10001800 | |||
| 1114 | Ga0207702_10012724 | |||
| 1115 | Ga0207641_10000049 | |||
| 1116 | Ga0207641_10000517 | |||
| 1117 | Ga0207641_10001931 | |||
| 1118 | Ga0207641_10003674 | |||
| 1119 | Ga0207641_10027854 | |||
| 1120 | Ga0207641_10157734 | |||
| 1121 | Ga0207648_10000003 | |||
| 1122 | Ga0207676_10000022 | |||
| 1123 | Ga0207676_10001436 | |||
| 1124 | Ga0207676_10135394 | |||
| 1125 | Ga0207676_10257235 | |||
| 1126 | Ga0207674_10025551 | |||
| 1127 | Ga0207674_10056234 | |||
| 1128 | Ga0207674_10057470 | |||
| 1129 | Ga0207674_10204851 | |||
| 1130 | Ga0207675_100000841 | |||
| 1131 | Ga0207675_100013085 | |||
| 1132 | Ga0207675_100215995 | |||
| 1133 | Ga0207675_100630334 | |||
| 1134 | Ga0207683_10053530 | |||
| 1135 | Ga0207698_10032795 | |||
| 1136 | Ga0207698_10061912 | |||
| 1137 | Ga0207698_10105310 | |||
| 1138 | Ga0209281_1025812 | |||
| 1139 | Ga0209813_10000180 | |||
| 1140 | Ga0209813_10000872 | |||
| 1141 | Ga0268266_10000341 | |||
| 1142 | Ga0268266_10054982 | |||
| 1143 | Ga0268266_10092933 | |||
| 1144 | Ga0268266_10210882 | |||
| 1145 | Ga0268265_10001114 | |||
| 1146 | Ga0268265_10003238 | |||
| 1147 | Ga0268265_10005512 | |||
| 1148 | Ga0268265_10040218 | |||
| 1149 | Ga0268265_10089087 | |||
| 1150 | Ga0268265_10152606 | |||
| 1151 | Ga0268264_10000003 | |||
| 1152 | Ga0268264_10000342 | |||
| 1153 | Ga0268264_10006007 | |||
| 1154 | Ga0268264_10006643 | |||
| 1155 | Ga0268264_10011266 | |||
| 1156 | Ga0268264_10062999 | |||
| 1157 | Ga0307515_10001181 | |||
| 1158 | Ga0307515_10133963 | |||
| 1159 | Ga0265327_10000275 | |||
| 1160 | Ga0265316_10229308 | |||
| 1161 | Ga0307516_10000051 | |||
| 1162 | Ga0307405_10068585 | |||
| 1163 | Ga0307410_10061941 | |||
| 1164 | Ga0307410_10507802 | |||
| 1165 | Ga0307412_10000515 | |||
| 1166 | Ga0307412_10014120 | |||
| 1167 | Ga0307412_10029669 | |||
| 1168 | Ga0307412_10039260 | |||
| 1169 | Ga0307416_100171098 | |||
| 1170 | Ga0307416_100438077 | |||
| 1171 | Ga0307414_10000328 | |||
| 1172 | Ga0307411_10055828 | |||
| 1173 | Ga0307411_10084352 | |||
| 1174 | Ga0373932_0025429 | |||
| 1175 | Ga0395900_0343419 | |||
| 1176 | Ga0395898_0235205 | |||
| 1177 | Ga0395905_0400057 | |||
| 1178 | Ga0395901_0043629 | |||
| 1179 | Ga0237819_00134 | |||
| 1180 | Ga0436362_1026846 | |||
| 1181 | Ga0439436_0018614 | |||
| 1182 | Ga0439461_0011817 | |||
| 1183 | Ga0439465_0010873 | |||
| 1184 | Ga0451802_0643022 | |||
| 1185 | Ga0439431_0035978 | |||
| 1186 | Ga0439432_021508 | |||
| 1187 | Ga0439457_007618 | |||
| 1188 | Ga0466964_0028108 | |||
| 1189 | Ga0466968_0006657 | |||
| 1190 | Ga0495627_000113 | |||
| 1191 | Ga0495638_0000012 | |||
| 1192 | Ga0495638_0000123 | |||
| 1193 | Ga0495650_0000093 | |||
| 1194 | Ga0495650_0001327 | |||
| 1195 | Ga0495650_0069138 | |||
