F478245
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 736 | 331 | 1472 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005290|Ga0065712_10129503|Ga0065712_101295032 |
| Length | 129 |
| Sequence | MSYHPLTGTFLGKRSSKVHMSRDDLQLLQGTLDVLVLKTVARGPCHGYEIARWIRETTDAELQVEDRALYVALHRMEERQWLEAEWGLTENNRNAKYYQLTREGRKQLAAKTATWSRYTAAVSKVLQTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 108 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 192 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 208 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 226 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 230 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 231 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 232 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 233 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 234 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 235 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 281 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 282 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 283 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 284 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 285 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 296 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 297 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 298 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 299 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 302 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 310 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 325 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 328 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 329 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 330 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.68 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.36 |
| Nodule | 0 |
| Rhizoplane | 1.9 |
| Rhizosphere | 95.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 29.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10129503 | 3300005290 | Bacteria | 1567 |
| 2 | rootH2_10029268 | 3300003320 | Bacteria | 10658 |
| 3 | rootH1_10167616 | 3300003323 | Bacteria | 1340 |
| 4 | Ga0058861_11874416 | 3300004800 | Bacteria | 1905 |
| 5 | Ga0058862_12864595 | 3300004803 | Unclassified | 501 |
| 6 | Ga0065714_10120485 | 3300005288 | Bacteria | 1354 |
| 7 | Ga0065712_10000917 | 3300005290 | Bacteria | 17213 |
| 8 | Ga0065712_10219885 | 3300005290 | Bacteria | 1044 |
| 9 | Ga0065715_10101055 | 3300005293 | Unclassified | 3241 |
| 10 | Ga0065715_10206861 | 3300005293 | Bacteria | 1333 |
| 11 | Ga0065715_10509543 | 3300005293 | Bacteria | 772 |
| 12 | Ga0065707_10208508 | 3300005295 | Bacteria | 1275 |
| 13 | Ga0065707_10900229 | 3300005295 | Unclassified | 548 |
| 14 | Ga0065707_11085347 | 3300005295 | Bacteria | 519 |
| 15 | Ga0070658_10000010 | 3300005327 | Bacteria | 297212 |
| 16 | Ga0070658_10225570 | 3300005327 | Bacteria | 1585 |
| 17 | Ga0070658_10243245 | 3300005327 | Bacteria | 1525 |
| 18 | Ga0070683_100002402 | 3300005329 | Bacteria | 14874 |
| 19 | Ga0070683_100024209 | 3300005329 | Bacteria | 5435 |
| 20 | Ga0070683_100306042 | 3300005329 | Unclassified | 1512 |
| 21 | Ga0070670_100046451 | 3300005331 | Bacteria | 3734 |
| 22 | Ga0070670_100199424 | 3300005331 | Unclassified | 1738 |
| 23 | Ga0070670_100339214 | 3300005331 | Bacteria | 1319 |
| 24 | Ga0068869_100038282 | 3300005334 | Bacteria | 3417 |
| 25 | Ga0068869_100060505 | 3300005334 | Bacteria | 2776 |
| 26 | Ga0070666_10005963 | 3300005335 | Bacteria | 7482 |
| 27 | Ga0070666_11460234 | 3300005335 | Unclassified | 511 |
| 28 | Ga0070680_100047909 | 3300005336 | Bacteria | 3481 |
| 29 | Ga0070682_100014074 | 3300005337 | Bacteria | 4618 |
| 30 | Ga0070682_101894921 | 3300005337 | Unclassified | 522 |
| 31 | Ga0068868_100019841 | 3300005338 | Bacteria | 5043 |
| 32 | Ga0068868_101909022 | 3300005338 | Unclassified | 562 |
| 33 | Ga0070689_100153502 | 3300005340 | Bacteria | 1858 |
| 34 | Ga0070689_101822825 | 3300005340 | Bacteria | 555 |
| 35 | Ga0070689_102016695 | 3300005340 | Unclassified | 528 |
| 36 | Ga0070661_100013639 | 3300005344 | Bacteria | 5706 |
| 37 | Ga0070661_100332406 | 3300005344 | Bacteria | 1189 |
| 38 | Ga0070661_100569472 | 3300005344 | Bacteria | 913 |
| 39 | Ga0070661_101729451 | 3300005344 | Bacteria | 530 |
| 40 | Ga0070692_10242261 | 3300005345 | Unclassified | 1075 |
| 41 | Ga0070668_100054270 | 3300005347 | Unclassified | 3091 |
| 42 | Ga0070669_100261020 | 3300005353 | Unclassified | 1382 |
| 43 | Ga0070669_100324083 | 3300005353 | Bacteria | 1245 |
| 44 | Ga0070675_100052114 | 3300005354 | Bacteria | 3363 |
| 45 | Ga0070675_100448152 | 3300005354 | Bacteria | 1157 |
| 46 | Ga0070675_102069906 | 3300005354 | Bacteria | 525 |
| 47 | Ga0070671_100011138 | 3300005355 | Bacteria | 7223 |
| 48 | Ga0070671_100092761 | 3300005355 | Unclassified | 2530 |
| 49 | Ga0070674_100257215 | 3300005356 | Bacteria | 1374 |
| 50 | Ga0070674_100453301 | 3300005356 | Bacteria | 1059 |
| 51 | Ga0070674_100592858 | 3300005356 | Bacteria | 935 |
| 52 | Ga0070674_100885773 | 3300005356 | Unclassified | 776 |
| 53 | Ga0070673_100052665 | 3300005364 | Bacteria | 3194 |
| 54 | Ga0070673_100200986 | 3300005364 | Unclassified | 1716 |
| 55 | Ga0070688_100008063 | 3300005365 | Bacteria | 5702 |
| 56 | Ga0070688_100038931 | 3300005365 | Bacteria | 2907 |
| 57 | Ga0070667_100014626 | 3300005367 | Bacteria | 6485 |
| 58 | Ga0070667_100024020 | 3300005367 | Bacteria | 5063 |
| 59 | Ga0070703_10247904 | 3300005406 | Unclassified | 721 |
| 60 | Ga0070709_10000905 | 3300005434 | Bacteria | 16488 |
| 61 | Ga0070709_11511448 | 3300005434 | Unclassified | 545 |
| 62 | Ga0070714_100166445 | 3300005435 | Bacteria | 1998 |
| 63 | Ga0070713_100000393 | 3300005436 | Bacteria | 28108 |
| 64 | Ga0070713_100125223 | 3300005436 | Bacteria | 2259 |
| 65 | Ga0070713_100460907 | 3300005436 | Unclassified | 1195 |
| 66 | Ga0070713_100929589 | 3300005436 | Bacteria | 837 |
| 67 | Ga0070713_101041052 | 3300005436 | