F478284

General Info

Members Datasets Scaffolds Average Seq Length
736 364 1472 170

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0139643|Ga0436364_0139643_1063_1632
Length 189
Sequence VSDALEQQEQREQAEWPAETPAGGHTFGIVLEDVRQFLYREARYLDDREFEQWLECYHSDAEFWMPAWADDDNVTTDPQSEISLVYYPNRAGLEDRVFRIRTDRSSATSLPEPRTGHNITNVEITGQEGAFVDVRFNWFTLYYRYQTVDTYFGTSFYRLDLSGPKPLITRKKVVLKNDYVHHVVDIYHV

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
195 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
214 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
220 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
229 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
230 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
231 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
232 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
245 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
268 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
315 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
316 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
317 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
318 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
339 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
340 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
341 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
342 2643221561 Nocardioides sp. Root151 Isolate Unclassified
343 2643221696 Nocardioides sp. Root140 Isolate Unclassified
344 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
345 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
346 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
347 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
348 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
349 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
350 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
351 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
352 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
353 2862574272 Streptomyces sp. AcE210 Isolate Nodule
354 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
355 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
356 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
357 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
358 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
359 2922554459 Rhodococcus sp. 66b Isolate Unclassified
360 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
361 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
362 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
363 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
364 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 5.84
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0.27
Rhizoplane 7.74
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0139643 3300037853 Bacteria 10617
2 LJQas_1000116 3300000549 Bacteria 13834
3 LJQas_1004960 3300000549 Bacteria 1705
4 JGI24737J22298_10049507 3300001990 Bacteria 1278
5 JGI24743J22301_10003682 3300001991 Bacteria 2445
6 JGI24735J21928_10042444 3300002067 Bacteria 1324
7 JGI24738J21930_10007611 3300002075 Bacteria 2492
8 JGI24034J26672_10005656 3300002239 Bacteria 1795
9 JGI25406J46586_10079730 3300003203 Bacteria 1007
10 Ga0058858_1421484 3300004785 Bacteria 1590
11 Ga0058859_10009161 3300004798 Bacteria 1625
12 Ga0058863_10041758 3300004799 Bacteria 1474
13 Ga0058861_10087982 3300004800 Bacteria 2685
14 Ga0058862_10099156 3300004803 Bacteria 2414
15 Ga0070658_10130570 3300005327 Bacteria 2093
16 Ga0070676_10020890 3300005328 Bacteria 3661
17 Ga0070676_10118520 3300005328 Bacteria 1658
18 Ga0070683_100567343 3300005329 Bacteria 1085
19 Ga0070670_100209071 3300005331 Bacteria 1696
20 Ga0068869_100035747 3300005334 Bacteria 3523
21 Ga0068869_100039798 3300005334 Bacteria 3359
22 Ga0070666_10009026 3300005335 Bacteria 6211
23 Ga0070666_10096876 3300005335 Bacteria 2031
24 Ga0070680_100275773 3300005336 Bacteria 1424
25 Ga0070682_100030739 3300005337 Bacteria 3245
26 Ga0070682_100042072 3300005337 Bacteria 2819
27 Ga0070682_100167042 3300005337 Bacteria 1526
28 Ga0070682_100174053 3300005337 Bacteria 1498
29 Ga0070682_100361567 3300005337 Bacteria 1085
30 Ga0068868_100000203 3300005338 Bacteria 40057
31 Ga0068868_100219671 3300005338 Bacteria 1590
32 Ga0070660_100289439 3300005339 Bacteria 1341
33 Ga0070689_100040615 3300005340 Bacteria 3568
34 Ga0070689_100331091 3300005340 Bacteria 1274
35 Ga0070691_10000914 3300005341 Bacteria 11972
36 Ga0070691_10020230 3300005341 Bacteria 3074
37 Ga0070692_10019671 3300005345 Bacteria 3262
38 Ga0070668_100005307 3300005347 Bacteria 9566
39 Ga0070668_100152042 3300005347 Bacteria 1872
40 Ga0070668_100197378 3300005347 Bacteria 1651
41 Ga0070668_101364615 3300005347 Bacteria 646
42 Ga0070669_100031637 3300005353 Bacteria 3822
43 Ga0070669_100065201 3300005353 Bacteria 2683
44 Ga0070675_100087473 3300005354 Bacteria 2605
45 Ga0070675_100340366 3300005354 Bacteria 1328
46 Ga0070675_100765381 3300005354 Bacteria 881
47 Ga0070671_100021227 3300005355 Bacteria 5304
48 Ga0070671_100178098 3300005355 Bacteria 1799
49 Ga0070674_100000244 3300005356 Bacteria 26961
50 Ga0070674_100212458 3300005356 Bacteria 1500
51 Ga0070673_100449356 3300005364 Bacteria 1159
52 Ga0070688_100002188 3300005365 Bacteria 9856
53 Ga0070688_100018231 3300005365 Bacteria 4047
54 Ga0070688_100144039 3300005365 Bacteria 1622
55 Ga0070659_100028419 3300005366 Bacteria 4319
56 Ga0070659_100038097 3300005366 Bacteria 3749
57 Ga0070659_100049761 3300005366 Bacteria 3296
58 Ga0070659_100088400 3300005366 Bacteria 2481
59 Ga0070667_100066954 3300005367 Bacteria 3053
60 Ga0070667_100163065 3300005367 Bacteria 1964
61 Ga0070667_100850445 3300005367 Bacteria 848
62 Ga0070709_10014652 3300005434 Bacteria 4438
63 Ga0070709_10159348 3300005434 Bacteria 1568
64 Ga0070709_10190005 3300005434 Bacteria 1448
65 Ga0070709_10804763 3300005434 Bacteria 738
66 Ga0070714_100828600 3300005435 Bacteria 897
67 Ga0070713_100976370 3300005436 Bacteria 817
68 Ga0070710_10007738 3300005437 Bacteria 5212
69 Ga0070710_10025259 3300005437 Bacteria 3145
70 Ga0070710_10083926 3300005437 Bacteria 1865
71 Ga0070701_10055627 3300005438 Bacteria 2068
72 Ga0070711_100002396 3300005439 Bacteria 10681
73 Ga0070711_100005711 3300005439 Bacteria 7459
74 Ga0070711_100132440 3300005439 Bacteria 1858
75 Ga0070705_100005263 3300005440 Bacteria 6289
76 Ga0070705_100084114 3300005440 Bacteria 1963
77 Ga0070700_100012566 3300005441 Bacteria 4730
78 Ga0070700_100029765 3300005441 Bacteria 3258
79 Ga0070694_100044216 3300005444 Bacteria 2980
80 Ga0070694_100335162 3300005444 Bacteria 1168
81 Ga0070663_100012067 3300005455 Bacteria 5452
82 Ga0070663_100173838 3300005455 Bacteria 1666
83 Ga0070663_100694125 3300005455 Bacteria 864
84 Ga0070678_100125867 3300005456 Bacteria 2028
85 Ga0070678_100148518 3300005456 Bacteria 1885
86 Ga0070678_100171114 3300005456 Bacteria 1769
87 Ga0070678_100402445 3300005456 Bacteria 1189
88 Ga0070662_100000713 3300005457 Bacteria 20417