| 1196 | Ga0495584_0020356 | |||
| 1197 | Ga0495583_0000474 | |||
| 1198 | Ga0495583_0001160 | |||
| 1199 | Ga0495606_0000272 | |||
| 1200 | Ga0495606_0000382 | |||
| 1201 | Ga0495606_0000443 | |||
| 1202 | Ga0495606_0002643 | |||
| 1203 | Ga0495606_0046954 | |||
| 1204 | Ga0495610_0001282 | |||
| 1205 | Ga0495610_0008306 | |||
| 1206 | Ga0495616_0000176 | |||
| 1207 | Ga0495616_0062116 | |||
| 1208 | Ga0495616_0131471 | |||
| 1209 | Ga0495620_0018265 | |||
| 1210 | Ga0495631_0004640 | |||
| 1211 | Ga0495632_0000001 | |||
| 1212 | Ga0495632_0000773 | |||
| 1213 | Ga0495637_0000809 | |||
| 1214 | Ga0495637_0013583 | |||
| 1215 | Ga0495637_0056792 | |||
| 1216 | Ga0495643_0000006 | |||
| 1217 | Ga0495643_0011649 | |||
| 1218 | Ga0495643_0062648 | |||
| 1219 | Ga0495648_0000295 | |||
| 1220 | Ga0495648_0001990 | |||
| 1221 | Ga0495648_0041808 | |||
| 1222 | Ga0495663_0000002 | |||
| 1223 | Ga0495642_0005393 | |||
| 1224 | Ga0495654_0001238 | |||
| 1225 | Ga0495587_0078108 | |||
| 1226 | Ga0495609_0036465 | |||
| 1227 | Ga0495609_0041526 | |||
| 1228 | Ga0495597_0005293 | |||
| 1229 | Ga0495597_0029662 | |||
| 1230 | Ga0495622_0002978 | |||
| 1231 | Ga0495622_0020902 | |||
| 1232 | Ga0495633_0000053 | |||
| 1233 | Ga0495633_0000160 | |||
| 1234 | Ga0495633_0001046 | |||
| 1235 | Ga0495633_0005525 | |||
| 1236 | Ga0495668_0002823 | |||
| 1237 | Ga0495668_0013682 | |||
| 1238 | Ga0495668_0027073 | |||
| 1239 | Ga0495668_0042439 | |||
| 1240 | Ga0495668_0200403 | |||
| 1241 | Ga0495634_0115611 | |||
| 1242 | Ga0495625_0006257 | |||
| 1243 | Ga0495625_0178507 | |||
| 1244 | Ga0495625_0183568 | |||
| 1245 | Ga0495588_0213298 | |||
| 1246 | Ga0495599_0047019 | |||
| 1247 | Ga0495646_0168617 | |||
| 1248 | Ga0495669_0000639 | |||
| 1249 | Ga0495669_0024103 | |||
| 1250 | Ga0495613_0204739 | |||
| 1251 | Ga0495670_0000036 | |||
| 1252 | Ga0495670_0020373 | |||
| 1253 | Ga0495670_0021440 | |||
| 1254 | Ga0495670_0025856 | |||
| 1255 | Ga0495671_0000008 | |||
| 1256 | Ga0495671_0000111 | |||
| 1257 | Ga0495600_0033760 | |||
| 1258 | Ga0495660_0032948 | |||
| 1259 | Ga0495687_000084 | |||
| 1260 | Ga0495687_052898 | |||
| 1261 | Ga0495673_0000013 | |||
| 1262 | Ga0495673_0007717 | |||
| 1263 | Ga0495681_0000058 | |||
| 1264 | Ga0495681_0002650 | |||
| 1265 | Ga0495686_0000433 | |||
| 1266 | Ga0495686_0002518 | |||
| 1267 | Ga0495686_0010639 | |||
| 1268 | Ga0495686_0045272 | |||
| 1269 | Ga0495686_0047711 | |||
| 1270 | Ga0496100_0147609 | |||
| 1271 | Ga0496101_0351262 | |||
| 1272 | Ga0496101_0363113 | |||
| 1273 | Ga0496102_0000106 | |||
| 1274 | Ga0496102_0000143 | |||
| 1275 | Ga0496102_0508198 | |||
| 1276 | Ga0496103_0000095 | |||
| 1277 | Ga0496103_0000098 | |||
| 1278 | Ga0496103_0000924 | |||
| 1279 | Ga0496103_0015455 | |||
