F478263

General Info

Members Datasets Scaffolds Average Seq Length
736 385 1472 121

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10541086|Ga0157371_105410861
Length 148
Sequence MATILTVDDSPSIRQMIKVVLGPAGHNVLEASDGAQGLEAAKSAKPDLVITDLNMPVMNGMELIKALRKQPSLVGLPIVFLTTESNDATKQEAKAAGATGWITKPFKPEQLLAVVSKLVRTCRHWIRLMSSDRKQASSSKFSKGPCWI

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
68 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
160 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
161 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
162 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
340 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
341 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
348 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
349 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
350 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
351 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
352 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
353 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
354 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
355 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
356 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
357 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
358 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
359 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
360 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
361 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
364 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
365 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
366 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
367 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
368 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
369 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
370 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
371 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
372 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
373 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
374 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
375 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
376 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
377 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
378 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
379 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
380 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.52
Nodule 1.22
Rhizoplane 3.94
Rhizosphere 65.35
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10541086 3300013102 Bacteria 863
2 JGI24736J21556_1063606 3300001904 Bacteria 572
3 JGI24739J22299_10100083 3300001989 Bacteria 875
4 JGI24737J22298_10135173 3300001990 Bacteria 728
5 JGI24735J21928_10147995 3300002067 Bacteria 678
6 JGI25153J46596_10000633 3300003215 Bacteria 21490
7 JGI25153J46596_10000651 3300003215 Bacteria 21219
8 JGI25153J46596_10006525 3300003215 Bacteria 5888
9 JGI25153J46596_10011915 3300003215 Bacteria 3805
10 JGI25153J46596_10037547 3300003215 Bacteria 1538
11 JGI25153J46596_10089491 3300003215 Bacteria 747
12 rootH1_10201646 3300003323 Bacteria 1334
13 JGI25160J50197_1056197 3300003354 Bacteria 807
14 Ga0055526_1036046 3300003771 Bacteria 1320
15 Ga0055524_1007998 3300003775 Bacteria 4435
16 Ga0055524_1059930 3300003775 Bacteria 796
17 Ga0055531_10005412 3300003794 Bacteria 7481
18 Ga0065165_1000054 3300005262 Bacteria 187351
19 Ga0065165_1001857 3300005262 Bacteria 20523
20 Ga0065165_1002497 3300005262 Bacteria 15404
21 Ga0065165_1061509 3300005262 Bacteria 1027
22 Ga0070683_100038089 3300005329 Bacteria 4405
23 Ga0070683_100057527 3300005329 Bacteria 3612
24 Ga0070683_100765555 3300005329 Bacteria 925
25 Ga0070670_101423776 3300005331 Bacteria 636
26 Ga0070680_100094782 3300005336 Bacteria 2474
27 Ga0070682_101804299 3300005337 Bacteria 534
28 Ga0068868_100357737 3300005338 Bacteria 1252
29 Ga0070660_100294597 3300005339 Bacteria 1329
30 Ga0070660_101761265 3300005339 Bacteria 528
31 Ga0070691_10030518 3300005341 Bacteria 2525
32 Ga0070671_100289106 3300005355 Bacteria 1395
33 Ga0070667_100930754 3300005367 Bacteria 810
34 Ga0070709_10001267 3300005434 Bacteria 13836
35 Ga0070709_11017313 3300005434 Bacteria 660
36 Ga0070714_100135360 3300005435 Bacteria 2206
37 Ga0070714_100213431 3300005435 Bacteria 1770
38 Ga0070713_100006642 3300005436 Bacteria 8044
39 Ga0070710_10001610 3300005437 Bacteria 10663
40 Ga0070711_100002880 3300005439 Bacteria 9907
41 Ga0070663_100063537 3300005455 Bacteria 2666
42 Ga0070663_100666177 3300005455 Bacteria 881
43 Ga0070681_10229924 3300005458 Bacteria 1769
44 Ga0070681_11349987 3300005458 Bacteria 636
45 Ga0070679_100195528 3300005530 Bacteria 1990
46 Ga0070679_100214870 3300005530 Bacteria 1886
47 Ga0070679_101845899 3300005530 Bacteria 553
48 Ga0070684_100032985 3300005535 Bacteria 4418
49 Ga0070684_100610185 3300005535 Bacteria 1015
50 Ga0068853_100295866 3300005539 Bacteria 1495
51 Ga0068853_100469902 3300005539 Bacteria 1185
52 Ga0068853_100516200 3300005539 Bacteria 1129
53 Ga0068853_100794613 3300005539 Bacteria 906
54 Ga0068853_101628346 3300005539 Bacteria 626
55 Ga0068855_100080309 3300005563 Bacteria 3782
56 Ga0068855_101935132 3300005563 Bacteria 597
57 Ga0070664_100705062 3300005564 Bacteria 940
58 Ga0068857_100265926 3300005577 Bacteria 1575
59 Ga0068857_100444308 3300005577 Bacteria 1212
60 Ga0068857_100732826 3300005577 Bacteria 941
61 Ga0068854_100328560 3300005578 Bacteria 1245
62 Ga0068856_100375959 3300005614 Bacteria 1440
63 Ga0068856_101597303 3300005614 Bacteria 665
64 Ga0068852_100001747 3300005616 Bacteria 14801
65 Ga0068859_100108929 3300005617 Bacteria 2831
66 Ga0068864_100000060 3300005618 Bacteria 124506
67 Ga0068864_100208399 3300005618 Bacteria 1799
68 Ga0068864_100398976 3300005618 Bacteria 1307
69 Ga0068851_10183858 3300005834 Bacteria 1159
70 Ga0068870_10512580 3300005840 Bacteria 801
71 Ga0068863_100000023 3300005841 Bacteria 186490
72 Ga0068863_100182757 3300005841 Bacteria 2013
73 Ga0068863_100216415 3300005841 Bacteria 1845
74 Ga0068858_100011301 3300005842 Bacteria 8435
75 Ga0068860_100608105 3300005843 Bacteria 1099
76 Ga0068860_100626215 3300005843 Bacteria 1083
77 Ga0068860_101235463 3300005843 Bacteria 768
78 Ga0068862_100966501 3300005844 Bacteria 841
79 Ga0081455_10106377 3300005937 Bacteria 2239
80 Ga0081540_1048867 3300005983 Bacteria 2115
81 Ga0070717_10128448 3300006028 Bacteria 2178
82 Ga0070717_10238080 3300006028 Bacteria 1604
83 Ga0075365_10012541 3300006038 Bacteria 5038
84 Ga0075365_10039785 3300006038 Bacteria 3063
85 Ga0075365_10100286 3300006038 Bacteria 1982
86 Ga0075368_10283293 3300006042 Bacteria 712
87 Ga0075363_100019810 3300006048 Bacteria 3368
88 Ga0075363_100373654 3300006048 Bacteria 835
89 Ga0075363_101003995 3300006048 Bacteria 514
90 Ga0075364_10523514 3300006051 Bacteria 811
91 Ga0070715_10569651 3300006163 Bacteria 659