89 Ga0070662_100023543 3300005457 Bacteria 4231
90 Ga0070662_100190515 3300005457 Bacteria 1621
91 Ga0070662_100410529 3300005457 Bacteria 1119
92 Ga0068867_100001211 3300005459 Bacteria 17725
93 Ga0068867_100070477 3300005459 Bacteria 2613
94 Ga0068867_100163388 3300005459 Bacteria 1757
95 Ga0068867_100579396 3300005459 Bacteria 976
96 Ga0070685_10405609 3300005466 Bacteria 945
97 Ga0070685_10924288 3300005466 Bacteria 650
98 Ga0070706_101140514 3300005467 Bacteria 717
99 Ga0070698_100349102 3300005471 Bacteria 1411
100 Ga0070679_100231529 3300005530 Bacteria 1807
101 Ga0070684_100259830 3300005535 Bacteria 1588
102 Ga0070684_100790738 3300005535 Bacteria 887
103 Ga0070697_100578301 3300005536 Bacteria 986
104 Ga0068853_100020911 3300005539 Bacteria 5445
105 Ga0070672_100084142 3300005543 Bacteria 2554
106 Ga0070672_100252351 3300005543 Bacteria 1486
107 Ga0070686_100520250 3300005544 Bacteria 926
108 Ga0070695_100002690 3300005545 Bacteria 10289
109 Ga0070695_100105423 3300005545 Bacteria 1905
110 Ga0070696_100035559 3300005546 Bacteria 3431
111 Ga0070696_100044126 3300005546 Bacteria 3087
112 Ga0070696_100121686 3300005546 Bacteria 1889
113 Ga0070693_100035467 3300005547 Bacteria 2767
114 Ga0070693_100094314 3300005547 Bacteria 1810
115 Ga0070693_100292561 3300005547 Bacteria 1095
116 Ga0070693_100312734 3300005547 Bacteria 1063
117 Ga0070665_100005218 3300005548 Bacteria 13443
118 Ga0070665_100269005 3300005548 Bacteria 1706
119 Ga0070665_100443494 3300005548 Bacteria 1307
120 Ga0070665_100915168 3300005548 Bacteria 890
121 Ga0070665_101299194 3300005548 Bacteria 737
122 Ga0070704_100032452 3300005549 Bacteria 3522
123 Ga0070704_100330316 3300005549 Bacteria 1280
124 Ga0068855_100184547 3300005563 Bacteria 2357
125 Ga0068855_100320302 3300005563 Bacteria 1714
126 Ga0068855_100473773 3300005563 Bacteria 1363
127 Ga0068855_101153401 3300005563 Bacteria 808
128 Ga0068857_100068268 3300005577 Bacteria 3164
129 Ga0068854_100000262 3300005578 Bacteria 35841
130 Ga0068854_100017580 3300005578 Bacteria 4785
131 Ga0068854_100103823 3300005578 Bacteria 2134
132 Ga0068854_100775741 3300005578 Bacteria 833
133 Ga0068854_101038324 3300005578 Bacteria 727
134 Ga0068856_100095930 3300005614 Bacteria 2954
135 Ga0068856_100226532 3300005614 Bacteria 1885
136 Ga0070702_100001129 3300005615 Bacteria 10713
137 Ga0070702_100011029 3300005615 Bacteria 4482
138 Ga0068852_100097532 3300005616 Bacteria 2645
139 Ga0068852_100160012 3300005616 Bacteria 2102
140 Ga0068852_100316407 3300005616 Bacteria 1514
141 Ga0068852_100328356 3300005616 Bacteria 1488
142 Ga0068852_100396309 3300005616 Bacteria 1357
143 Ga0068859_100002266 3300005617 Bacteria 19509
144 Ga0068859_100018292 3300005617 Bacteria 7045
145 Ga0068859_100171048 3300005617 Bacteria 2253
146 Ga0068859_100903846 3300005617 Bacteria 967
147 Ga0068859_101674409 3300005617 Bacteria 703
148 Ga0068864_100357442 3300005618 Bacteria 1379
149 Ga0068864_100380674 3300005618 Bacteria 1337
150 Ga0068866_10000681 3300005718 Bacteria 15451
151 Ga0068866_10013634 3300005718 Bacteria 3572
152 Ga0068866_10069881 3300005718 Bacteria 1851
153 Ga0068866_10366871 3300005718 Bacteria 919
154 Ga0068866_10374820 3300005718 Bacteria 911
155 Ga0068861_100018017 3300005719 Bacteria 5022
156 Ga0068861_100031467 3300005719 Bacteria 3898
157 Ga0068861_100293577 3300005719 Bacteria 1405
158 Ga0068851_10036766 3300005834 Bacteria 2453
159 Ga0068870_10130974 3300005840 Bacteria 1457
160 Ga0068870_10374851 3300005840 Bacteria 919
161 Ga0068863_100064551 3300005841 Bacteria 3462
162 Ga0068863_100163747 3300005841 Bacteria 2132
163 Ga0068863_100325055 3300005841 Bacteria 1494
164 Ga0068858_100001689 3300005842 Bacteria 22563
165 Ga0068858_100072930 3300005842 Bacteria 3186
166 Ga0068858_100102866 3300005842 Bacteria 2664
167 Ga0068858_100143657 3300005842 Bacteria 2241
168 Ga0068858_100544263 3300005842 Bacteria 1124
169 Ga0068860_100001255 3300005843 Bacteria 27661
170 Ga0068860_100037958 3300005843 Bacteria 4609
171 Ga0068860_100084902 3300005843 Bacteria 3011
172 Ga0068860_100376133 3300005843 Bacteria 1402
173 Ga0068860_101278075 3300005843 Bacteria 754
174 Ga0068862_100001317 3300005844 Bacteria 23074
175 Ga0068862_100114511 3300005844 Bacteria 2370
176 Ga0068862_100174243 3300005844 Bacteria 1927
177 Ga0068862_100384621 3300005844 Bacteria 1309
178 Ga0081455_10007611 3300005937 Bacteria 11384
179 Ga0081455_10018209 3300005937 Bacteria 6704
180 Ga0081539_10006743 3300005985 Bacteria 10787
181 Ga0081539_10031667 3300005985 Bacteria 3255
182 Ga0070717_10121739 3300006028 Bacteria 2236
183 Ga0075365_10215282 3300006038 Bacteria 1347
184 Ga0075364_10244722 3300006051 Bacteria 1218
185 Ga0075364_10591662 3300006051 Bacteria 758
186 Ga0075432_10004226 3300006058 Bacteria 4887
187 Ga0075432_10085879 3300006058 Bacteria 1146
188 Ga0070715_10016658 3300006163 Bacteria 2767
189 Ga0070715_10041328 3300006163 Bacteria 1932
190 Ga0070716_100001673 3300006173 Bacteria 9998
191 Ga0070716_100001813 3300006173 Bacteria 9669
192 Ga0070712_100001225 3300006175 Bacteria 15514
193 Ga0070712_100056512 3300006175 Bacteria 2753
194 Ga0070712_100206841 3300006175 Bacteria 1545
195 Ga0097621_100038572 3300006237 Bacteria 3834
196 Ga0097621_100217142 3300006237 Bacteria 1665
197 Ga0068871_100044030 3300006358 Bacteria 3588
198 Ga0068871_100080370 3300006358 Bacteria 2699
199 Ga0068871_100274619 3300006358 Bacteria 1473
200 Ga0075428_100092968 3300006844 Bacteria 3288
201 Ga0068865_100300952 3300006881 Bacteria 1284
202 Ga0068865_100461217 3300006881 Bacteria 1052
203 Ga0097620_100002267 3300006931 Bacteria 19509
204 Ga0097620_100018292 3300006931 Bacteria 7045
205 Ga0097620_100171066 3300006931 Bacteria 2253
206 Ga0097620_100903897 3300006931 Bacteria 967
207 Ga0097620_101674463 3300006931 Bacteria 703
208 Ga0105251_10137392 3300009011 Bacteria 1106
209 Ga0105250_10206822 3300009092 Bacteria 829
210 Ga0111539_10438119 3300009094 Bacteria 1522
211 Ga0111539_10690177 3300009094 Bacteria 1188
212 Ga0111539_10861476 3300009094 Bacteria 1054
213 Ga0111539_10902890 3300009094 Bacteria 1028
214 Ga0111539_11205917 3300009094 Bacteria 879
215 Ga0105245_10001005 3300009098 Bacteria 25622
216 Ga0105245_10092913 3300009098 Bacteria 2779
217 Ga0105245_10207686 3300009098 Bacteria 1883
218 Ga0105245_10361532 3300009098 Bacteria 1441
219 Ga0105247_10000372 3300009101 Bacteria 38190
220 Ga0105247_10094069 3300009101 Bacteria 1906
221 Ga0105247_10185883 3300009101 Bacteria 1389
222 Ga0105247_10213937 3300009101 Bacteria 1301
223 Ga0105247_10714032 3300009101 Bacteria 756
224 Ga0105247_10954126 3300009101 Bacteria 666
225 Ga0114129_10111628 3300009147 Bacteria 3772
226 Ga0105243_10000676 3300009148 Bacteria 33249
227 Ga0105243_10092718 3300009148 Bacteria 2491
228 Ga0105243_10178741 3300009148 Bacteria 1844
229 Ga0105243_10573239 3300009148 Bacteria 1082
230 Ga0105243_11161613 3300009148 Bacteria 783
231 Ga0105241_10030340 3300009174 Bacteria 4040
232 Ga0105241_10641842 3300009174 Bacteria 963
233 Ga0105242_10000197 3300009176 Bacteria 46948