| 1280 | Ga0496104_0019175 | |||
| 1281 | Ga0496104_0129301 | |||
| 1282 | Ga0496104_0152808 | |||
| 1283 | Ga0496105_0189572 | |||
| 1284 | Ga0496105_0381490 | |||
| 1285 | Ga0496106_0013364 | |||
| 1286 | Ga0496106_0091425 | |||
| 1287 | Ga0496106_0097613 | |||
| 1288 | Ga0496108_0006555 | |||
| 1289 | Ga0496109_0023726 | |||
| 1290 | Ga0496110_0070177 | |||
| 1291 | Ga0496110_0130597 | |||
| 1292 | Ga0496111_0226626 | |||
| 1293 | Ga0496112_0002555 | |||
| 1294 | Ga0496112_0004022 | |||
| 1295 | Ga0496113_0000022 | |||
| 1296 | Ga0496113_0023762 | |||
| 1297 | Ga0496113_0107503 | |||
| 1298 | Ga0496113_0361267 | |||
| 1299 | Ga0496114_0082909 | |||
| 1300 | Ga0496115_0069307 | |||
| 1301 | Ga0496116_0001473 | |||
| 1302 | Ga0496116_0052511 | |||
| 1303 | Ga0496116_0066591 | |||
| 1304 | Ga0496117_0000121 | |||
| 1305 | Ga0496117_0002347 | |||
| 1306 | Ga0496117_0004218 | |||
| 1307 | Ga0496117_0013111 | |||
| 1308 | Ga0496117_0034039 | |||
| 1309 | Ga0496118_0000095 | |||
| 1310 | Ga0496118_0002332 | |||
| 1311 | Ga0496118_0004877 | |||
| 1312 | Ga0496118_0004878 | |||
| 1313 | Ga0496118_0029869 | |||
| 1314 | Ga0496118_0064346 | |||
| 1315 | Ga0496118_0118962 | |||
| 1316 | Ga0496118_0124746 | |||
| 1317 | Ga0496118_0143926 | |||
| 1318 | Ga0496119_0001217 | |||
| 1319 | Ga0496119_0014522 | |||
| 1320 | Ga0496119_0026090 | |||
| 1321 | Ga0496119_0042198 | |||
| 1322 | Ga0496119_0141446 | |||
| 1323 | Ga0496120_0029409 | |||
| 1324 | Ga0496121_0000272 | |||
| 1325 | Ga0496121_0004371 | |||
| 1326 | Ga0496121_0004952 | |||
| 1327 | Ga0496121_0028429 | |||
| 1328 | Ga0496121_0029618 | |||
| 1329 | Ga0496121_0029998 | |||
| 1330 | Ga0496122_0054539 | |||
| 1331 | Ga0496122_0065917 | |||
| 1332 | Ga0496122_0121086 | |||
| 1333 | Ga0496122_0189059 | |||
| 1334 | Ga0496123_0010012 | |||
| 1335 | Ga0496123_0025209 | |||
| 1336 | Ga0496123_0058779 | |||
| 1337 | Ga0496123_0091348 | |||
| 1338 | Ga0496123_0151834 | |||
| 1339 | Ga0496123_0169219 | |||
| 1340 | Ga0496124_0000119 | |||
| 1341 | Ga0496124_0000417 | |||
| 1342 | Ga0496124_0005450 | |||
| 1343 | Ga0496124_0113541 | |||
| 1344 | Ga0496124_0117893 | |||
| 1345 | Ga0496125_0000953 | |||
| 1346 | Ga0496125_0002341 | |||
| 1347 | Ga0496125_0012810 | |||
| 1348 | Ga0496125_0064504 | |||
| 1349 | Ga0496125_0076259 | |||
| 1350 | Ga0496126_0009286 | |||
| 1351 | Ga0496126_0042375 | |||
| 1352 | Ga0496126_0059050 | |||
| 1353 | Ga0496126_0310704 | |||
| 1354 | Ga0495678_069590 | |||
| 1355 | Ga0495682_0006896 | |||
| 1356 | Ga0501335_003397 | |||
| 1357 | Ga0501034_0061308 | |||
| 1358 | Ga0501070_0413397 | |||
| 1359 | Ga0501198_011888 | |||
| 1360 | Ga0501211_001542 | |||
| 1361 | Ga0501223_000006 | |||
| 1362 | Ga0501223_000100 | |||
| 1363 | Ga0501224_000002 | |||