92 Ga0070716_100001907 3300006173 Bacteria 9470
93 Ga0070712_100022694 3300006175 Bacteria 4137
94 Ga0075362_10060294 3300006177 Bacteria 1715
95 Ga0075362_10183579 3300006177 Bacteria 1014
96 Ga0075362_10598125 3300006177 Bacteria 570
97 Ga0075367_10096852 3300006178 Bacteria 1799
98 Ga0075367_10099824 3300006178 Bacteria 1773
99 Ga0075367_10127753 3300006178 Bacteria 1570
100 Ga0075367_10972276 3300006178 Bacteria 542
101 Ga0075369_10100669 3300006186 Bacteria 1296
102 Ga0075369_10120731 3300006186 Bacteria 1186
103 Ga0075366_10008786 3300006195 Bacteria 5626
104 Ga0097621_101899187 3300006237 Bacteria 568
105 Ga0075370_10047941 3300006353 Bacteria 2420
106 Ga0075370_10133086 3300006353 Bacteria 1451
107 Ga0068871_100635702 3300006358 Bacteria 973
108 Ga0075433_11578652 3300006852 Unclassified 566
109 Ga0075434_100248208 3300006871 Bacteria 1799
110 Ga0075436_100889635 3300006914 Bacteria 666
111 Ga0097620_100108929 3300006931 Bacteria 2831
112 Ga0099824_1024667 3300006942 Bacteria 3458
113 Ga0099823_1070945 3300006944 Bacteria 1547
114 Ga0105251_10063426 3300009011 Bacteria 1734
115 Ga0105251_10210083 3300009011 Bacteria 876
116 Ga0105244_10397525 3300009036 Bacteria 634
117 Ga0105250_10012457 3300009092 Bacteria 3510
118 Ga0105240_10008853 3300009093 Bacteria 14333
119 Ga0105240_10020641 3300009093 Bacteria 8781
120 Ga0105240_10164739 3300009093 Bacteria 2630
121 Ga0105240_10465050 3300009093 Bacteria 1412
122 Ga0105240_11113435 3300009093 Bacteria 840
123 Ga0105245_10336467 3300009098 Bacteria 1491
124 Ga0105245_10877220 3300009098 Bacteria 938
125 Ga0105247_10122059 3300009101 Bacteria 1689
126 Ga0105247_10396142 3300009101 Bacteria 982
127 Ga0105247_10803452 3300009101 Bacteria 718
128 Ga0105247_10937133 3300009101 Bacteria 671
129 Ga0105243_10139868 3300009148 Bacteria 2064
130 Ga0105243_10917821 3300009148 Bacteria 872
131 Ga0105241_11457722 3300009174 Bacteria 657
132 Ga0105242_10949479 3300009176 Bacteria 864
133 Ga0105248_10001464 3300009177 Bacteria 26304
134 Ga0105248_10800750 3300009177 Bacteria 1064
135 Ga0105248_10860246 3300009177 Bacteria 1024
136 Ga0105248_12313384 3300009177 Bacteria 612
137 Ga0105237_10014235 3300009545 Bacteria 8329
138 Ga0105237_10042891 3300009545 Bacteria 4559
139 Ga0105237_10139035 3300009545 Bacteria 2423
140 Ga0105237_10265701 3300009545 Bacteria 1719
141 Ga0105237_10644094 3300009545 Bacteria 1066
142 Ga0105237_11725061 3300009545 Bacteria 634
143 Ga0105238_10063440 3300009551 Bacteria 3695
144 Ga0105238_10374439 3300009551 Bacteria 1415
145 Ga0105238_10712014 3300009551 Bacteria 1016
146 Ga0105238_10791518 3300009551 Bacteria 963
147 Ga0105238_11255130 3300009551 Bacteria 766
148 Ga0105249_10339575 3300009553 Bacteria 1518
149 Ga0105239_10039622 3300010375 Bacteria 5161
150 Ga0105239_10079622 3300010375 Bacteria 3605
151 Ga0105239_10079805 3300010375 Bacteria 3601
152 Ga0105239_13536518 3300010375 Bacteria 508
153 Ga0105246_10015578 3300011119 Bacteria 4804
154 Ga0157373_10307542 3300013100 Bacteria 1126
155 Ga0157371_11115882 3300013102 Bacteria 605
156 Ga0157370_10050197 3300013104 Bacteria 3988
157 Ga0157370_11160226 3300013104 Bacteria 697
158 Ga0157369_10007758 3300013105 Bacteria 12344
159 Ga0157369_10009352 3300013105 Bacteria 11208
160 Ga0157369_10484841 3300013105 Bacteria 1279
161 Ga0157369_10729188 3300013105 Bacteria 1020
162 Ga0157374_10457643 3300013296 Bacteria 1278
163 Ga0157374_10885120 3300013296 Bacteria 910
164 Ga0157378_10433232 3300013297 Bacteria 1302
165 Ga0163162_10165287 3300013306 Bacteria 2336
166 Ga0157372_10213404 3300013307 Bacteria 2237
167 Ga0157372_10476886 3300013307 Bacteria 1454
168 Ga0157375_10136536 3300013308 Bacteria 2577
169 Ga0163163_10071930 3300014325 Bacteria 3447
170 Ga0163163_10536565 3300014325 Bacteria 1232
171 Ga0163163_10975280 3300014325 Bacteria 911
172 Ga0182008_10855741 3300014497 Bacteria 532
173 Ga0157379_10058879 3300014968 Bacteria 3435
174 Ga0157379_10603277 3300014968 Bacteria 1025
175 Ga0157379_11221694 3300014968 Bacteria 723
176 Ga0157379_12117066 3300014968 Bacteria 558
177 Ga0157376_10096295 3300014969 Bacteria 2575
178 Ga0213873_10010521 3300021358 Bacteria 1953
179 Ga0213872_10004165 3300021361 Bacteria 7775
180 Ga0213872_10031833 3300021361 Bacteria 2417
181 Ga0213872_10370683 3300021361 Bacteria 584
182 Ga0213876_10065160 3300021384 Bacteria 1923
183 Ga0213876_10103445 3300021384 Bacteria 1510
184 Ga0213875_10119834 3300021388 Bacteria 1229
185 Ga0213875_10122984 3300021388 Bacteria 1213
186 Ga0213871_10007632 3300021441 Bacteria 2350
187 Ga0207425_1010576 3300025245 Bacteria 2239
188 Ga0209148_1000421 3300025254 Bacteria 47524
189 Ga0209148_1016562 3300025254 Bacteria 1266
190 Ga0209148_1043097 3300025254 Bacteria 615
191 Ga0209233_1002484 3300025261 Bacteria 6755
192 Ga0209233_1002615 3300025261 Bacteria 6539
193 Ga0209233_1017000 3300025261 Bacteria 1990
194 Ga0209455_1007536 3300025272 Bacteria 3062
195 Ga0209130_1081120 3300025284 Bacteria 522
196 Ga0209564_1000044 3300025295 Bacteria 381017
197 Ga0209564_1004705 3300025295 Bacteria 8182
198 Ga0209564_1014807 3300025295 Bacteria 3216
199 Ga0209758_1000117 3300025297 Bacteria 198325
200 Ga0209758_1000506 3300025297 Bacteria 63135
201 Ga0209758_1001068 3300025297 Bacteria 35664
202 Ga0209758_1001793 3300025297 Bacteria 23709
203 Ga0209758_1003491 3300025297 Bacteria 14222
204 Ga0209758_1007058 3300025297 Bacteria 7792
205 Ga0209050_1070340 3300025298 Bacteria 784
206 Ga0209256_1000740 3300025299 Bacteria 42806
207 Ga0209256_1007255 3300025299 Bacteria 5533
208 Ga0209256_1008199 3300025299 Bacteria 4906
209 Ga0207426_1000467 3300025302 Bacteria 62488
210 Ga0207426_1000508 3300025302 Bacteria 57035
211 Ga0207426_1006582 3300025302 Bacteria 5014
212 Ga0207426_1023419 3300025302 Bacteria 2107
213 Ga0207426_1075361 3300025302 Bacteria 929
214 Ga0207426_1103153 3300025302 Bacteria 732
215 Ga0209051_1030114 3300025303 Bacteria 2111
216 Ga0209257_1000158 3300025304 Bacteria 180079
217 Ga0209257_1023507 3300025304 Bacteria 2164
218 Ga0207692_10001796 3300025898 Bacteria 8136
219 Ga0207710_10023967 3300025900 Bacteria 2626
220 Ga0207710_10318232 3300025900 Bacteria 788
221 Ga0207688_10138968 3300025901 Bacteria 1429
222 Ga0207680_10052867 3300025903 Bacteria 2436
223 Ga0207647_10006024 3300025904 Bacteria 8837
224 Ga0207647_10146688 3300025904 Bacteria 1380
225 Ga0207685_10315612 3300025905 Bacteria 778
226 Ga0207699_10000749 3300025906 Bacteria 15507
227 Ga0207707_10660765 3300025912 Bacteria 880
228 Ga0207695_10000136 3300025913 Bacteria 217596
229 Ga0207695_10019551 3300025913 Bacteria 7793
230 Ga0207695_10113023 3300025913 Bacteria 2692
231 Ga0207695_10201059 3300025913 Bacteria 1907
232 Ga0207695_11137786 3300025913 Bacteria 661
233 Ga0207671_10000202 3300025914 Bacteria 90868
234 Ga0207671_10136125 3300025914 Bacteria 1889
235 Ga0207671_10171842 3300025914 Bacteria 1683
236 Ga0207671_10285439 3300025914 Bacteria 1302
237 Ga0207671_10556070 3300025914 Bacteria 915