234 Ga0105242_10060569 3300009176 Bacteria 3111
235 Ga0105242_10081548 3300009176 Bacteria 2705
236 Ga0105242_10835790 3300009176 Bacteria 915
237 Ga0105248_10014539 3300009177 Bacteria 8663
238 Ga0105248_10016388 3300009177 Bacteria 8156
239 Ga0105248_10027828 3300009177 Bacteria 6294
240 Ga0105248_10177001 3300009177 Bacteria 2404
241 Ga0105248_12625132 3300009177 Bacteria 574
242 Ga0105237_10005565 3300009545 Bacteria 14206
243 Ga0105237_10168447 3300009545 Bacteria 2190
244 Ga0105237_10414322 3300009545 Bacteria 1352
245 Ga0105238_10093100 3300009551 Bacteria 3002
246 Ga0105238_10320379 3300009551 Bacteria 1536
247 Ga0105238_10515638 3300009551 Bacteria 1198
248 Ga0105238_11642875 3300009551 Bacteria 673
249 Ga0105249_10355110 3300009553 Bacteria 1486
250 Ga0105249_10378634 3300009553 Bacteria 1441
251 Ga0105239_10004408 3300010375 Bacteria 16853
252 Ga0105246_10018879 3300011119 Bacteria 4397
253 Ga0105246_10310978 3300011119 Bacteria 1276
254 Ga0105246_11397793 3300011119 Bacteria 653
255 Ga0157371_10249588 3300013102 Bacteria 1277
256 Ga0157370_10739994 3300013104 Bacteria 896
257 Ga0157370_10864992 3300013104 Bacteria 821
258 Ga0157369_10375380 3300013105 Bacteria 1476
259 Ga0157369_10597261 3300013105 Bacteria 1139
260 Ga0157374_10047682 3300013296 Bacteria 3973
261 Ga0157374_10052951 3300013296 Bacteria 3782
262 Ga0157374_10645124 3300013296 Bacteria 1070
263 Ga0157378_10002889 3300013297 Bacteria 15295
264 Ga0157378_10030416 3300013297 Bacteria 4771
265 Ga0157378_10978990 3300013297 Bacteria 879
266 Ga0163162_10002808 3300013306 Bacteria 16565
267 Ga0163162_10120757 3300013306 Bacteria 2725
268 Ga0163162_10210930 3300013306 Bacteria 2072
269 Ga0163162_10630926 3300013306 Bacteria 1196
270 Ga0163162_11750459 3300013306 Bacteria 710
271 Ga0157372_10090951 3300013307 Bacteria 3470
272 Ga0157372_10303835 3300013307 Bacteria 1856
273 Ga0157372_10610941 3300013307 Bacteria 1271
274 Ga0157372_11187422 3300013307 Bacteria 882
275 Ga0157375_10001551 3300013308 Bacteria 19772
276 Ga0157375_10228743 3300013308 Bacteria 2018
277 Ga0157375_10303332 3300013308 Bacteria 1761
278 Ga0157375_10337393 3300013308 Bacteria 1673
279 Ga0157375_10470027 3300013308 Bacteria 1423
280 Ga0157375_11573654 3300013308 Bacteria 777
281 Ga0163163_10329677 3300014325 Bacteria 1581
282 Ga0163163_11921292 3300014325 Bacteria 652
283 Ga0157380_10000136 3300014326 Bacteria 41118
284 Ga0157380_10023621 3300014326 Bacteria 4641
285 Ga0157380_10542956 3300014326 Bacteria 1139
286 Ga0157377_10019708 3300014745 Bacteria 3527
287 Ga0157377_10021065 3300014745 Bacteria 3424
288 Ga0157377_10051551 3300014745 Bacteria 2321
289 Ga0157379_10002115 3300014968 Bacteria 16461
290 Ga0157379_10181559 3300014968 Bacteria 1901
291 Ga0157379_10967930 3300014968 Bacteria 810
292 Ga0157376_10039949 3300014969 Bacteria 3831
293 Ga0157376_10171043 3300014969 Bacteria 1979
294 Ga0157376_10355796 3300014969 Bacteria 1403
295 Ga0163161_10012707 3300017792 Bacteria 5848
296 Ga0163161_10338074 3300017792 Bacteria 1194
297 Ga0163161_10360074 3300017792 Bacteria 1158
298 Ga0163161_11163407 3300017792 Bacteria 665
299 Ga0197907_10831311 3300020069 Bacteria 1987
300 Ga0206356_10184193 3300020070 Bacteria 2400
301 Ga0206356_10309572 3300020070 Bacteria 2818
302 Ga0206356_11613575 3300020070 Bacteria 831
303 Ga0206349_1889663 3300020075 Bacteria 1114
304 Ga0206355_1246002 3300020076 Bacteria 2492
305 Ga0206355_1653515 3300020076 Bacteria 1593
306 Ga0206351_10992062 3300020077 Bacteria 814
307 Ga0206352_10290768 3300020078 Bacteria 983
308 Ga0206352_11145297 3300020078 Bacteria 2584
309 Ga0206354_11208453 3300020081 Bacteria 1806
310 Ga0206353_11504654 3300020082 Bacteria 966
311 Ga0206353_11544153 3300020082 Bacteria 1990
312 Ga0224712_10004343 3300022467 Bacteria 3812
313 Ga0207426_1009534 3300025302 Bacteria 3832
314 Ga0207653_10028622 3300025885 Bacteria 1793
315 Ga0207692_10018628 3300025898 Bacteria 3120
316 Ga0207692_10027995 3300025898 Bacteria 2660
317 Ga0207692_10345997 3300025898 Bacteria 915
318 Ga0207642_10000178 3300025899 Bacteria 18339
319 Ga0207642_10049043 3300025899 Bacteria 1896
320 Ga0207642_10067860 3300025899 Bacteria 1685
321 Ga0207642_10306547 3300025899 Bacteria 922
322 Ga0207710_10011878 3300025900 Bacteria 3664
323 Ga0207710_10309640 3300025900 Bacteria 799
324 Ga0207710_10459625 3300025900 Bacteria 658
325 Ga0207710_10594830 3300025900 Bacteria 578
326 Ga0207688_10002022 3300025901 Bacteria 10880
327 Ga0207688_10004903 3300025901 Bacteria 7285
328 Ga0207688_10007863 3300025901 Bacteria 5803
329 Ga0207688_10335108 3300025901 Bacteria 930
330 Ga0207680_10007555 3300025903 Bacteria 5308
331 Ga0207647_10008739 3300025904 Bacteria 7232
332 Ga0207647_10034190 3300025904 Bacteria 3248
333 Ga0207647_10060164 3300025904 Bacteria 2322
334 Ga0207647_10075426 3300025904 Bacteria 2030
335 Ga0207685_10028489 3300025905 Bacteria 1968
336 Ga0207699_10057278 3300025906 Bacteria 2326
337 Ga0207645_10010732 3300025907 Bacteria 6280
338 Ga0207645_10653094 3300025907 Bacteria 715
339 Ga0207643_10185680 3300025908 Bacteria 1260
340 Ga0207654_10159947 3300025911 Bacteria 1454
341 Ga0207707_11068289 3300025912 Bacteria 659
342 Ga0207671_10056867 3300025914 Bacteria 2899
343 Ga0207671_10234171 3300025914 Bacteria 1441
344 Ga0207693_10000507 3300025915 Bacteria 35136
345 Ga0207693_10004862 3300025915 Bacteria 11307
346 Ga0207693_10006779 3300025915 Bacteria 9457
347 Ga0207663_10006272 3300025916 Bacteria 6068
348 Ga0207663_10045140 3300025916 Bacteria 2709
349 Ga0207663_10051804 3300025916 Bacteria 2558
350 Ga0207660_10374424 3300025917 Bacteria 1144
351 Ga0207660_10384185 3300025917 Bacteria 1129
352 Ga0207660_10676576 3300025917 Bacteria 842
353 Ga0207662_10015986 3300025918 Bacteria 4230
354 Ga0207662_10314910 3300025918 Bacteria 1043
355 Ga0207657_10206611 3300025919 Bacteria 1577
356 Ga0207652_10188672 3300025921 Bacteria 1854
357 Ga0207652_11096743 3300025921 Bacteria 696
358 Ga0207681_10032097 3300025923 Bacteria 3437
359 Ga0207681_10039095 3300025923 Bacteria 3147
360 Ga0207681_10140195 3300025923 Bacteria 1800
361 Ga0207681_10443862 3300025923 Bacteria 1055
362 Ga0207694_10548643 3300025924 Bacteria 970
363 Ga0207650_11108999 3300025925 Bacteria 673
364 Ga0207659_11420819 3300025926 Bacteria 594
365 Ga0207687_10003137 3300025927 Bacteria 11208
366 Ga0207687_10054043 3300025927 Bacteria 2808
367 Ga0207687_10200706 3300025927 Bacteria 1559
368 Ga0207687_11324535 3300025927 Bacteria 619
369 Ga0207700_10274240 3300025928 Bacteria 1449
370 Ga0207700_11046575 3300025928 Bacteria 730
371 Ga0207664_10137255 3300025929 Bacteria 2065
372 Ga0207664_10533673 3300025929 Bacteria 1052
373 Ga0207644_10031815 3300025931 Bacteria 3678
374 Ga0207690_10034702 3300025932 Bacteria 3252
375 Ga0207690_10161856 3300025932 Bacteria 1669
376 Ga0207706_10001533 3300025933 Bacteria 22933
377 Ga0207706_10012019 3300025933 Bacteria 7886
378 Ga0207706_10014036 3300025933 Bacteria 7265
379 Ga0207706_10026774 3300025933 Bacteria 5161
380 Ga0207706_10372102 3300025933 Bacteria 1241
381 Ga0207686_10001322 3300025934 Bacteria 14150
382 Ga0207686_10078273 3300025934 Bacteria 2150
383 Ga0207686_10086228 3300025934 Bacteria 2062
384 Ga0207709_10003151 3300025935 Bacteria 9912
385 Ga0207709_10071722 3300025935 Bacteria 2201
386 Ga0207670_10005363 3300025936 Bacteria 7032
387 Ga0207670_10254533 3300025936 Bacteria 1358
388 Ga0207670_10569550 3300025936 Bacteria 927
389 Ga0207669_10002448 3300025937 Bacteria 7918
390 Ga0207669_10010783 3300025937 Bacteria 4416
391 Ga0207669_10027073 3300025937 Bacteria 3131
392 Ga0207669_10250046 3300025937 Bacteria 1319
393 Ga0207669_10257420 3300025937 Bacteria 1303
394 Ga0207704_10000458 3300025938 Bacteria 18202
395 Ga0207704_10138481 3300025938 Bacteria 1698
396 Ga0207704_10165215 3300025938 Bacteria 1580
397 Ga0207704_10355392 3300025938 Bacteria 1142
398 Ga0207665_10001870 3300025939 Bacteria 14190
399 Ga0207665_10006046 3300025939 Bacteria 8044
400 Ga0207665_10031079 3300025939 Bacteria 3531
401 Ga0207691_10041110 3300025940 Bacteria 4270
402 Ga0207691_10142949 3300025940 Bacteria 2107
403 Ga0207711_10023282 3300025941 Bacteria 5184
404 Ga0207711_10108648 3300025941 Bacteria 2464
405 Ga0207711_10556727 3300025941 Bacteria 1070
406 Ga0207711_10691785 3300025941 Bacteria 951
407 Ga0207689_10012131 3300025942 Bacteria 7375
408 Ga0207689_10012362 3300025942 Bacteria 7302
409 Ga0207689_10534632 3300025942 Bacteria 984
410 Ga0207661_10747266 3300025944 Bacteria 900
411 Ga0207667_10156712 3300025949 Bacteria 2343
412 Ga0207667_10596152 3300025949 Bacteria 1114
413 Ga0207667_10832049 3300025949 Bacteria 918
414 Ga0207651_10362039 3300025960 Bacteria 1224
415 Ga0207651_10992737 3300025960 Bacteria 750
416 Ga0207712_10005323 3300025961 Bacteria 8124
417 Ga0207712_10131269 3300025961 Bacteria 1909
418 Ga0207712_10259405 3300025961 Bacteria 1409
419 Ga0207668_10001538 3300025972 Bacteria 13494
420 Ga0207668_10111361 3300025972 Bacteria 2055
421 Ga0207668_10134239 3300025972 Bacteria 1894
422 Ga0207668_10188472 3300025972 Bacteria 1632
423 Ga0207668_10553031 3300025972 Bacteria 997
424 Ga0207640_10000827 3300025981 Bacteria 17626
425 Ga0207640_10116261 3300025981 Bacteria 1906
426 Ga0207640_10264466 3300025981 Bacteria 1342
427 Ga0207658_10018537 3300025986 Bacteria 4807
428 Ga0207658_10312260 3300025986 Bacteria 1358
429 Ga0207658_10751297 3300025986 Bacteria 883
430 Ga0207677_10018504 3300026023 Bacteria 4182
431 Ga0207677_10075635 3300026023 Bacteria 2394
432 Ga0207677_10384001 3300026023 Bacteria 1186
433 Ga0207703_10000920 3300026035 Bacteria 28669
434 Ga0207703_10055283 3300026035 Bacteria 3229
435 Ga0207703_10464993 3300026035 Bacteria 1183
436 Ga0207678_10003253 3300026067 Bacteria 14661
437 Ga0207678_10024038 3300026067 Bacteria 5325
438 Ga0207678_10358757 3300026067 Bacteria 1258
439 Ga0207678_10407898 3300026067 Bacteria 1177
440 Ga0207708_10024290 3300026075 Bacteria 4584
441 Ga0207708_10063951 3300026075 Bacteria 2811
442 Ga0207708_10091736 3300026075 Bacteria 2343
443 Ga0207702_10420643 3300026078 Bacteria 1292
444 Ga0207702_10852773 3300026078 Bacteria 902
445 Ga0207641_10297562 3300026088 Bacteria 1523
446 Ga0207641_10451556 3300026088 Bacteria 1242
447 Ga0207648_10000929 3300026089 Bacteria 33018
448 Ga0207648_10033327 3300026089 Bacteria 4543
449 Ga0207648_10120299 3300026089 Bacteria 2309
450 Ga0207676_10432246 3300026095 Bacteria 1237
451 Ga0207676_10551392 3300026095 Bacteria 1101
452 Ga0207674_10017599 3300026116 Bacteria 7795
453 Ga0207675_100000544 3300026118 Bacteria 36830
454 Ga0207675_100041890 3300026118 Bacteria 4276
455 Ga0207675_100497880 3300026118 Bacteria 1213
456 Ga0207675_100723494 3300026118 Bacteria 1005
457 Ga0207683_10000335 3300026121 Bacteria 42789
458 Ga0207683_10013403 3300026121 Bacteria 6991
459 Ga0207683_10180226 3300026121 Bacteria 1915
460 Ga0207683_11145132 3300026121 Bacteria 721
461 Ga0207698_10073687 3300026142 Bacteria 2720
462 Ga0207698_10148975 3300026142 Bacteria 2028
463 Ga0207698_10350143 3300026142 Bacteria 1395
464 Ga0207698_10633796 3300026142 Bacteria 1057
465 Ga0207428_10006323 3300027907 Bacteria 10951
466 Ga0207428_10219838 3300027907 Bacteria 1424
467 Ga0207428_10379496 3300027907 Bacteria 1037
468 Ga0268266_10673515 3300028379 Bacteria 996
469 Ga0268265_10236677 3300028380 Bacteria 1608
470 Ga0268265_10310037 3300028380 Bacteria 1425
471 Ga0268265_10379022 3300028380 Bacteria 1300
472 Ga0268264_10001041 3300028381 Bacteria 27858
473 Ga0268264_10443187 3300028381 Bacteria 1257
474 Ga0268264_10586425 3300028381 Bacteria 1097
475 Ga0268264_10684798 3300028381 Bacteria 1017
476 Ga0307511_10001365 3300030521 Bacteria 25829
477 Ga0314311_1002826 3300030733 Bacteria 1023
478 Ga0307513_10000684 3300031456 Bacteria 48768
479 Ga0307408_100058841 3300031548 Bacteria 2795
480 Ga0307408_100380303 3300031548 Bacteria 1207
481 Ga0307408_101807763 3300031548 Bacteria 584
482 Ga0307405_10458926 3300031731 Bacteria 1012
483 Ga0307413_10064012 3300031824 Bacteria 2283
484 Ga0307413_10329929 3300031824 Bacteria 1169
485 Ga0307518_10000028 3300031838 Bacteria 98010
486 Ga0307410_10070078 3300031852 Bacteria 2427
487 Ga0307410_10093619 3300031852 Bacteria 2138
488 Ga0307410_10101609 3300031852 Bacteria 2062
489 Ga0307406_10079533 3300031901 Bacteria 2174
490 Ga0307406_10716839 3300031901 Bacteria 837
491 Ga0307407_10002834 3300031903 Bacteria 6929
492 Ga0307407_10148401 3300031903 Bacteria 1521
493 Ga0307407_10228782 3300031903 Bacteria 1262
494 Ga0307409_100042297 3300031995 Bacteria 3411
495 Ga0307409_100114582 3300031995 Bacteria 2268
496 Ga0307409_100122689 3300031995 Bacteria 2204
497 Ga0307409_100356020 3300031995 Bacteria 1383
498 Ga0307409_100418559 3300031995 Bacteria 1285
499 Ga0307409_100453166 3300031995 Bacteria 1239
500 Ga0307409_100528314 3300031995 Bacteria 1154
501 Ga0307416_100150513 3300032002 Bacteria 2133
502 Ga0307416_101509024 3300032002 Bacteria 778
503 Ga0307414_10588819 3300032004 Bacteria 996
504 Ga0307415_100230900 3300032126 Bacteria 1490
505 Ga0307415_101428380 3300032126 Bacteria 660
506 Ga0373958_0065009 3300034819 Bacteria 798
507 Ga0373959_0067870 3300034820 Bacteria 801
508 Ga0373951_0201422 3300035091 Bacteria 580
509 Ga0373932_0021433 3300035112 Bacteria 1706
510 Ga0373960_0051766 3300035121 Bacteria 1221
511 Ga0373942_0108728 3300035207 Bacteria 855
512 Ga0373961_0034242 3300035241 Bacteria 1435
513 Ga0373931_0036791 3300035691 Bacteria 2553
514 Ga0373931_0126691 3300035691 Bacteria 1465
515 Ga0373931_0300983 3300035691 Bacteria 990
516 Ga0395900_0117571 3300037418 Bacteria 2728
517 Ga0395900_0450194 3300037418 Bacteria 1244
518 Ga0395898_0334390 3300037466 Bacteria 1444
519 Ga0395901_0069819 3300038443 Bacteria 3659
520 Ga0439436_0007353 3300041404 Bacteria 3390
521 Ga0439438_027619 3300041405 Bacteria 1531
522 Ga0439439_0014801 3300041406 Bacteria 1901
523 Ga0439466_0014804 3300041411 Bacteria 2837
524 Ga0439466_0205833 3300041411 Bacteria 598
525 Ga0439465_0026887 3300041413 Bacteria 1821
526 Ga0451789_0783324 3300041443 Bacteria 1510
527 Ga0451793_0320317 3300041452 Bacteria 2384