| 1364 | Ga0501233_000375 | |||
| 1365 | Ga0501235_000453 | |||
| 1366 | Ga0501235_000617 | |||
| 1367 | Ga0501246_000655 | |||
| 1368 | Ga0501249_000095 | |||
| 1369 | Ga0501225_0000032 | |||
| 1370 | Ga0501225_0000120 | |||
| 1371 | Ga0501225_0001607 | |||
| 1372 | Ga0501225_0030924 | |||
| 1373 | Ga0501234_000367 | |||
| 1374 | Ga0501204_002066 | |||
| 1375 | Ga0501226_000089 | |||
| 1376 | nmdc:mga03683_1401_c1 | |||
| 1377 | nmdc:mga03n38_3421_c1 | |||
| 1378 | nmdc:mga00v17_59624_c1 | |||
| 1379 | nmdc:mga00v17_9340_c1 | |||
| 1380 | nmdc:mga0yw44_5062_c1 | |||
| 1381 | nmdc:mga0yw44_76938_c1 | |||
| 1382 | nmdc:mga06z11_100_c1 | |||
| 1383 | nmdc:mga06z11_108_c1 | |||
| 1384 | nmdc:mga04h51_11_c1 | |||
| 1385 | nmdc:mga04h51_181_c1 | |||
| 1386 | nmdc:mga07m45_114364_c1 | |||
| 1387 | nmdc:mga07m45_15_c1 | |||
| 1388 | nmdc:mga07m45_31802_c1 | |||
| 1389 | nmdc:mga07m45_4041_c1 | |||
| 1390 | nmdc:mga07m45_40709_c1 | |||
| 1391 | nmdc:mga0qj67_27752_c1 | |||
| 1392 | nmdc:mga0sz30_109_c1 | |||
| 1393 | nmdc:mga0sz30_36836_c1 | |||
| 1394 | Ga0500578_0020670 | |||
| 1395 | Ga0500651_0039143 | |||
| 1396 | Ga0500651_0163430 | |||
| 1397 | Ga0500566_0007265 | |||
| 1398 | Ga0500566_0014559 | |||
| 1399 | Ga0500566_0059490 | |||
| 1400 | Ga0500650_0006230 | |||
| 1401 | Ga0500555_000477 | |||
| 1402 | Ga0500555_064078 | |||
| 1403 | Ga0500556_0000024 | |||
| 1404 | Ga0500569_013432 | |||
| 1405 | Ga0500595_005233 | |||
| 1406 | Ga0500607_000065 | |||
| 1407 | Ga0500607_000168 | |||
| 1408 | Ga0500607_030204 | |||
| 1409 | Ga0500608_025822 | |||
| 1410 | Ga0500618_000092 | |||
| 1411 | Ga0500618_004379 | |||
| 1412 | Ga0500618_014931 | |||
| 1413 | Ga0500618_035729 | |||
| 1414 | Ga0500642_0000035 | |||
| 1415 | Ga0500642_0001609 | |||
| 1416 | Ga0500652_000134 | |||
| 1417 | Ga0500655_000399 | |||
| 1418 | Ga0500658_0000598 | |||
| 1419 | Ga0500559_0000668 | |||
| 1420 | Ga0500559_0001329 | |||
| 1421 | Ga0500559_0002950 | |||
| 1422 | Ga0500559_0030167 | |||
| 1423 | Ga0500559_0049447 | |||
| 1424 | Ga0500559_0068225 | |||
| 1425 | Ga0500568_0003427 | |||
| 1426 | Ga0500568_0015006 | |||
| 1427 | Ga0500568_0033607 | |||
| 1428 | Ga0500568_0066066 | |||
| 1429 | Ga0500577_0000483 | |||
| 1430 | Ga0500577_0004181 | |||
| 1431 | Ga0500590_043419 | |||
| 1432 | Ga0500590_062176 | |||
| 1433 | Ga0500604_0006540 | |||
| 1434 | Ga0500604_0035841 | |||
| 1435 | Ga0500604_0087397 | |||
| 1436 | Ga0500616_0000122 | |||
| 1437 | Ga0500622_0001122 | |||
| 1438 | Ga0500622_0001260 | |||
| 1439 | Ga0500622_0004003 | |||
| 1440 | Ga0500622_0020907 | |||
| 1441 | Ga0500624_000018 | |||
| 1442 | Ga0500624_000182 | |||
| 1443 | Ga0500624_000205 | |||
| 1444 | Ga0500627_0000687 | |||
| 1445 | Ga0500627_0003265 | |||
| 1446 | Ga0500633_0001786 | |||