238 Ga0207693_10176854 3300025915 Bacteria 1679
239 Ga0207693_10227360 3300025915 Bacteria 1465
240 Ga0207663_10001805 3300025916 Bacteria 10114
241 Ga0207660_10435695 3300025917 Bacteria 1059
242 Ga0207657_10304669 3300025919 Bacteria 1262
243 Ga0207657_10332726 3300025919 Bacteria 1199
244 Ga0207657_10392953 3300025919 Bacteria 1091
245 Ga0207649_10874190 3300025920 Bacteria 704
246 Ga0207652_10150356 3300025921 Bacteria 2085
247 Ga0207652_10313972 3300025921 Bacteria 1415
248 Ga0207681_10762870 3300025923 Bacteria 807
249 Ga0207694_10079372 3300025924 Bacteria 2574
250 Ga0207694_10092566 3300025924 Bacteria 2387
251 Ga0207694_10934411 3300025924 Bacteria 734
252 Ga0207694_11431450 3300025924 Bacteria 584
253 Ga0207650_10212832 3300025925 Bacteria 1553
254 Ga0207650_11610041 3300025925 Bacteria 551
255 Ga0207687_10652712 3300025927 Bacteria 890
256 Ga0207700_10004852 3300025928 Bacteria 7985
257 Ga0207700_10169014 3300025928 Bacteria 1822
258 Ga0207700_11201268 3300025928 Bacteria 677
259 Ga0207664_10053425 3300025929 Bacteria 3198
260 Ga0207664_10151837 3300025929 Bacteria 1968
261 Ga0207690_10106076 3300025932 Bacteria 2016
262 Ga0207706_10100034 3300025933 Bacteria 2551
263 Ga0207686_10905971 3300025934 Bacteria 712
264 Ga0207709_10130291 3300025935 Bacteria 1713
265 Ga0207709_10611520 3300025935 Bacteria 864
266 Ga0207665_10002001 3300025939 Bacteria 13745
267 Ga0207711_10001333 3300025941 Bacteria 23353
268 Ga0207711_10567296 3300025941 Bacteria 1059
269 Ga0207689_10634348 3300025942 Bacteria 900
270 Ga0207661_10013432 3300025944 Bacteria 5981
271 Ga0207661_10062354 3300025944 Bacteria 3016
272 Ga0207661_11599670 3300025944 Bacteria 596
273 Ga0207667_10441570 3300025949 Bacteria 1323
274 Ga0207667_10707351 3300025949 Bacteria 1009
275 Ga0207651_10220893 3300025960 Bacteria 1532
276 Ga0207712_10907609 3300025961 Bacteria 779
277 Ga0207668_11197751 3300025972 Bacteria 682
278 Ga0207640_10514171 3300025981 Bacteria 1000
279 Ga0207703_10000571 3300026035 Bacteria 37816
280 Ga0207639_10186688 3300026041 Bacteria 1768
281 Ga0207639_10277379 3300026041 Bacteria 1473
282 Ga0207639_10729666 3300026041 Bacteria 920
283 Ga0207639_11020290 3300026041 Bacteria 775
284 Ga0207678_10055007 3300026067 Bacteria 3428
285 Ga0207678_10066190 3300026067 Bacteria 3103
286 Ga0207678_10202709 3300026067 Bacteria 1697
287 Ga0207678_10883620 3300026067 Bacteria 790
288 Ga0207678_11713587 3300026067 Bacteria 552
289 Ga0207708_11822248 3300026075 Bacteria 534
290 Ga0207702_10283974 3300026078 Bacteria 1566
291 Ga0207641_10000067 3300026088 Bacteria 155379
292 Ga0207641_10180966 3300026088 Bacteria 1931
293 Ga0207641_10221377 3300026088 Bacteria 1755
294 Ga0207648_10105282 3300026089 Bacteria 2475
295 Ga0207676_10001977 3300026095 Bacteria 14926
296 Ga0207676_10743709 3300026095 Bacteria 953
297 Ga0207676_11361098 3300026095 Bacteria 705
298 Ga0207676_11816878 3300026095 Bacteria 608
299 Ga0207676_12502286 3300026095 Bacteria 513
300 Ga0207674_10295232 3300026116 Bacteria 1569
301 Ga0207674_10851309 3300026116 Bacteria 879
302 Ga0207675_100260059 3300026118 Bacteria 1682
303 Ga0207683_10091813 3300026121 Bacteria 2705
304 Ga0209281_1027067 3300027111 Bacteria 1053
305 Ga0209389_1000056 3300027296 Bacteria 107673
306 Ga0209389_1000206 3300027296 Bacteria 42342
307 Ga0209589_1000034 3300027357 Bacteria 138086
308 Ga0209489_100009 3300027361 Bacteria 263873
309 Ga0209489_103071 3300027361 Bacteria 33029
310 Ga0209700_100471 3300027363 Bacteria 75447
311 Ga0209813_10107735 3300027866 Bacteria 956
312 Ga0209813_10144029 3300027866 Bacteria 848
313 Ga0268266_10133830 3300028379 Bacteria 2219
314 Ga0268266_10933498 3300028379 Bacteria 839
315 Ga0268265_10149380 3300028380 Bacteria 1969
316 Ga0268264_10473708 3300028381 Bacteria 1217
317 Ga0268264_10664299 3300028381 Bacteria 1032
318 Ga0307515_10303528 3300028794 Bacteria 1279
319 Ga0265338_10009258 3300028800 Bacteria 11784
320 Ga0265324_10202588 3300029957 Bacteria 674
321 Ga0265330_10034992 3300031235 Bacteria 2242
322 Ga0265330_10039393 3300031235 Bacteria 2099
323 Ga0265330_10062578 3300031235 Bacteria 1618
324 Ga0265328_10015517 3300031239 Bacteria 2982
325 Ga0265325_10025516 3300031241 Bacteria 3208
326 Ga0265325_10043185 3300031241 Bacteria 2353
327 Ga0265325_10266042 3300031241 Bacteria 772
328 Ga0265340_10009354 3300031247 Bacteria 5263
329 Ga0265340_10327074 3300031247 Bacteria 678
330 Ga0265339_10014821 3300031249 Bacteria 4690
331 Ga0265316_10256633 3300031344 Bacteria 1282
332 Ga0265313_10176613 3300031595 Bacteria 899
333 Ga0265313_10291340 3300031595 Bacteria 658
334 Ga0265314_10035527 3300031711 Bacteria 3631
335 Ga0265314_10054932 3300031711 Bacteria 2753
336 Ga0265314_10126958 3300031711 Bacteria 1596
337 Ga0265314_10442368 3300031711 Bacteria 694
338 Ga0265342_10100271 3300031712 Bacteria 1650
339 Ga0265342_10102084 3300031712 Bacteria 1632
340 Ga0265342_10169122 3300031712 Bacteria 1204
341 Ga0307406_10109482 3300031901 Bacteria 1899
342 Ga0307406_10339551 3300031901 Bacteria 1169
343 Ga0307409_100840991 3300031995 Bacteria 928
344 Ga0307510_10063444 3300033180 Bacteria 3763
345 Ga0373928_0003582 3300035084 Bacteria 2962
346 Ga0373932_0016697 3300035112 Bacteria 1876
347 Ga0373943_0848637 3300035170 Bacteria 545
348 Ga0373931_0375875 3300035691 Bacteria 895
349 Ga0373925_0065376 3300037068 Bacteria 2740
350 Ga0395899_0112185 3300037312 Bacteria 1959
351 Ga0395899_0206251 3300037312 Bacteria 1368
352 Ga0395900_0003815 3300037418 Bacteria 16114
353 Ga0395900_0033307 3300037418 Bacteria 5303
354 Ga0395900_0057751 3300037418 Bacteria 3995
355 Ga0395900_0723873 3300037418 Bacteria 927
356 Ga0395900_0904579 3300037418 Bacteria 806
357 Ga0395898_0007171 3300037466 Bacteria 11834
358 Ga0395898_0022885 3300037466 Bacteria 6320
359 Ga0395898_0097903 3300037466 Bacteria 2817
360 Ga0395905_0637162 3300037471 Bacteria 968
361 Ga0395905_0894013 3300037471 Bacteria 791
362 Ga0436364_0487949 3300037853 Bacteria 2019
363 Ga0436364_0646122 3300037853 Bacteria 1983
364 Ga0436364_0899392 3300037853 Bacteria 3249
365 Ga0436364_1201854 3300037853 Bacteria 1207
366 Ga0395901_0017745 3300038443 Bacteria 7264
367 Ga0395901_0072187 3300038443 Bacteria 3598
368 Ga0436365_0167269 3300039437 Bacteria 1661
369 Ga0436365_0642071 3300039437 Bacteria 2101
370 Ga0436365_0817878 3300039437 Bacteria 1149
371 Ga0436365_1667821 3300039437 Bacteria 1026
372 Ga0436360_0463479 3300039438 Bacteria 2612
373 Ga0436360_0628778 3300039438 Bacteria 1406
374 Ga0436361_0077944 3300039447 Bacteria 3047
375 Ga0436361_0238145 3300039447 Bacteria 6517
376 Ga0436361_0274756 3300039447 Bacteria 52927
377 Ga0436361_0488424 3300039447 Bacteria 3382
378 Ga0436361_0489737 3300039447 Bacteria 10225
379 Ga0436361_1115272 3300039447 Bacteria 2984
380 Ga0436363_0656246 3300039450 Bacteria 572
381 Ga0436363_1420126 3300039450 Bacteria 903
382 Ga0436362_0085232 3300039453 Bacteria 5983
383 Ga0436362_0120734 3300039453 Bacteria 805
384 Ga0451843_0121359 3300041509 Bacteria 791