528 Ga0451797_0745449 3300041453 Bacteria 1398
529 Ga0451797_1178160 3300041453 Bacteria 1009
530 Ga0451795_0224208 3300041456 Bacteria 1550
531 Ga0451802_0591086 3300041460 Bacteria 751
532 Ga0451806_806050 3300041462 Bacteria 1451
533 Ga0451804_0721298 3300041463 Bacteria 726
534 Ga0451841_0419520 3300041498 Bacteria 595
535 Ga0451845_0365457 3300041501 Bacteria 1337
536 Ga0451853_0649725 3300041512 Bacteria 729
537 Ga0439433_0001119 3300041999 Bacteria 5477
538 Ga0439442_000790 3300042002 Bacteria 6582
539 Ga0439448_0027472 3300042005 Bacteria 1794
540 Ga0439449_0001002 3300042007 Bacteria 11117
541 Ga0439452_030960 3300042010 Bacteria 1316
542 Ga0439457_005622 3300042014 Bacteria 3132
543 Ga0439462_0007839 3300042015 Bacteria 2680
544 Ga0439463_051944 3300042016 Bacteria 1046
545 Ga0439446_0013747 3300042156 Bacteria 2226
546 Ga0439434_0020631 3300042435 Bacteria 1979
547 Ga0439434_0031878 3300042435 Bacteria 1603
548 Ga0439459_0042308 3300042438 Bacteria 973
549 Ga0439464_0082322 3300042439 Bacteria 963
550 Ga0466969_0043728 3300044656 Bacteria 2231
551 Ga0466972_0022428 3300044658 Bacteria 3145
552 Ga0466965_0380622 3300044683 Bacteria 777
553 Ga0466966_0009336 3300044684 Bacteria 6496
554 Ga0466966_0048045 3300044684 Bacteria 2719
555 Ga0466961_0025109 3300044693 Bacteria 3835
556 Ga0466963_0014835 3300044694 Bacteria 4812
557 Ga0466971_0008198 3300044719 Bacteria 4556
558 Ga0466971_0043951 3300044719 Bacteria 2007
559 Ga0466970_0007129 3300044765 Bacteria 5596
560 Ga0466970_0012159 3300044765 Bacteria 4396
561 Ga0466970_0019982 3300044765 Bacteria 3477
562 Ga0466957_0107245 3300044842 Bacteria 1768
563 Ga0466957_0334522 3300044842 Bacteria 1024
564 Ga0466960_0001756 3300044901 Bacteria 7961
565 Ga0466960_0394323 3300044901 Bacteria 796
566 Ga0466959_0032739 3300045049 Bacteria 3848
567 Ga0466959_0080005 3300045049 Bacteria 2356
568 Ga0466959_0113302 3300045049 Bacteria 1934
569 Ga0466958_0101292 3300045836 Bacteria 1791
570 Ga0466958_0153823 3300045836 Bacteria 1451
571 Ga0466958_0711955 3300045836 Bacteria 654
572 Ga0466967_0003341 3300045976 Bacteria 10433
573 Ga0466967_0115293 3300045976 Bacteria 2474
574 Ga0495627_134968 3300046453 Bacteria 693
575 Ga0495603_0084998 3300046455 Bacteria 1852
576 Ga0495638_0021571 3300046460 Bacteria 4242
577 Ga0495650_0056992 3300046471 Bacteria 1583
578 Ga0495664_0092530 3300046477 Bacteria 1819
579 Ga0495585_0111285 3300046492 Bacteria 1456
580 Ga0495585_0265819 3300046492 Bacteria 852
581 Ga0495594_0044020 3300046499 Bacteria 2448
582 Ga0495608_0174282 3300046511 Bacteria 1363
583 Ga0495631_0308848 3300046518 Bacteria 673
584 Ga0495654_0000140 3300046530 Bacteria 75508
585 Ga0495587_0534783 3300046536 Bacteria 647
586 Ga0495622_0256308 3300046557 Bacteria 769
587 Ga0495656_0052761 3300046615 Bacteria 1744
588 Ga0495669_0164467 3300046684 Bacteria 1054
589 Ga0495613_0274905 3300046689 Bacteria 1171
590 Ga0495613_0308785 3300046689 Bacteria 1094
591 Ga0495624_0276047 3300046690 Bacteria 1015
592 Ga0495624_0396558 3300046690 Bacteria 829
593 Ga0495670_0057578 3300046691 Bacteria 1951
594 Ga0495670_0087786 3300046691 Bacteria 1589
595 Ga0495589_0011210 3300046794 Bacteria 4652
596 Ga0495589_0209124 3300046794 Bacteria 919
597 Ga0495600_0329958 3300046809 Bacteria 958
598 Ga0495636_0001755 3300047318 Bacteria 8263
599 Ga0495636_0072739 3300047318 Bacteria 1470
600 Ga0495676_0017481 3300047321 Bacteria 6339
601 Ga0495676_0264355 3300047321 Bacteria 1169
602 Ga0495680_0708361 3300047322 Bacteria 664
603 Ga0495687_003383 3300047443 Bacteria 11627
604 Ga0495685_001492 3300047447 Bacteria 7162
605 Ga0495686_0003364 3300047472 Bacteria 13933
606 Ga0495686_0521345 3300047472 Bacteria 624
607 Ga0495593_0099908 3300047673 Bacteria 1489
608 Ga0496100_0000383 3300048903 Bacteria 21527
609 Ga0496100_0004863 3300048903 Bacteria 7176
610 Ga0496100_0184615 3300048903 Bacteria 1510
611 Ga0496101_0000593 3300048904 Bacteria 22016
612 Ga0496101_0011857 3300048904 Bacteria 5801
613 Ga0496101_0126305 3300048904 Bacteria 1938
614 Ga0496102_0004668 3300048905 Bacteria 11588
615 Ga0496102_0084290 3300048905 Bacteria 2933
616 Ga0496102_0205197 3300048905 Bacteria 1858
617 Ga0496102_0415120 3300048905 Bacteria 1264
618 Ga0496102_0457661 3300048905 Bacteria 1197
619 Ga0496102_1244908 3300048905 Bacteria 663
620 Ga0496103_0002854 3300048906 Bacteria 10742
621 Ga0496103_0054366 3300048906 Bacteria 2482
622 Ga0496103_0054478 3300048906 Bacteria 2479
623 Ga0496104_0006811 3300048907 Bacteria 10067
624 Ga0496104_0018259 3300048907 Bacteria 6399
625 Ga0496104_0193330 3300048907 Bacteria 1947
626 Ga0496104_0392167 3300048907 Bacteria 1301
627 Ga0496106_0000615 3300048909 Bacteria 25459
628 Ga0496106_0039922 3300048909 Bacteria 3514
629 Ga0496106_0102409 3300048909 Bacteria 2221
630 Ga0496106_0365916 3300048909 Bacteria 1158
631 Ga0496107_0001171 3300048910 Bacteria 15903
632 Ga0496107_0027686 3300048910 Bacteria 4025
633 Ga0496107_0186574 3300048910 Bacteria 1540
634 Ga0496107_0255911 3300048910 Bacteria 1303
635 Ga0496107_0330251 3300048910 Bacteria 1135
636 Ga0496108_0004415 3300048911 Bacteria 11319
637 Ga0496108_0012219 3300048911 Bacteria 6986
638 Ga0496108_0135328 3300048911 Bacteria 2120
639 Ga0496108_0601994 3300048911 Bacteria 958
640 Ga0496109_0028038 3300048912 Bacteria 5033
641 Ga0496109_0129519 3300048912 Bacteria 2354
642 Ga0496109_0460088 3300048912 Bacteria 1201
643 Ga0496110_0088759 3300048913 Bacteria 2762
644 Ga0496110_0092534 3300048913 Bacteria 2706
645 Ga0496110_0722379 3300048913 Bacteria 898
646 Ga0496111_0368990 3300048914 Bacteria 1062
647 Ga0496111_0529616 3300048914 Bacteria 866
648 Ga0496113_0408736 3300048916 Bacteria 1090
649 Ga0496114_0000517 3300048917 Bacteria 28403
650 Ga0496114_0040677 3300048917 Bacteria 3849
651 Ga0496114_0426964 3300048917 Bacteria 1174
652 Ga0496115_0008256 3300048918 Bacteria 7695
653 Ga0496115_0053453 3300048918 Bacteria 3241
654 Ga0496115_0118950 3300048918 Bacteria 2173
655 Ga0496115_1089090 3300048918 Bacteria 606
656 Ga0496119_0015035 3300048922 Bacteria 5996
657 Ga0501041_0098351 3300049577 Bacteria 1810
658 Ga0501042_0223871 3300049578 Bacteria 1357
659 Ga0501075_0580022 3300049591 Bacteria 856
660 Ga0501076_0623511 3300049592 Bacteria 890
661 Ga0501045_0334080 3300049824 Bacteria 1128
662 nmdc:mga0yw44_136577_c1 3300050492 Bacteria 1591
663 nmdc:mga05p37_151291_c1 3300050507 Bacteria 1372
664 nmdc:mga0qj67_232358_c1 3300050509 Bacteria 1496
665 nmdc:mga0qj67_475227_c1 3300050509 Bacteria 1006
666 nmdc:mga08y16_1306930_c1 3300050511 Bacteria 692
667 nmdc:mga08y16_338710_c1 3300050511 Bacteria 1546
668 nmdc:mga08y16_933665_c1 3300050511 Bacteria 852
669 nmdc:mga0rr50_591096_c1 3300050513 Bacteria 946
670 Ga0495655_0230238 3300053083 Bacteria 617
671 Ga0495595_0409082 3300053084 Bacteria 688
672 Ga0500660_099896 3300053100 Bacteria 1269
673 Ga0500556_0000472 3300053104 Bacteria 28259
674 Ga0500560_000103 3300053107 Bacteria 8711
675 Ga0500562_015745 3300053108 Bacteria 1941
676 Ga0500593_003899 3300053117 Bacteria 5721
677 Ga0500628_136542 3300053129 Bacteria 677
678 Ga0500655_002692 3300053133 Bacteria 3219
679 Ga0500559_0019671 3300053136 Bacteria 2853
680 Ga0500573_0227834 3300053140 Bacteria 973
681 Ga0500616_0000027 3300053153 Bacteria 441053
682 Ga0500620_115434 3300053155 Bacteria 940
683 Ga0500645_004203 3300053730 Bacteria 5602
684 Ga0587093_053513 3300059478 Bacteria 643
685 Ga0587066_012376 3300059490 Bacteria 1272
686 Ga0587070_035744 3300059491 Bacteria 926
687 Ga0587070_050901 3300059491 Bacteria 827
688 Ga0587077_082409 3300059493 Bacteria 741
689 Ga0587080_032628 3300059503 Bacteria 915
690 Ga0587080_060492 3300059503 Bacteria 737
691 Ga0587082_016022 3300059504 Bacteria 1165
692 Ga0587082_029850 3300059504 Bacteria 944
693 Ga0587082_069561 3300059504 Bacteria 712
694 Ga0587082_084282 3300059504 Bacteria 668
695 Ga0587086_040533 3300059507 Bacteria 719
696 Ga0587088_047972 3300059508 Bacteria 827
697 Ga0587088_061262 3300059508 Bacteria 763
698 Ga0587075_008119 3300059644 Bacteria 1334
699 Ga0587075_035026 3300059644 Bacteria 817
700 Ga0587078_049321 3300059646 Bacteria 614
701 Ga0587079_004925 3300059647 Bacteria 1853
702 Ga0587079_034119 3300059647 Bacteria 994
703 Ga0587079_137505 3300059647 Bacteria 620
704 Ga0587079_168628 3300059647 Bacteria 578
705 Ga0587071_071833 3300060344 Bacteria 755
706 Ga0587071_114682 3300060344 Bacteria 637
707 Ga0587071_123693 3300060344 Bacteria 621
708 Ga0466962_0290710 3300061719 Bacteria 807
709 Ga0530510_0010046 3300061734 Bacteria 6639
710 2537898874 2537561592 Bacteria 4348607
711 2554815058 2554235132 Bacteria 6772433
712 2566993344 2565956761 Bacteria 6601618
713 2608383560 2606217733 Bacteria 6360972
714 2643827360 2643221561 Bacteria 4984412
715 2644533813 2643221696 Bacteria 5431823
716 2753036186 2751185725 Bacteria 5740550
717 2753324058 2751185792 Bacteria 5739090
718 2774396716 2773857762 Bacteria 5971770
719 2776374623 2775506925 Bacteria 7237746
720 2793283815 2791355253 Bacteria 5171699
721 2809198363 2808606439 Bacteria 5952208
722 2812349557 2811994878 Bacteria 5992952
723 2842137130 2842134933 Bacteria 5847019
724 2862514025 2862507626 Bacteria 9425308
725 2862581646 2862574272 Bacteria 10567477
726 2863075421 2863067949 Bacteria 8541735
727 2891969407 2891968417 Bacteria 5821697
728 2893685409 2893684298 Bacteria 2897960
729 2904772433 2904770941 Bacteria 5580202
730 2919395199 2919391150 Bacteria 4884741
731 2922559674 2922554459 Bacteria 6683962
732 2945958916 2945956166 Bacteria 5110334
733 2974315792 2974315732 Bacteria 4602776
734 3005416110 3005409236 Bacteria 7188837
735 8011356985 8011350971 Bacteria 6158957
736 8054479161 8054472261 Bacteria 7464355
737 Ga0436364_0139643
738 LJQas_1000116
739 LJQas_1004960
740 JGI24737J22298_10049507
741 JGI24743J22301_10003682
742 JGI24735J21928_10042444
743 JGI24738J21930_10007611
744 JGI24034J26672_10005656
745 JGI25406J46586_10079730
746 Ga0058858_1421484
747 Ga0058859_10009161
748 Ga0058863_10041758
749 Ga0058861_10087982
750 Ga0058862_10099156
751 Ga0070658_10130570
752 Ga0070676_10020890
753 Ga0070676_10118520
754 Ga0070683_100567343
755 Ga0070670_100209071
756 Ga0068869_100035747
757 Ga0068869_100039798
758 Ga0070666_10009026
759 Ga0070666_10096876
760 Ga0070680_100275773
761 Ga0070682_100030739
762 Ga0070682_100042072
763 Ga0070682_100167042
764 Ga0070682_100174053
765 Ga0070682_100361567
766 Ga0068868_100000203
767 Ga0068868_100219671
768 Ga0070660_100289439
769 Ga0070689_100040615
770 Ga0070689_100331091
771 Ga0070691_10000914
772 Ga0070691_10020230
773 Ga0070692_10019671
774 Ga0070668_100005307
775 Ga0070668_100152042
776 Ga0070668_100197378
777 Ga0070668_101364615
778 Ga0070669_100031637
779 Ga0070669_100065201
780 Ga0070675_100087473
781 Ga0070675_100340366
782 Ga0070675_100765381
783 Ga0070671_100021227
784 Ga0070671_100178098
785 Ga0070674_100000244
786 Ga0070674_100212458
787 Ga0070673_100449356
788 Ga0070688_100002188
789 Ga0070688_100018231
790 Ga0070688_100144039
791 Ga0070659_100028419
792 Ga0070659_100038097
793 Ga0070659_100049761
794 Ga0070659_100088400
795 Ga0070667_100066954
796 Ga0070667_100163065
797 Ga0070667_100850445
798 Ga0070709_10014652
799 Ga0070709_10159348
800 Ga0070709_10190005
801 Ga0070709_10804763
802 Ga0070714_100828600
803 Ga0070713_100976370
804 Ga0070710_10007738
805 Ga0070710_10025259
806 Ga0070710_10083926
807 Ga0070701_10055627
808 Ga0070711_100002396
809 Ga0070711_100005711
810 Ga0070711_100132440
811 Ga0070705_100005263
812 Ga0070705_100084114
813 Ga0070700_100012566
814 Ga0070700_100029765
815 Ga0070694_100044216
816 Ga0070694_100335162
817 Ga0070663_100012067
818 Ga0070663_100173838
819 Ga0070663_100694125
820 Ga0070678_100125867
821 Ga0070678_100148518
822 Ga0070678_100171114
823 Ga0070678_100402445
824 Ga0070662_100000713
825 Ga0070662_100023543
826 Ga0070662_100190515
827 Ga0070662_100410529
828 Ga0068867_100001211
829 Ga0068867_100070477
830 Ga0068867_100163388
831 Ga0068867_100579396
832 Ga0070685_10405609
833 Ga0070685_10924288
834 Ga0070706_101140514
835 Ga0070698_100349102
836 Ga0070679_100231529
837 Ga0070684_100259830
838 Ga0070684_100790738
839 Ga0070697_100578301
840 Ga0068853_100020911
841 Ga0070672_100084142
842 Ga0070672_100252351
843 Ga0070686_100520250
844 Ga0070695_100002690
845 Ga0070695_100105423
846 Ga0070696_100035559
847 Ga0070696_100044126
848 Ga0070696_100121686
849 Ga0070693_100035467
850 Ga0070693_100094314
851 Ga0070693_100292561
852 Ga0070693_100312734
853 Ga0070665_100005218
854 Ga0070665_100269005
855 Ga0070665_100443494
856 Ga0070665_100915168
857 Ga0070665_101299194
858 Ga0070704_100032452
859 Ga0070704_100330316
860 Ga0068855_100184547
861 Ga0068855_100320302
862 Ga0068855_100473773
863 Ga0068855_101153401
864 Ga0068857_100068268
865 Ga0068854_100000262
866 Ga0068854_100017580
867 Ga0068854_100103823
868 Ga0068854_100775741
869 Ga0068854_101038324
870 Ga0068856_100095930
871 Ga0068856_100226532
872 Ga0070702_100001129
873 Ga0070702_100011029
874 Ga0068852_100097532
875 Ga0068852_100160012
876 Ga0068852_100316407
877 Ga0068852_100328356
878 Ga0068852_100396309
879 Ga0068859_100002266
880 Ga0068859_100018292
881 Ga0068859_100171048
882 Ga0068859_100903846
883 Ga0068859_101674409
884 Ga0068864_100357442
885 Ga0068864_100380674
886 Ga0068866_10000681
887 Ga0068866_10013634
888 Ga0068866_10069881
889 Ga0068866_10366871
890 Ga0068866_10374820
891 Ga0068861_100018017
892 Ga0068861_100031467
893 Ga0068861_100293577
894 Ga0068851_10036766
895 Ga0068870_10130974
896 Ga0068870_10374851
897 Ga0068863_100064551
898 Ga0068863_100163747
899 Ga0068863_100325055
900 Ga0068858_100001689
901 Ga0068858_100072930
902 Ga0068858_100102866
903 Ga0068858_100143657
904 Ga0068858_100544263
905 Ga0068860_100001255
906 Ga0068860_100037958
907 Ga0068860_100084902
908 Ga0068860_100376133
909 Ga0068860_101278075
910 Ga0068862_100001317
911 Ga0068862_100114511
912 Ga0068862_100174243
913 Ga0068862_100384621
914 Ga0081455_10007611
915 Ga0081455_10018209
916 Ga0081539_10006743
917 Ga0081539_10031667
918 Ga0070717_10121739
919 Ga0075365_10215282
920 Ga0075364_10244722
921 Ga0075364_10591662