| 1447 | Ga0500634_0076613 | |||
| 1448 | Ga0500636_0009686 | |||
| 1449 | Ga0500636_0051013 | |||
| 1450 | Ga0500637_0020659 | |||
| 1451 | Ga0500637_0044358 | |||
| 1452 | Ga0500567_002415 | |||
| 1453 | Ga0500570_000052 | |||
| 1454 | Ga0500625_000009 | |||
| 1455 | Ga0500645_006451 | |||
| 1456 | Ga0500645_007832 | |||
| 1457 | Ga0500661_015067 | |||
| 1458 | 2512644270 | |||
| 1459 | 2603861073 | |||
| 1460 | 2644036830 | |||
| 1461 | 2739650098 | |||
| 1462 | 2740028571 | |||
| 1463 | 2753766278 | |||
| 1464 | 2778126989 | |||
| 1465 | 2809078669 | |||
| 1466 | 2809083036 | |||
| 1467 | 2857528800 | |||
| 1468 | 2880521547 | |||
| 1469 | 2893068994 | |||
| 1470 | 2919079227 | |||
| 1471 | 2919140998 | |||
| 1472 | 2919711065 | |||
| 1473 | 2929200432 | |||
| 1474 | 8055914748 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jpy-assembly1.cif.gz_A | iron and phenylalanine bound crystal structure of phenylalanine hydroxylase from chromobacterium violaceum | 0.9829 | 12 | 272 |
| 4jpx-assembly1.cif.gz_A | crystal structure of phenylalanine hydroxylase s203p mutant from chromobacterium violaceum | 0.9811 | 12 | 272 |
| 4q3w-assembly1.cif.gz_A | crystal structure of c. violaceum phenylalanine hydroxylase d139e mutation | 0.9795 | 12 | 272 |
| 4etl-assembly1.cif.gz_A | crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum f258a mutation | 0.9794 | 12 | 272 |
| 3tk4-assembly1.cif.gz_A | crystal structure of phenylalanine hydroxylase from chromobacterium violaceum bound to cobalt | 0.9788 | 12 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ltzA00 | Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase | 0.9702 | 12 | 272 | 1.10.800.10 |
| 4bptC00 | Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase | 0.939 | 32 | 260 | 1.10.800.10 |
| 2v28B00 | Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase | 0.924 | 16 | 252 | 1.10.800.10 |
| 5jk8B00 | Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase | 0.9159 | 23 | 244 | 1.10.800.10 |
| 4bptC00 | Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase | 0.9156 | 32 | 260 | 1.10.800.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2L969-F1-model_v4 | Phenylalanine 4-monooxygenase | 0.9979 | 84 | 190 |
GO:0004505
GO:0005506 |
| AF-A0A525JC61-F1-model_v4 | Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) | 0.9912 | 8 | 286 |
GO:0004505
GO:0005506 GO:0006559 |
| AF-A0A257WQE8-F1-model_v4 | Biopterin-dependent aromatic amino acid hydroxylase family profile domain-containing protein | 0.9905 | 11 | 175 |
GO:0004505
GO:0005506 |
| AF-A0A520ETB8-F1-model_v4 | deleted | 0.9894 | 109 | 285 |
|
| AF-A0A537MHB0-F1-model_v4 | Phenylalanine-4-hydroxylase (EC 1.14.16.1) (Phe-4-monooxygenase) | 0.9893 | 12 | 262 |
GO:0004505
GO:0005506 GO:0006559 |