385 Ga0451853_2243521 3300041512 Bacteria 1862
386 Ga0439448_0145914 3300042005 Bacteria 820
387 Ga0439455_0091643 3300042012 Bacteria 834
388 Ga0466972_0013574 3300044658 Bacteria 4088
389 Ga0466972_0060680 3300044658 Bacteria 1814
390 Ga0466972_0148323 3300044658 Bacteria 1103
391 Ga0453683_0016715 3300044673 Bacteria 4729
392 Ga0453683_0071616 3300044673 Bacteria 2169
393 Ga0453683_0650408 3300044673 Unclassified 689
394 Ga0466965_0014378 3300044683 Bacteria 3744
395 Ga0466965_0126215 3300044683 Bacteria 1324
396 Ga0466966_0000101 3300044684 Bacteria 51920
397 Ga0466966_0033392 3300044684 Bacteria 3332
398 Ga0466966_0152405 3300044684 Bacteria 1409
399 Ga0466966_0529581 3300044684 Bacteria 709
400 Ga0466961_0000031 3300044693 Bacteria 85869
401 Ga0466961_0389363 3300044693 Bacteria 846
402 Ga0466961_0614709 3300044693 Bacteria 653
403 Ga0466963_0071739 3300044694 Bacteria 2331
404 Ga0466964_0062459 3300044706 Bacteria 1553
405 Ga0466964_0559434 3300044706 Bacteria 622
406 Ga0466964_0583370 3300044706 Bacteria 611
407 Ga0453684_0010072 3300044712 Bacteria 16242
408 Ga0453684_0178352 3300044712 Bacteria 2496
409 Ga0453684_0400155 3300044712 Unclassified 1538
410 Ga0466971_0188836 3300044719 Bacteria 970
411 Ga0466968_0007772 3300044735 Bacteria 4086
412 Ga0466968_0059574 3300044735 Bacteria 1645
413 Ga0466968_0379882 3300044735 Bacteria 690
414 Ga0466968_0589379 3300044735 Bacteria 560
415 Ga0466970_0085392 3300044765 Bacteria 1710
416 Ga0466970_0250820 3300044765 Bacteria 992
417 Ga0466970_0752107 3300044765 Bacteria 570
418 Ga0466957_0063501 3300044842 Bacteria 2270
419 Ga0466957_0363544 3300044842 Bacteria 984
420 Ga0466957_0417676 3300044842 Bacteria 920
421 Ga0466960_0097023 3300044901 Bacteria 1512
422 Ga0466960_0262608 3300044901 Bacteria 962
423 Ga0466960_0300008 3300044901 Bacteria 905
424 Ga0466960_0480463 3300044901 Bacteria 726
425 Ga0466960_0588463 3300044901 Bacteria 659
426 Ga0466959_0002151 3300045049 Bacteria 12504
427 Ga0466959_0002988 3300045049 Bacteria 10928
428 Ga0466959_0083616 3300045049 Bacteria 2298
429 Ga0466959_0698176 3300045049 Bacteria 680
430 Ga0466959_0785759 3300045049 Bacteria 637
431 Ga0451576_0014014 3300045051 Bacteria 8937
432 Ga0451576_0186023 3300045051 Unclassified 2169
433 Ga0451576_0824550 3300045051 Bacteria 974
434 Ga0451576_1546787 3300045051 Bacteria 689
435 Ga0451576_2733516 3300045051 Bacteria 502
436 Ga0466958_0241916 3300045836 Bacteria 1153
437 Ga0466958_0369547 3300045836 Bacteria 924
438 Ga0466967_0332903 3300045976 Bacteria 1466
439 Ga0466967_1234914 3300045976 Bacteria 744
440 Ga0495592_0636056 3300046454 Bacteria 648
441 Ga0495603_0153940 3300046455 Bacteria 1335
442 Ga0495629_0002586 3300046459 Bacteria 13860
443 Ga0495638_0094972 3300046460 Bacteria 1791
444 Ga0495638_0293832 3300046460 Bacteria 878
445 Ga0495638_0339974 3300046460 Bacteria 796
446 Ga0495641_0222418 3300046461 Bacteria 847
447 Ga0495653_0458474 3300046463 Bacteria 801
448 Ga0495582_0345380 3300046473 Bacteria 857
449 Ga0495605_0036646 3300046474 Bacteria 2472
450 Ga0495584_0321586 3300046491 Bacteria 785
451 Ga0495585_0132759 3300046492 Bacteria 1309
452 Ga0495585_0593259 3300046492 Bacteria 521
453 Ga0495594_0329073 3300046499 Bacteria 870
454 Ga0495607_0265039 3300046501 Bacteria 821
455 Ga0495606_0359973 3300046507 Bacteria 769
456 Ga0495608_0132808 3300046511 Bacteria 1592
457 Ga0495610_0041005 3300046512 Bacteria 2328
458 Ga0495618_0183521 3300046514 Bacteria 1329
459 Ga0495620_0101613 3300046515 Bacteria 1146
460 Ga0495620_0147040 3300046515 Bacteria 920
461 Ga0495628_0127789 3300046516 Bacteria 1946
462 Ga0495628_0516394 3300046516 Bacteria 861
463 Ga0495631_0178471 3300046518 Bacteria 910
464 Ga0495632_0267632 3300046519 Bacteria 763
465 Ga0495643_0014632 3300046522 Bacteria 4662
466 Ga0495643_0112256 3300046522 Bacteria 1385
467 Ga0495648_0191101 3300046524 Bacteria 1033
468 Ga0495666_0446195 3300046526 Bacteria 580
469 Ga0495652_0642276 3300046529 Bacteria 720
470 Ga0495654_0071188 3300046530 Bacteria 1648
471 Ga0495640_0038244 3300046533 Bacteria 3376
472 Ga0495609_0064268 3300046538 Bacteria 1619
473 Ga0495597_0068827 3300046542 Bacteria 1529
474 Ga0495622_0145679 3300046557 Bacteria 1073
475 Ga0495668_0256370 3300046616 Bacteria 957
476 Ga0495611_0052320 3300046648 Bacteria 1842
477 Ga0495625_0396047 3300046660 Bacteria 864
478 Ga0495625_0830418 3300046660 Bacteria 535
479 Ga0495661_0275948 3300046665 Bacteria 849
480 Ga0495588_0013855 3300046674 Bacteria 3849
481 Ga0495588_0258802 3300046674 Bacteria 917
482 Ga0495657_0013301 3300046675 Bacteria 6076
483 Ga0495646_0115628 3300046680 Bacteria 1523
484 Ga0495658_0213925 3300046683 Bacteria 1205
485 Ga0495613_0050253 3300046689 Bacteria 3075
486 Ga0495624_0043108 3300046690 Bacteria 2879
487 Ga0495671_0428953 3300046692 Bacteria 632
488 Ga0495649_0155091 3300046694 Bacteria 1202
489 Ga0495649_0382430 3300046694 Bacteria 708
490 Ga0495589_0063125 3300046794 Bacteria 1817
491 Ga0495600_0185527 3300046809 Bacteria 1339
492 Ga0495660_0283013 3300046810 Bacteria 758
493 Ga0495581_0106771 3300047315 Bacteria 1627
494 Ga0495604_0061880 3300047317 Bacteria 2861
495 Ga0495674_0404264 3300047319 Bacteria 1102
496 Ga0495672_0044926 3300047320 Bacteria 2647
497 Ga0495672_0090267 3300047320 Bacteria 1684
498 Ga0495672_0228800 3300047320 Bacteria 914
499 Ga0495672_0268228 3300047320 Bacteria 821
500 Ga0495676_0063382 3300047321 Bacteria 2881
501 Ga0495683_0144990 3300047323 Bacteria 1110
502 Ga0495687_083087 3300047443 Bacteria 1248
503 Ga0495687_097577 3300047443 Bacteria 1110
504 Ga0495673_0062574 3300047469 Bacteria 1589
505 Ga0495602_0109321 3300048088 Bacteria 2249
506 Ga0495626_0170316 3300048091 Bacteria 908
507 Ga0496100_0615052 3300048903 Bacteria 844
508 Ga0496101_0163326 3300048904 Bacteria 1709
509 Ga0496102_0074188 3300048905 Bacteria 3127
510 Ga0496102_0712961 3300048905 Bacteria 926
511 Ga0496102_1042382 3300048905 Bacteria 738
512 Ga0496103_0241856 3300048906 Bacteria 1161
513 Ga0496103_0261166 3300048906 Bacteria 1114
514 Ga0496104_0001655 3300048907 Bacteria 19236
515 Ga0496104_0057112 3300048907 Bacteria 3693
516 Ga0496104_0903684 3300048907 Bacteria 788
517 Ga0496105_0015424 3300048908 Bacteria 6089
518 Ga0496106_0094426 3300048909 Bacteria 2312
519 Ga0496108_0505547 3300048911 Bacteria 1055
520 Ga0496109_0754511 3300048912 Bacteria 911
521 Ga0496109_1859875 3300048912 Bacteria 535
522 Ga0496110_0157888 3300048913 Bacteria 2055
523 Ga0496110_0880568 3300048913 Bacteria 801
524 Ga0496110_1558871 3300048913 Bacteria 570
525 Ga0496111_0711005 3300048914 Bacteria 730
526 Ga0496111_1031510 3300048914 Bacteria 588
527 Ga0496112_0064774 3300048915 Bacteria 3607
528 Ga0496112_0390349 3300048915 Bacteria 1332
529 Ga0496113_0119847 3300048916 Bacteria 2056
530 Ga0496113_0179175 3300048916 Bacteria 1680
531 Ga0496113_0347813 3300048916 Bacteria 1189
532 Ga0496114_0392099 3300048917 Bacteria 1230
533 Ga0496114_0769788 3300048917 Bacteria 840
534 Ga0496115_0059021 3300048918 Bacteria 3089
535 Ga0496115_0154337 3300048918 Bacteria 1896
536 Ga0496116_0009012 3300048919 Bacteria 8574
537 Ga0496116_0053528 3300048919 Bacteria 2665
538 Ga0496117_0014560 3300048920 Bacteria 6768
539 Ga0496117_0033443 3300048920 Bacteria 3887
540 Ga0496117_0243084 3300048920 Bacteria 987
541 Ga0496117_0418051 3300048920 Bacteria 671
542 Ga0496118_0024327 3300048921 Bacteria 5230
543 Ga0496118_0025294 3300048921 Bacteria 5096
544 Ga0496118_0087742 3300048921 Bacteria 2156
545 Ga0496118_0222622 3300048921 Bacteria 1097
546 Ga0496119_0011533 3300048922 Bacteria 7303
547 Ga0496119_0016058 3300048922 Bacteria 5721
548 Ga0496119_0113437 3300048922 Bacteria 1501
549 Ga0496119_0342863 3300048922 Bacteria 726
550 Ga0496119_0360104 3300048922 Bacteria 702
551 Ga0496119_0388918 3300048922 Bacteria 667
552 Ga0496120_0003849 3300048923 Bacteria 13184
553 Ga0496120_0173894 3300048923 Bacteria 1063
554 Ga0496120_0393946 3300048923 Bacteria 613
555 Ga0496121_0000152 3300048924 Bacteria 150767
556 Ga0496121_0013561 3300048924 Bacteria 8740
557 Ga0496121_0014668 3300048924 Bacteria 8286
558 Ga0496121_0026715 3300048924 Bacteria 5426
559 Ga0496121_0043563 3300048924 Bacteria 3885
560 Ga0496121_0049950 3300048924 Bacteria 3539
561 Ga0496121_0121794 3300048924 Bacteria 1969
562 Ga0496122_0021585 3300048925 Bacteria 5757
563 Ga0496122_0047803 3300048925 Bacteria 3298
564 Ga0496122_0297606 3300048925 Bacteria 872
565 Ga0496122_0314650 3300048925 Bacteria 836
566 Ga0496123_0084176 3300048926 Bacteria 1919
567 Ga0496124_0371906 3300048927 Bacteria 1003
568 Ga0496124_0576293 3300048927 Bacteria 737
569 Ga0496124_0934270 3300048927 Bacteria 523
570 Ga0496125_0016187 3300048928 Bacteria 7170
571 Ga0496126_0002980 3300048929 Bacteria 21982
572 Ga0496126_0016467 3300048929 Bacteria 7391
573 Ga0496126_0026746 3300048929 Bacteria 5525
574 Ga0496126_0030510 3300048929 Bacteria 5106
575 Ga0496126_0076527 3300048929 Bacteria 2969
576 Ga0496126_0142002 3300048929 Bacteria 2066
577 Ga0496126_0173888 3300048929 Bacteria 1833
578 Ga0496126_0182774 3300048929 Bacteria 1780
579 Ga0496126_0194501 3300048929 Bacteria 1716
580 Ga0496126_0422071 3300048929 Bacteria 1078
581 Ga0496126_0470127 3300048929 Bacteria 1009
582 Ga0495678_089501 3300049459 Bacteria 1087
583 Ga0495682_0127700 3300049460 Bacteria 910
584 Ga0501031_0001041 3300049568 Bacteria 16832
585 Ga0501031_0065591 3300049568 Bacteria 2365
586 Ga0501032_0000040 3300049569 Bacteria 115662
587 Ga0501032_0003556 3300049569 Bacteria 11884
588 Ga0501033_0000128 3300049570 Bacteria 73419
589 Ga0501033_0000392 3300049570 Bacteria 42128
590 Ga0501033_0187684 3300049570 Bacteria 1480
591 Ga0501034_0000254 3300049571 Bacteria 97896
592 Ga0501034_0050101 3300049571 Bacteria 4212
593 Ga0501036_0000088 3300049572 Bacteria 57888
594 Ga0501036_0000375 3300049572 Bacteria 31541
595 Ga0501036_0239652 3300049572 Bacteria 1521
596 Ga0501037_0000041 3300049573 Bacteria 118457
597 Ga0501037_0008655 3300049573 Bacteria 7463
598 Ga0501038_0000057 3300049574 Bacteria 92766
599 Ga0501038_0001549 3300049574 Bacteria 21233
600 Ga0501039_0000084 3300049575 Bacteria 71542
601 Ga0501039_0015337 3300049575 Bacteria 5865
602 Ga0501042_0000506 3300049578 Bacteria 20296
603 Ga0501043_0000184 3300049579 Bacteria 56470
604 Ga0501043_0022975 3300049579 Bacteria 4890
605 Ga0501043_0186112 3300049579 Bacteria 1617
606 Ga0501043_0439183 3300049579 Bacteria 982
607 Ga0501046_0000072 3300049580 Bacteria 106407
608 Ga0501046_0000402 3300049580 Bacteria 43356
609 Ga0501047_0000044 3300049581 Bacteria 174789
610 Ga0501047_0009182 3300049581 Bacteria 9337
611 Ga0501047_0017239 3300049581 Bacteria 6914
612 Ga0501047_0038560 3300049581 Bacteria 4622
613 Ga0501047_0047785 3300049581 Bacteria 4134
614 Ga0501048_0000295 3300049582 Bacteria 33908
615 Ga0501048_0001365 3300049582 Bacteria 18477
616 Ga0501048_0068744 3300049582 Bacteria 2501
617 Ga0501067_0039211 3300049583 Bacteria 2630
618 Ga0501067_0154729 3300049583 Bacteria 1277
619 Ga0501068_0000113 3300049584 Bacteria 34900
620 Ga0501069_0021434 3300049585 Bacteria 3507
621 Ga0501069_0211197 3300049585 Bacteria 1126
622 Ga0501070_0000310 3300049586 Bacteria 44627
623 Ga0501070_0021229 3300049586 Bacteria 5450
624 Ga0501070_0885236 3300049586 Bacteria 697
625 Ga0501070_1392272 3300049586 Bacteria 533
626 Ga0501071_0278852 3300049587 Bacteria 1265
627 Ga0501072_0000156 3300049588 Bacteria 50717
628 Ga0501073_0000043 3300049589 Bacteria 80142
629 Ga0501073_0150523 3300049589 Bacteria 1613
630 Ga0501073_0185555 3300049589 Bacteria 1439
631 Ga0501074_0000035 3300049590 Bacteria 64770
632 Ga0501074_0156084 3300049590 Bacteria 1630
633 Ga0501079_0000839 3300049741 Bacteria 20917
634 Ga0501080_0000600 3300049742 Bacteria 28483
635 Ga0501080_0079232 3300049742 Bacteria 3054
636 Ga0501080_0099770 3300049742 Bacteria 2694
637 Ga0501083_0147261 3300049744 Bacteria 1542
638 Ga0501083_0223232 3300049744 Bacteria 1227
639 Ga0501035_0000128 3300049822 Bacteria 92297
640 Ga0501035_0000269 3300049822 Bacteria 61583
641 Ga0501035_0225361 3300049822 Bacteria 1599
642 Ga0501035_1208039 3300049822 Bacteria 586
643 Ga0501044_0000108 3300049823 Bacteria 100968
644 Ga0501044_0046026 3300049823 Bacteria 4518
645 Ga0501044_0323740 3300049823 Bacteria 1465
646 nmdc:mga03683_146362_c1 3300050489 Bacteria 1064
647 nmdc:mga03683_223452_c1 3300050489 Bacteria 869
648 nmdc:mga03n38_190319_c1 3300050490 Bacteria 1057
649 nmdc:mga00v17_438966_c1 3300050491 Bacteria 848
650 nmdc:mga00v17_77157_c1 3300050491 Bacteria 2074
651 nmdc:mga0yw44_3454_c1 3300050492 Bacteria 7016
652 nmdc:mga0yw44_528656_c1 3300050492 Bacteria 801
653 nmdc:mga0k408_11705_c1 3300050493 Bacteria 4783
654 nmdc:mga06z11_149191_c1 3300050494 Bacteria 1328
655 nmdc:mga06z11_244146_c1 3300050494 Bacteria 1056
656 nmdc:mga06z11_520846_c1 3300050494 Bacteria 721
657 nmdc:mga04h51_50221_c1 3300050495 Bacteria 1397
658 nmdc:mga07m45_174323_c1 3300050496 Bacteria 1250
659 nmdc:mga07m45_506363_c1 3300050496 Bacteria 699
660 nmdc:mga07m45_63911_c1 3300050496 Bacteria 1768
661 nmdc:mga08x19_425231_c1 3300050514 Bacteria 933
662 nmdc:mga0sz30_107435_c1 3300050516 Bacteria 1221
663 nmdc:mga0sz30_237724_c1 3300050516 Bacteria 811
664 nmdc:mga0sz30_48827_c1 3300050516 Bacteria 1792
665 Ga0495619_0412108 3300053085 Bacteria 933
666 Ga0500578_0186870 3300053086 Bacteria 1274
667 Ga0500643_000095 3300053087 Bacteria 92535
668 Ga0500644_0283517 3300053088 Bacteria 706
669 Ga0500651_0001437 3300053093 Bacteria 11972
670 Ga0500651_0211368 3300053093 Bacteria 1141
671 Ga0500566_0000123 3300053094 Bacteria 40138
672 Ga0500640_202490 3300053095 Bacteria 691
673 Ga0500641_0108970 3300053096 Bacteria 1191
674 Ga0500641_0372331 3300053096 Bacteria 568
675 Ga0500650_0087519 3300053098 Bacteria 1458
676 Ga0500554_138171 3300053102 Bacteria 824
677 Ga0500555_004703 3300053103 Bacteria 3878
678 Ga0500556_0048984 3300053104 Bacteria 1521
679 Ga0500557_000036 3300053105 Bacteria 71169
680 Ga0500562_034684 3300053108 Bacteria 1335
681 Ga0500569_003011 3300053109 Bacteria 3387
682 Ga0500569_267237 3300053109 Bacteria 579
683 Ga0500572_019168 3300053111 Bacteria 1783
684 Ga0500592_025841 3300053116 Bacteria 947
685 Ga0500592_030759 3300053116 Bacteria 866
686 Ga0500593_000585 3300053117 Bacteria 13998
687 Ga0500594_0223209 3300053118 Bacteria 623
688 Ga0500595_000839 3300053119 Bacteria 17559
689 Ga0500595_001859 3300053119 Bacteria 10918
690 Ga0500595_014588 3300053119 Bacteria 2978
691 Ga0500595_029117 3300053119 Bacteria 1876
692 Ga0500595_044588 3300053119 Bacteria 1404
693 Ga0500595_088852 3300053119 Bacteria 896
694 Ga0500607_055382 3300053121 Bacteria 2096
695 Ga0500608_019066 3300053122 Bacteria 3139
696 Ga0500642_0000103 3300053130 Bacteria 40846
697 Ga0500642_0037896 3300053130 Bacteria 2063
698 Ga0500642_0088219 3300053130 Bacteria 1431
699 Ga0500652_140334 3300053131 Bacteria 1006
700 Ga0500652_310827 3300053131 Bacteria 607
701 Ga0500658_0040012 3300053134 Bacteria 1876
702 Ga0500559_0002826 3300053136 Bacteria 8770
703 Ga0500559_0030423 3300053136 Bacteria 2314
704 Ga0500568_0008926 3300053139 Bacteria 4796
705 Ga0500568_0041288 3300053139 Bacteria 1854
706 Ga0500568_0059411 3300053139 Bacteria 1483
707 Ga0500568_0074207 3300053139 Bacteria 1298
708 Ga0500568_0260100 3300053139 Bacteria 631
709 Ga0500577_0317831 3300053142 Bacteria 680
710 Ga0500588_0179590 3300053146 Bacteria 778
711 Ga0500590_126829 3300053148 Bacteria 1187
712 Ga0500616_0017085 3300053153 Bacteria 4120
713 Ga0500616_0297568 3300053153 Bacteria 671
714 Ga0500619_019397 3300053154 Bacteria 1926
715 Ga0500620_036935 3300053155 Bacteria 1582
716 Ga0500622_0012724 3300053156 Bacteria 4551
717 Ga0500622_0020063 3300053156 Bacteria 3549
718 Ga0500627_0361680 3300053158 Bacteria 624
719 Ga0500638_118669 3300053162 Bacteria 1212
720 Ga0500638_139954 3300053162 Bacteria 1088
721 Ga0500636_0002571 3300053177 Bacteria 10091
722 Ga0500636_0005712 3300053177 Bacteria 7114
723 Ga0500637_0073623 3300053178 Bacteria 1967
724 Ga0500570_066843 3300053724 Bacteria 1703
725 Ga0500625_000325 3300053729 Bacteria 11897
726 Ga0500609_001599 3300053731 Bacteria 3303
727 Ga0500599_007228 3300053736 Bacteria 1426
728 Ga0500601_000445 3300053737 Bacteria 6725
729 Ga0500601_035212 3300053737 Bacteria 601
730 Ga0501084_0025559 3300054114 Bacteria 4926
731 Ga0500661_011309 3300055283 Bacteria 1614
732 Ga0501082_0158442 3300060353 Bacteria 1967
733 Ga0466962_0092498 3300061719 Bacteria 1450
734 Ga0466962_0132351 3300061719 Bacteria 1206
735 Ga0466962_0157047 3300061719 Bacteria 1105
736 2788437587 2786546940 Bacteria 6396474
737 Ga0157371_10541086
738 JGI24736J21556_1063606
739 JGI24739J22299_10100083
740 JGI24737J22298_10135173
741 JGI24735J21928_10147995
742 JGI25153J46596_10000633
743 JGI25153J46596_10000651
744 JGI25153J46596_10006525
745 JGI25153J46596_10011915
746 JGI25153J46596_10037547
747 JGI25153J46596_10089491
748 rootH1_10201646
749 JGI25160J50197_1056197
750 Ga0055526_1036046
751 Ga0055524_1007998
752 Ga0055524_1059930
753 Ga0055531_10005412
754 Ga0065165_1000054
755 Ga0065165_1001857
756 Ga0065165_1002497
757 Ga0065165_1061509
758 Ga0070683_100038089
759 Ga0070683_100057527
760 Ga0070683_100765555
761 Ga0070670_101423776
762 Ga0070680_100094782
763 Ga0070682_101804299
764 Ga0068868_100357737
765 Ga0070660_100294597
766 Ga0070660_101761265
767 Ga0070691_10030518
768 Ga0070671_100289106
769 Ga0070667_100930754
770 Ga0070709_10001267
771 Ga0070709_11017313
772 Ga0070714_100135360
773 Ga0070714_100213431
774 Ga0070713_100006642
775 Ga0070710_10001610
776 Ga0070711_100002880
777 Ga0070663_100063537
778 Ga0070663_100666177
779 Ga0070681_10229924
780 Ga0070681_11349987
781 Ga0070679_100195528
782 Ga0070679_100214870
783 Ga0070679_101845899
784 Ga0070684_100032985
785 Ga0070684_100610185
786 Ga0068853_100295866
787 Ga0068853_100469902
788 Ga0068853_100516200
789 Ga0068853_100794613
790 Ga0068853_101628346
791 Ga0068855_100080309
792 Ga0068855_101935132
793 Ga0070664_100705062
794 Ga0068857_100265926
795 Ga0068857_100444308
796 Ga0068857_100732826
797 Ga0068854_100328560
798 Ga0068856_100375959
799 Ga0068856_101597303
800 Ga0068852_100001747
801 Ga0068859_100108929
802 Ga0068864_100000060
803 Ga0068864_100208399
804 Ga0068864_100398976
805 Ga0068851_10183858
806 Ga0068870_10512580
807 Ga0068863_100000023
808 Ga0068863_100182757
809 Ga0068863_100216415
810 Ga0068858_100011301
811 Ga0068860_100608105
812 Ga0068860_100626215
813 Ga0068860_101235463
814 Ga0068862_100966501
815 Ga0081455_10106377
816 Ga0081540_1048867
817 Ga0070717_10128448
818 Ga0070717_10238080
819 Ga0075365_10012541
820 Ga0075365_10039785
821 Ga0075365_10100286
822 Ga0075368_10283293
823 Ga0075363_100019810
824 Ga0075363_100373654
825 Ga0075363_101003995
826 Ga0075364_10523514
827 Ga0070715_10569651
828 Ga0070716_100001907
829 Ga0070712_100022694
830 Ga0075362_10060294
831 Ga0075362_10183579
832 Ga0075362_10598125
833 Ga0075367_10096852
834 Ga0075367_10099824
835 Ga0075367_10127753
836 Ga0075367_10972276
837 Ga0075369_10100669
838 Ga0075369_10120731
839 Ga0075366_10008786
840 Ga0097621_101899187
841 Ga0075370_10047941
842 Ga0075370_10133086
843 Ga0068871_100635702
844 Ga0075433_11578652
845 Ga0075434_100248208
846 Ga0075436_100889635
847 Ga0097620_100108929
848 Ga0099824_1024667
849 Ga0099823_1070945
850 Ga0105251_10063426
851 Ga0105251_10210083
852 Ga0105244_10397525
853 Ga0105250_10012457
854 Ga0105240_10008853
855 Ga0105240_10020641
856 Ga0105240_10164739
857 Ga0105240_10465050
858 Ga0105240_11113435
859 Ga0105245_10336467
860 Ga0105245_10877220
861 Ga0105247_10122059
862 Ga0105247_10396142
863 Ga0105247_10803452
864 Ga0105247_10937133
865 Ga0105243_10139868
866 Ga0105243_10917821
867 Ga0105241_11457722
868 Ga0105242_10949479
869 Ga0105248_10001464
870 Ga0105248_10800750
871 Ga0105248_10860246
872 Ga0105248_12313384
873 Ga0105237_10014235
874 Ga0105237_10042891
875 Ga0105237_10139035
876 Ga0105237_10265701
877 Ga0105237_10644094
878 Ga0105237_11725061
879 Ga0105238_10063440
880 Ga0105238_10374439
881 Ga0105238_10712014
882 Ga0105238_10791518
883 Ga0105238_11255130
884 Ga0105249_10339575
885 Ga0105239_10039622
886 Ga0105239_10079622
887 Ga0105239_10079805
888 Ga0105239_13536518
889 Ga0105246_10015578
890 Ga0157373_10307542
891 Ga0157371_11115882
892 Ga0157370_10050197
893 Ga0157370_11160226
894 Ga0157369_10007758
895 Ga0157369_10009352
896 Ga0157369_10484841
897 Ga0157369_10729188
898 Ga0157374_10457643
899 Ga0157374_10885120
900 Ga0157378_10433232
901 Ga0163162_10165287
902 Ga0157372_10213404
903 Ga0157372_10476886
904 Ga0157375_10136536
905 Ga0163163_10071930
906 Ga0163163_10536565
907 Ga0163163_10975280
908 Ga0182008_10855741
909 Ga0157379_10058879
910 Ga0157379_10603277
911 Ga0157379_11221694
912 Ga0157379_12117066
913 Ga0157376_10096295
914 Ga0213873_10010521
915 Ga0213872_10004165
916 Ga0213872_10031833
917 Ga0213872_10370683
918 Ga0213876_10065160
919 Ga0213876_10103445
920 Ga0213875_10119834
921 Ga0213875_10122984
922 Ga0213871_10007632
923 Ga0207425_1010576
924 Ga0209148_1000421
925 Ga0209148_1016562
926 Ga0209148_1043097
927 Ga0209233_1002484
928 Ga0209233_1002615
929 Ga0209233_1017000
930 Ga0209455_1007536
931 Ga0209130_1081120
932 Ga0209564_1000044
933 Ga0209564_1004705
934 Ga0209564_1014807
935 Ga0209758_1000117
936 Ga0209758_1000506
937 Ga0209758_1001068
938 Ga0209758_1001793
939 Ga0209758_1003491
940 Ga0209758_1007058
941 Ga0209050_1070340
942 Ga0209256_1000740
943 Ga0209256_1007255
944 Ga0209256_1008199
945 Ga0207426_1000467
946 Ga0207426_1000508
947 Ga0207426_1006582
948 Ga0207426_1023419
949 Ga0207426_1075361
950 Ga0207426_1103153
951 Ga0209051_1030114
952 Ga0209257_1000158
953 Ga0209257_1023507
954 Ga0207692_10001796
955 Ga0207710_10023967
956 Ga0207710_10318232
957 Ga0207688_10138968
958 Ga0207680_10052867
959 Ga0207647_10006024
960 Ga0207647_10146688
961 Ga0207685_10315612
962 Ga0207699_10000749
963 Ga0207707_10660765
964 Ga0207695_10000136
965 Ga0207695_10019551
966 Ga0207695_10113023
967 Ga0207695_10201059
968 Ga0207695_11137786
969 Ga0207671_10000202
970 Ga0207671_10136125
971 Ga0207671_10171842
972 Ga0207671_10285439
973 Ga0207671_10556070
974 Ga0207693_10176854
975 Ga0207693_10227360
976 Ga0207663_10001805
977 Ga0207660_10435695
978 Ga0207657_10304669
979 Ga0207657_10332726
980 Ga0207657_10392953
981 Ga0207649_10874190
982 Ga0207652_10150356
983 Ga0207652_10313972
984 Ga0207681_10762870
985 Ga0207694_10079372
986 Ga0207694_10092566
987 Ga0207694_10934411
988 Ga0207694_11431450
989 Ga0207650_10212832
990 Ga0207650_11610041
991 Ga0207687_10652712
992 Ga0207700_10004852
993 Ga0207700_10169014
994 Ga0207700_11201268
995 Ga0207664_10053425
996 Ga0207664_10151837
997 Ga0207690_10106076
998 Ga0207706_10100034
999 Ga0207686_10905971
1000 Ga0207709_10130291
1001 Ga0207709_10611520
1002 Ga0207665_10002001
1003 Ga0207711_10001333
1004 Ga0207711_10567296
1005 Ga0207689_10634348
1006 Ga0207661_10013432
1007 Ga0207661_10062354
1008 Ga0207661_11599670
1009 Ga0207667_10441570
1010 Ga0207667_10707351
1011 Ga0207651_10220893
1012 Ga0207712_10907609
1013 Ga0207668_11197751
1014 Ga0207640_10514171
1015 Ga0207703_10000571
1016 Ga0207639_10186688
1017 Ga0207639_10277379
1018 Ga0207639_10729666
1019 Ga0207639_11020290
1020 Ga0207678_10055007
1021 Ga0207678_10066190
1022 Ga0207678_10202709
1023 Ga0207678_10883620
1024 Ga0207678_11713587
1025 Ga0207708_11822248
1026 Ga0207702_10283974
1027 Ga0207641_10000067
1028 Ga0207641_10180966
1029 Ga0207641_10221377
1030 Ga0207648_10105282
1031 Ga0207676_10001977
1032 Ga0207676_10743709
1033 Ga0207676_11361098
1034 Ga0207676_11816878
1035 Ga0207676_12502286
1036 Ga0207674_10295232
1037 Ga0207674_10851309
1038 Ga0207675_100260059
1039 Ga0207683_10091813
1040 Ga0209281_1027067
1041 Ga0209389_1000056
1042 Ga0209389_1000206
1043 Ga0209589_1000034
1044 Ga0209489_100009
1045 Ga0209489_103071
1046 Ga0209700_100471
1047 Ga0209813_10107735
1048 Ga0209813_10144029
1049 Ga0268266_10133830
1050 Ga0268266_10933498
1051 Ga0268265_10149380
1052 Ga0268264_10473708
1053 Ga0268264_10664299
1054 Ga0307515_10303528
1055 Ga0265338_10009258
1056 Ga0265324_10202588
1057 Ga0265330_10034992
1058 Ga0265330_10039393
1059 Ga0265330_10062578
1060 Ga0265328_10015517
1061 Ga0265325_10025516
1062 Ga0265325_10043185
1063 Ga0265325_10266042
1064 Ga0265340_10009354
1065 Ga0265340_10327074
1066 Ga0265339_10014821
1067 Ga0265316_10256633
1068 Ga0265313_10176613
1069 Ga0265313_10291340
1070 Ga0265314_10035527
1071 Ga0265314_10054932
1072 Ga0265314_10126958
1073 Ga0265314_10442368
1074 Ga0265342_10100271
1075 Ga0265342_10102084
1076 Ga0265342_10169122
1077 Ga0307406_10109482
1078 Ga0307406_10339551
1079 Ga0307409_100840991
1080 Ga0307510_10063444
1081 Ga0373928_0003582
1082 Ga0373932_0016697
1083 Ga0373943_0848637
1084 Ga0373931_0375875
1085 Ga0373925_0065376
1086 Ga0395899_0112185
1087 Ga0395899_0206251
1088 Ga0395900_0003815
1089 Ga0395900_0033307
1090 Ga0395900_0057751
1091 Ga0395900_0723873
1092 Ga0395900_0904579
1093 Ga0395898_0007171
1094 Ga0395898_0022885
1095 Ga0395898_0097903
1096 Ga0395905_0637162
1097 Ga0395905_0894013
1098 Ga0436364_0487949
1099 Ga0436364_0646122
1100 Ga0436364_0899392
1101 Ga0436364_1201854
1102 Ga0395901_0017745
1103 Ga0395901_0072187
1104 Ga0436365_0167269
1105 Ga0436365_0642071
1106 Ga0436365_0817878
1107 Ga0436365_1667821
1108 Ga0436360_0463479
1109 Ga0436360_0628778
1110 Ga0436361_0077944
1111 Ga0436361_0238145
1112 Ga0436361_0274756
1113 Ga0436361_0488424
1114 Ga0436361_0489737
1115 Ga0436361_1115272
1116 Ga0436363_0656246
1117 Ga0436363_1420126
1118 Ga0436362_0085232
1119 Ga0436362_0120734
1120 Ga0451843_0121359
1121 Ga0451853_2243521
1122 Ga0439448_0145914
1123 Ga0439455_0091643
1124 Ga0466972_0013574
1125 Ga0466972_0060680
1126 Ga0466972_0148323
1127 Ga0453683_0016715
1128 Ga0453683_0071616
1129 Ga0453683_0650408
1130 Ga0466965_0014378
1131 Ga0466965_0126215
1132 Ga0466966_0000101
1133 Ga0466966_0033392
1134 Ga0466966_0152405
1135 Ga0466966_0529581
1136 Ga0466961_0000031
1137 Ga0466961_0389363
1138 Ga0466961_0614709
1139 Ga0466963_0071739
1140 Ga0466964_0062459
1141 Ga0466964_0559434
1142 Ga0466964_0583370
1143 Ga0453684_0010072
1144 Ga0453684_0178352
1145 Ga0453684_0400155
1146 Ga0466971_0188836
1147 Ga0466968_0007772
1148 Ga0466968_0059574
1149 Ga0466968_0379882
1150 Ga0466968_0589379
1151 Ga0466970_0085392
1152 Ga0466970_0250820
1153 Ga0466970_0752107
1154 Ga0466957_0063501
1155 Ga0466957_0363544
1156 Ga0466957_0417676
1157 Ga0466960_0097023
1158 Ga0466960_0262608
1159 Ga0466960_0300008
1160 Ga0466960_0480463
1161 Ga0466960_0588463
1162 Ga0466959_0002151
1163 Ga0466959_0002988
1164 Ga0466959_0083616
1165 Ga0466959_0698176
1166 Ga0466959_0785759
1167 Ga0451576_0014014
1168 Ga0451576_0186023
1169 Ga0451576_0824550
1170 Ga0451576_1546787
1171 Ga0451576_2733516
1172 Ga0466958_0241916
1173 Ga0466958_0369547
1174 Ga0466967_0332903
1175 Ga0466967_1234914
1176 Ga0495592_0636056
1177 Ga0495603_0153940
1178 Ga0495629_0002586
1179 Ga0495638_0094972
1180 Ga0495638_0293832
1181 Ga0495638_0339974
1182 Ga0495641_0222418
1183 Ga0495653_0458474
1184 Ga0495582_0345380
1185 Ga0495605_0036646
1186 Ga0495584_0321586
1187 Ga0495585_0132759
1188 Ga0495585_0593259
1189 Ga0495594_0329073
1190 Ga0495607_0265039
1191 Ga0495606_0359973
1192 Ga0495608_0132808
1193 Ga0495610_0041005
1194 Ga0495618_0183521
1195 Ga0495620_0101613
1196 Ga0495620_0147040
1197 Ga0495628_0127789
1198 Ga0495628_0516394
1199 Ga0495631_0178471
1200 Ga0495632_0267632
1201 Ga0495643_0014632
1202 Ga0495643_0112256
1203 Ga0495648_0191101
1204 Ga0495666_0446195
1205 Ga0495652_0642276
1206 Ga0495654_0071188
1207 Ga0495640_0038244
1208 Ga0495609_0064268
1209 Ga0495597_0068827
1210 Ga0495622_0145679
1211 Ga0495668_0256370
1212 Ga0495611_0052320
1213 Ga0495625_0396047
1214 Ga0495625_0830418
1215 Ga0495661_0275948
1216 Ga0495588_0013855
1217 Ga0495588_0258802
1218 Ga0495657_0013301
1219 Ga0495646_0115628
1220 Ga0495658_0213925
1221 Ga0495613_0050253
1222 Ga0495624_0043108
1223 Ga0495671_0428953
1224 Ga0495649_0155091
1225 Ga0495649_0382430
1226 Ga0495589_0063125
1227 Ga0495600_0185527
1228 Ga0495660_0283013
1229 Ga0495581_0106771
1230 Ga0495604_0061880
1231 Ga0495674_0404264
1232 Ga0495672_0044926
1233 Ga0495672_0090267
1234 Ga0495672_0228800
1235 Ga0495672_0268228
1236 Ga0495676_0063382
1237 Ga0495683_0144990
1238 Ga0495687_083087
1239 Ga0495687_097577
1240 Ga0495673_0062574
1241 Ga0495602_0109321
1242 Ga0495626_0170316
1243 Ga0496100_0615052
1244 Ga0496101_0163326
1245 Ga0496102_0074188
1246 Ga0496102_0712961
1247 Ga0496102_1042382
1248 Ga0496103_0241856
1249 Ga0496103_0261166
1250 Ga0496104_0001655
1251 Ga0496104_0057112
1252 Ga0496104_0903684
1253 Ga0496105_0015424
1254 Ga0496106_0094426
1255 Ga0496108_0505547
1256 Ga0496109_0754511
1257 Ga0496109_1859875
1258 Ga0496110_0157888
1259 Ga0496110_0880568
1260 Ga0496110_1558871
1261 Ga0496111_0711005
1262 Ga0496111_1031510
1263 Ga0496112_0064774
1264 Ga0496112_0390349
1265 Ga0496113_0119847
1266 Ga0496113_0179175
1267 Ga0496113_0347813
1268 Ga0496114_0392099
1269 Ga0496114_0769788
1270 Ga0496115_0059021
1271 Ga0496115_0154337
1272 Ga0496116_0009012
1273 Ga0496116_0053528
1274 Ga0496117_0014560
1275 Ga0496117_0033443
1276 Ga0496117_0243084
1277 Ga0496117_0418051
1278 Ga0496118_0024327
1279 Ga0496118_0025294
1280 Ga0496118_0087742
1281 Ga0496118_0222622
1282 Ga0496119_0011533
1283 Ga0496119_0016058
1284 Ga0496119_0113437
1285 Ga0496119_0342863
1286 Ga0496119_0360104
1287 Ga0496119_0388918
1288 Ga0496120_0003849
1289 Ga0496120_0173894
1290 Ga0496120_0393946
1291 Ga0496121_0000152
1292 Ga0496121_0013561
1293 Ga0496121_0014668
1294 Ga0496121_0026715
1295 Ga0496121_0043563
1296 Ga0496121_0049950
1297 Ga0496121_0121794
1298 Ga0496122_0021585
1299 Ga0496122_0047803
1300 Ga0496122_0297606
1301 Ga0496122_0314650
1302 Ga0496123_0084176
1303 Ga0496124_0371906
1304 Ga0496124_0576293
1305 Ga0496124_0934270
1306 Ga0496125_0016187
1307 Ga0496126_0002980
1308 Ga0496126_0016467
1309 Ga0496126_0026746
1310 Ga0496126_0030510
1311 Ga0496126_0076527
1312 Ga0496126_0142002
1313 Ga0496126_0173888
1314 Ga0496126_0182774
1315 Ga0496126_0194501
1316 Ga0496126_0422071
1317 Ga0496126_0470127
1318 Ga0495678_089501
1319 Ga0495682_0127700
1320 Ga0501031_0001041
1321 Ga0501031_0065591
1322 Ga0501032_0000040
1323 Ga0501032_0003556
1324 Ga0501033_0000128
1325 Ga0501033_0000392
1326 Ga0501033_0187684
1327 Ga0501034_0000254
1328 Ga0501034_0050101
1329 Ga0501036_0000088
1330 Ga0501036_0000375
1331 Ga0501036_0239652
1332 Ga0501037_0000041
1333 Ga0501037_0008655
1334 Ga0501038_0000057
1335 Ga0501038_0001549
1336 Ga0501039_0000084
1337 Ga0501039_0015337
1338 Ga0501042_0000506
1339 Ga0501043_0000184
1340 Ga0501043_0022975
1341 Ga0501043_0186112
1342 Ga0501043_0439183
1343 Ga0501046_0000072
1344 Ga0501046_0000402
1345 Ga0501047_0000044
1346 Ga0501047_0009182
1347 Ga0501047_0017239
1348 Ga0501047_0038560
1349 Ga0501047_0047785
1350 Ga0501048_0000295
1351 Ga0501048_0001365
1352 Ga0501048_0068744
1353 Ga0501067_0039211
1354 Ga0501067_0154729
1355 Ga0501068_0000113
1356 Ga0501069_0021434
1357 Ga0501069_0211197
1358 Ga0501070_0000310
1359 Ga0501070_0021229
1360 Ga0501070_0885236
1361 Ga0501070_1392272
1362 Ga0501071_0278852
1363 Ga0501072_0000156
1364 Ga0501073_0000043
1365 Ga0501073_0150523
1366 Ga0501073_0185555
1367 Ga0501074_0000035
1368 Ga0501074_0156084
1369 Ga0501079_0000839
1370 Ga0501080_0000600
1371 Ga0501080_0079232
1372 Ga0501080_0099770
1373 Ga0501083_0147261
1374 Ga0501083_0223232
1375 Ga0501035_0000128
1376 Ga0501035_0000269
1377 Ga0501035_0225361
1378 Ga0501035_1208039
1379 Ga0501044_0000108
1380 Ga0501044_0046026
1381 Ga0501044_0323740
1382 nmdc:mga03683_146362_c1
1383 nmdc:mga03683_223452_c1
1384 nmdc:mga03n38_190319_c1
1385 nmdc:mga00v17_438966_c1
1386 nmdc:mga00v17_77157_c1
1387 nmdc:mga0yw44_3454_c1
1388 nmdc:mga0yw44_528656_c1
1389 nmdc:mga0k408_11705_c1
1390 nmdc:mga06z11_149191_c1
1391 nmdc:mga06z11_244146_c1
1392 nmdc:mga06z11_520846_c1
1393 nmdc:mga04h51_50221_c1
1394 nmdc:mga07m45_174323_c1
1395 nmdc:mga07m45_506363_c1
1396 nmdc:mga07m45_63911_c1
1397 nmdc:mga08x19_425231_c1
1398 nmdc:mga0sz30_107435_c1
1399 nmdc:mga0sz30_237724_c1
1400 nmdc:mga0sz30_48827_c1
1401 Ga0495619_0412108
1402 Ga0500578_0186870
1403 Ga0500643_000095
1404 Ga0500644_0283517
1405 Ga0500651_0001437
1406 Ga0500651_0211368
1407 Ga0500566_0000123
1408 Ga0500640_202490
1409 Ga0500641_0108970
1410 Ga0500641_0372331
1411 Ga0500650_0087519
1412 Ga0500554_138171
1413 Ga0500555_004703
1414 Ga0500556_0048984
1415 Ga0500557_000036
1416 Ga0500562_034684
1417 Ga0500569_003011
1418 Ga0500569_267237
1419 Ga0500572_019168
1420 Ga0500592_025841
1421 Ga0500592_030759
1422 Ga0500593_000585
1423 Ga0500594_0223209
1424 Ga0500595_000839
1425 Ga0500595_001859
1426 Ga0500595_014588
1427 Ga0500595_029117
1428 Ga0500595_044588
1429 Ga0500595_088852
1430 Ga0500607_055382
1431 Ga0500608_019066
1432 Ga0500642_0000103
1433 Ga0500642_0037896
1434 Ga0500642_0088219
1435 Ga0500652_140334
1436 Ga0500652_310827
1437 Ga0500658_0040012
1438 Ga0500559_0002826
1439 Ga0500559_0030423
1440 Ga0500568_0008926
1441 Ga0500568_0041288
1442 Ga0500568_0059411
1443 Ga0500568_0074207
1444 Ga0500568_0260100
1445 Ga0500577_0317831
1446 Ga0500588_0179590
1447 Ga0500590_126829
1448 Ga0500616_0017085
1449 Ga0500616_0297568
1450 Ga0500619_019397
1451 Ga0500620_036935
1452 Ga0500622_0012724
1453 Ga0500622_0020063
1454 Ga0500627_0361680
1455 Ga0500638_118669
1456 Ga0500638_139954
1457 Ga0500636_0002571
1458 Ga0500636_0005712
1459 Ga0500637_0073623
1460 Ga0500570_066843
1461 Ga0500625_000325
1462 Ga0500609_001599
1463 Ga0500599_007228
1464 Ga0500601_000445
1465 Ga0500601_035212
1466 Ga0501084_0025559
1467 Ga0500661_011309
1468 Ga0501082_0158442
1469 Ga0466962_0092498
1470 Ga0466962_0132351
1471 Ga0466962_0157047
1472 2788437587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.973 1 118
4hnr-assembly1.cif.gz_A high resolution structure of chemotaxis response regulator chey4 of vibrio cholerae 0.9701 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9699 1 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9674 3 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9672 3 120
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9714 3 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 1 82 3.40.50.2300
4hnrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 1 118 3.40.50.2300
af_Q5A4X5_425_557_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.969 4 118 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9655 1 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V8ITQ6-F1-model_v4 deleted 0.9912 2 119
AF-A7BZ01-F1-model_v4 deleted 0.9893 1 120
AF-B7RJ06-F1-model_v4 Chemotaxis response regulator, CheY4 0.9883 1 121 GO:0000160
AF-A0A545TIN6-F1-model_v4 Response regulator 0.9878 1 120 GO:0000160
AF-A0A2E0FLD5-F1-model_v4 Response regulatory domain-containing protein 0.9873 2 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map