922 Ga0075432_10004226
923 Ga0075432_10085879
924 Ga0070715_10016658
925 Ga0070715_10041328
926 Ga0070716_100001673
927 Ga0070716_100001813
928 Ga0070712_100001225
929 Ga0070712_100056512
930 Ga0070712_100206841
931 Ga0097621_100038572
932 Ga0097621_100217142
933 Ga0068871_100044030
934 Ga0068871_100080370
935 Ga0068871_100274619
936 Ga0075428_100092968
937 Ga0068865_100300952
938 Ga0068865_100461217
939 Ga0097620_100002267
940 Ga0097620_100018292
941 Ga0097620_100171066
942 Ga0097620_100903897
943 Ga0097620_101674463
944 Ga0105251_10137392
945 Ga0105250_10206822
946 Ga0111539_10438119
947 Ga0111539_10690177
948 Ga0111539_10861476
949 Ga0111539_10902890
950 Ga0111539_11205917
951 Ga0105245_10001005
952 Ga0105245_10092913
953 Ga0105245_10207686
954 Ga0105245_10361532
955 Ga0105247_10000372
956 Ga0105247_10094069
957 Ga0105247_10185883
958 Ga0105247_10213937
959 Ga0105247_10714032
960 Ga0105247_10954126
961 Ga0114129_10111628
962 Ga0105243_10000676
963 Ga0105243_10092718
964 Ga0105243_10178741
965 Ga0105243_10573239
966 Ga0105243_11161613
967 Ga0105241_10030340
968 Ga0105241_10641842
969 Ga0105242_10000197
970 Ga0105242_10060569
971 Ga0105242_10081548
972 Ga0105242_10835790
973 Ga0105248_10014539
974 Ga0105248_10016388
975 Ga0105248_10027828
976 Ga0105248_10177001
977 Ga0105248_12625132
978 Ga0105237_10005565
979 Ga0105237_10168447
980 Ga0105237_10414322
981 Ga0105238_10093100
982 Ga0105238_10320379
983 Ga0105238_10515638
984 Ga0105238_11642875
985 Ga0105249_10355110
986 Ga0105249_10378634
987 Ga0105239_10004408
988 Ga0105246_10018879
989 Ga0105246_10310978
990 Ga0105246_11397793
991 Ga0157371_10249588
992 Ga0157370_10739994
993 Ga0157370_10864992
994 Ga0157369_10375380
995 Ga0157369_10597261
996 Ga0157374_10047682
997 Ga0157374_10052951
998 Ga0157374_10645124
999 Ga0157378_10002889
1000 Ga0157378_10030416
1001 Ga0157378_10978990
1002 Ga0163162_10002808
1003 Ga0163162_10120757
1004 Ga0163162_10210930
1005 Ga0163162_10630926
1006 Ga0163162_11750459
1007 Ga0157372_10090951
1008 Ga0157372_10303835
1009 Ga0157372_10610941
1010 Ga0157372_11187422
1011 Ga0157375_10001551
1012 Ga0157375_10228743
1013 Ga0157375_10303332
1014 Ga0157375_10337393
1015 Ga0157375_10470027
1016 Ga0157375_11573654
1017 Ga0163163_10329677
1018 Ga0163163_11921292
1019 Ga0157380_10000136
1020 Ga0157380_10023621
1021 Ga0157380_10542956
1022 Ga0157377_10019708
1023 Ga0157377_10021065
1024 Ga0157377_10051551
1025 Ga0157379_10002115
1026 Ga0157379_10181559
1027 Ga0157379_10967930
1028 Ga0157376_10039949
1029 Ga0157376_10171043
1030 Ga0157376_10355796
1031 Ga0163161_10012707
1032 Ga0163161_10338074
1033 Ga0163161_10360074
1034 Ga0163161_11163407
1035 Ga0197907_10831311
1036 Ga0206356_10184193
1037 Ga0206356_10309572
1038 Ga0206356_11613575
1039 Ga0206349_1889663
1040 Ga0206355_1246002
1041 Ga0206355_1653515
1042 Ga0206351_10992062
1043 Ga0206352_10290768
1044 Ga0206352_11145297
1045 Ga0206354_11208453
1046 Ga0206353_11504654
1047 Ga0206353_11544153
1048 Ga0224712_10004343
1049 Ga0207426_1009534
1050 Ga0207653_10028622
1051 Ga0207692_10018628
1052 Ga0207692_10027995
1053 Ga0207692_10345997
1054 Ga0207642_10000178
1055 Ga0207642_10049043
1056 Ga0207642_10067860
1057 Ga0207642_10306547
1058 Ga0207710_10011878
1059 Ga0207710_10309640
1060 Ga0207710_10459625
1061 Ga0207710_10594830
1062 Ga0207688_10002022
1063 Ga0207688_10004903
1064 Ga0207688_10007863
1065 Ga0207688_10335108
1066 Ga0207680_10007555
1067 Ga0207647_10008739
1068 Ga0207647_10034190
1069 Ga0207647_10060164
1070 Ga0207647_10075426
1071 Ga0207685_10028489
1072 Ga0207699_10057278
1073 Ga0207645_10010732
1074 Ga0207645_10653094
1075 Ga0207643_10185680
1076 Ga0207654_10159947
1077 Ga0207707_11068289
1078 Ga0207671_10056867
1079 Ga0207671_10234171
1080 Ga0207693_10000507
1081 Ga0207693_10004862
1082 Ga0207693_10006779
1083 Ga0207663_10006272
1084 Ga0207663_10045140
1085 Ga0207663_10051804
1086 Ga0207660_10374424
1087 Ga0207660_10384185
1088 Ga0207660_10676576
1089 Ga0207662_10015986
1090 Ga0207662_10314910
1091 Ga0207657_10206611
1092 Ga0207652_10188672
1093 Ga0207652_11096743
1094 Ga0207681_10032097
1095 Ga0207681_10039095
1096 Ga0207681_10140195
1097 Ga0207681_10443862
1098 Ga0207694_10548643
1099 Ga0207650_11108999
1100 Ga0207659_11420819
1101 Ga0207687_10003137
1102 Ga0207687_10054043
1103 Ga0207687_10200706
1104 Ga0207687_11324535
1105 Ga0207700_10274240
1106 Ga0207700_11046575
1107 Ga0207664_10137255
1108 Ga0207664_10533673
1109 Ga0207644_10031815
1110 Ga0207690_10034702
1111 Ga0207690_10161856
1112 Ga0207706_10001533
1113 Ga0207706_10012019
1114 Ga0207706_10014036
1115 Ga0207706_10026774
1116 Ga0207706_10372102
1117 Ga0207686_10001322
1118 Ga0207686_10078273
1119 Ga0207686_10086228
1120 Ga0207709_10003151
1121 Ga0207709_10071722
1122 Ga0207670_10005363
1123 Ga0207670_10254533
1124 Ga0207670_10569550
1125 Ga0207669_10002448
1126 Ga0207669_10010783
1127 Ga0207669_10027073
1128 Ga0207669_10250046
1129 Ga0207669_10257420
1130 Ga0207704_10000458
1131 Ga0207704_10138481
1132 Ga0207704_10165215
1133 Ga0207704_10355392
1134 Ga0207665_10001870
1135 Ga0207665_10006046
1136 Ga0207665_10031079
1137 Ga0207691_10041110
1138 Ga0207691_10142949
1139 Ga0207711_10023282
1140 Ga0207711_10108648
1141 Ga0207711_10556727
1142 Ga0207711_10691785
1143 Ga0207689_10012131
1144 Ga0207689_10012362
1145 Ga0207689_10534632
1146 Ga0207661_10747266
1147 Ga0207667_10156712
1148 Ga0207667_10596152
1149 Ga0207667_10832049
1150 Ga0207651_10362039
1151 Ga0207651_10992737
1152 Ga0207712_10005323
1153 Ga0207712_10131269
1154 Ga0207712_10259405
1155 Ga0207668_10001538
1156 Ga0207668_10111361
1157 Ga0207668_10134239
1158 Ga0207668_10188472
1159 Ga0207668_10553031
1160 Ga0207640_10000827
1161 Ga0207640_10116261
1162 Ga0207640_10264466
1163 Ga0207658_10018537
1164 Ga0207658_10312260
1165 Ga0207658_10751297
1166 Ga0207677_10018504
1167 Ga0207677_10075635
1168 Ga0207677_10384001
1169 Ga0207703_10000920
1170 Ga0207703_10055283
1171 Ga0207703_10464993
1172 Ga0207678_10003253
1173 Ga0207678_10024038
1174 Ga0207678_10358757
1175 Ga0207678_10407898
1176 Ga0207708_10024290
1177 Ga0207708_10063951
1178 Ga0207708_10091736
1179 Ga0207702_10420643
1180 Ga0207702_10852773
1181 Ga0207641_10297562
1182 Ga0207641_10451556
1183 Ga0207648_10000929
1184 Ga0207648_10033327
1185 Ga0207648_10120299
1186 Ga0207676_10432246
1187 Ga0207676_10551392
1188 Ga0207674_10017599
1189 Ga0207675_100000544
1190 Ga0207675_100041890
1191 Ga0207675_100497880
1192 Ga0207675_100723494
1193 Ga0207683_10000335
1194 Ga0207683_10013403
1195 Ga0207683_10180226
1196 Ga0207683_11145132
1197 Ga0207698_10073687
1198 Ga0207698_10148975
1199 Ga0207698_10350143
1200 Ga0207698_10633796
1201 Ga0207428_10006323
1202 Ga0207428_10219838
1203 Ga0207428_10379496
1204 Ga0268266_10673515
1205 Ga0268265_10236677
1206 Ga0268265_10310037
1207 Ga0268265_10379022
1208 Ga0268264_10001041
1209 Ga0268264_10443187
1210 Ga0268264_10586425
1211 Ga0268264_10684798
1212 Ga0307511_10001365
1213 Ga0314311_1002826
1214 Ga0307513_10000684
1215 Ga0307408_100058841
1216 Ga0307408_100380303
1217 Ga0307408_101807763
1218 Ga0307405_10458926
1219 Ga0307413_10064012
1220 Ga0307413_10329929
1221 Ga0307518_10000028
1222 Ga0307410_10070078
1223 Ga0307410_10093619
1224 Ga0307410_10101609
1225 Ga0307406_10079533
1226 Ga0307406_10716839
1227 Ga0307407_10002834
1228 Ga0307407_10148401
1229 Ga0307407_10228782
1230 Ga0307409_100042297
1231 Ga0307409_100114582
1232 Ga0307409_100122689
1233 Ga0307409_100356020
1234 Ga0307409_100418559
1235 Ga0307409_100453166
1236 Ga0307409_100528314
1237 Ga0307416_100150513
1238 Ga0307416_101509024
1239 Ga0307414_10588819
1240 Ga0307415_100230900
1241 Ga0307415_101428380
1242 Ga0373958_0065009
1243 Ga0373959_0067870
1244 Ga0373951_0201422
1245 Ga0373932_0021433
1246 Ga0373960_0051766
1247 Ga0373942_0108728
1248 Ga0373961_0034242
1249 Ga0373931_0036791
1250 Ga0373931_0126691
1251 Ga0373931_0300983
1252 Ga0395900_0117571
1253 Ga0395900_0450194
1254 Ga0395898_0334390
1255 Ga0395901_0069819
1256 Ga0439436_0007353
1257 Ga0439438_027619
1258 Ga0439439_0014801
1259 Ga0439466_0014804
1260 Ga0439466_0205833
1261 Ga0439465_0026887
1262 Ga0451789_0783324
1263 Ga0451793_0320317
1264 Ga0451797_0745449
1265 Ga0451797_1178160
1266 Ga0451795_0224208
1267 Ga0451802_0591086
1268 Ga0451806_806050
1269 Ga0451804_0721298
1270 Ga0451841_0419520
1271 Ga0451845_0365457
1272 Ga0451853_0649725
1273 Ga0439433_0001119
1274 Ga0439442_000790
1275 Ga0439448_0027472
1276 Ga0439449_0001002
1277 Ga0439452_030960
1278 Ga0439457_005622
1279 Ga0439462_0007839
1280 Ga0439463_051944
1281 Ga0439446_0013747
1282 Ga0439434_0020631
1283 Ga0439434_0031878
1284 Ga0439459_0042308
1285 Ga0439464_0082322
1286 Ga0466969_0043728
1287 Ga0466972_0022428
1288 Ga0466965_0380622
1289 Ga0466966_0009336
1290 Ga0466966_0048045
1291 Ga0466961_0025109
1292 Ga0466963_0014835
1293 Ga0466971_0008198
1294 Ga0466971_0043951
1295 Ga0466970_0007129
1296 Ga0466970_0012159
1297 Ga0466970_0019982
1298 Ga0466957_0107245
1299 Ga0466957_0334522
1300 Ga0466960_0001756
1301 Ga0466960_0394323
1302 Ga0466959_0032739
1303 Ga0466959_0080005
1304 Ga0466959_0113302
1305 Ga0466958_0101292
1306 Ga0466958_0153823
1307 Ga0466958_0711955
1308 Ga0466967_0003341
1309 Ga0466967_0115293
1310 Ga0495627_134968
1311 Ga0495603_0084998
1312 Ga0495638_0021571
1313 Ga0495650_0056992
1314 Ga0495664_0092530
1315 Ga0495585_0111285
1316 Ga0495585_0265819
1317 Ga0495594_0044020
1318 Ga0495608_0174282
1319 Ga0495631_0308848
1320 Ga0495654_0000140
1321 Ga0495587_0534783
1322 Ga0495622_0256308
1323 Ga0495656_0052761
1324 Ga0495669_0164467
1325 Ga0495613_0274905
1326 Ga0495613_0308785
1327 Ga0495624_0276047
1328 Ga0495624_0396558
1329 Ga0495670_0057578
1330 Ga0495670_0087786
1331 Ga0495589_0011210
1332 Ga0495589_0209124
1333 Ga0495600_0329958
1334 Ga0495636_0001755
1335 Ga0495636_0072739
1336 Ga0495676_0017481
1337 Ga0495676_0264355
1338 Ga0495680_0708361
1339 Ga0495687_003383
1340 Ga0495685_001492
1341 Ga0495686_0003364
1342 Ga0495686_0521345
1343 Ga0495593_0099908
1344 Ga0496100_0000383
1345 Ga0496100_0004863
1346 Ga0496100_0184615
1347 Ga0496101_0000593
1348 Ga0496101_0011857
1349 Ga0496101_0126305
1350 Ga0496102_0004668
1351 Ga0496102_0084290
1352 Ga0496102_0205197
1353 Ga0496102_0415120
1354 Ga0496102_0457661
1355 Ga0496102_1244908
1356 Ga0496103_0002854
1357 Ga0496103_0054366
1358 Ga0496103_0054478
1359 Ga0496104_0006811
1360 Ga0496104_0018259
1361 Ga0496104_0193330
1362 Ga0496104_0392167
1363 Ga0496106_0000615
1364 Ga0496106_0039922
1365 Ga0496106_0102409
1366 Ga0496106_0365916
1367 Ga0496107_0001171
1368 Ga0496107_0027686
1369 Ga0496107_0186574
1370 Ga0496107_0255911
1371 Ga0496107_0330251
1372 Ga0496108_0004415
1373 Ga0496108_0012219
1374 Ga0496108_0135328
1375 Ga0496108_0601994
1376 Ga0496109_0028038
1377 Ga0496109_0129519
1378 Ga0496109_0460088
1379 Ga0496110_0088759
1380 Ga0496110_0092534
1381 Ga0496110_0722379
1382 Ga0496111_0368990
1383 Ga0496111_0529616
1384 Ga0496113_0408736
1385 Ga0496114_0000517
1386 Ga0496114_0040677
1387 Ga0496114_0426964
1388 Ga0496115_0008256
1389 Ga0496115_0053453
1390 Ga0496115_0118950
1391 Ga0496115_1089090
1392 Ga0496119_0015035
1393 Ga0501041_0098351
1394 Ga0501042_0223871
1395 Ga0501075_0580022
1396 Ga0501076_0623511
1397 Ga0501045_0334080
1398 nmdc:mga0yw44_136577_c1
1399 nmdc:mga05p37_151291_c1
1400 nmdc:mga0qj67_232358_c1
1401 nmdc:mga0qj67_475227_c1
1402 nmdc:mga08y16_1306930_c1
1403 nmdc:mga08y16_338710_c1
1404 nmdc:mga08y16_933665_c1
1405 nmdc:mga0rr50_591096_c1
1406 Ga0495655_0230238
1407 Ga0495595_0409082
1408 Ga0500660_099896
1409 Ga0500556_0000472
1410 Ga0500560_000103
1411 Ga0500562_015745
1412 Ga0500593_003899
1413 Ga0500628_136542
1414 Ga0500655_002692
1415 Ga0500559_0019671
1416 Ga0500573_0227834
1417 Ga0500616_0000027
1418 Ga0500620_115434
1419 Ga0500645_004203
1420 Ga0587093_053513
1421 Ga0587066_012376
1422 Ga0587070_035744
1423 Ga0587070_050901
1424 Ga0587077_082409
1425 Ga0587080_032628
1426 Ga0587080_060492
1427 Ga0587082_016022
1428 Ga0587082_029850
1429 Ga0587082_069561
1430 Ga0587082_084282
1431 Ga0587086_040533
1432 Ga0587088_047972
1433 Ga0587088_061262
1434 Ga0587075_008119
1435 Ga0587075_035026
1436 Ga0587078_049321
1437 Ga0587079_004925
1438 Ga0587079_034119
1439 Ga0587079_137505
1440 Ga0587079_168628
1441 Ga0587071_071833
1442 Ga0587071_114682
1443 Ga0587071_123693
1444 Ga0466962_0290710
1445 Ga0530510_0010046
1446 2537898874
1447 2554815058
1448 2566993344
1449 2608383560
1450 2643827360
1451 2644533813
1452 2753036186
1453 2753324058
1454 2774396716
1455 2776374623
1456 2793283815
1457 2809198363
1458 2812349557
1459 2842137130
1460 2862514025
1461 2862581646
1462 2863075421
1463 2891969407
1464 2893685409
1465 2904772433
1466 2919395199
1467 2922559674
1468 2945958916
1469 2974315792
1470 3005416110
1471 8011356985
1472 8054479161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

40

182

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e99-assembly1.cif.gz_A crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9196 8 170
3e99-assembly1.cif.gz_A crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9078 8 170
3eby-assembly1.cif.gz_A crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution 0.8499 12 165
7urz-assembly1.cif.gz_B hexadecameric hub domain of camkii beta 0.8309 11 158
7urz-assembly1.cif.gz_G hexadecameric hub domain of camkii beta 0.8231 15 158
ID Description Score Start End Superfamily
3e99A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9184 8 170 3.10.450.50
3e99A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9124 8 170 3.10.450.50
3ebyA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8651 12 161 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8263 15 158 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8244 15 160 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A243SX33-F1-model_v4 deleted 0.9184 95 170
AF-A0A5E7FVH8-F1-model_v4 Uncharacterized protein 0.9137 94 162
AF-A0A243SX33-F1-model_v4 deleted 0.9069 95 170
AF-A0A4R4ME56-F1-model_v4 deleted 0.9036 91 162
AF-A0A090YWA0-F1-model_v4 Putative transcriptional regulator, Bla/Mec 0.8968 96 157

Map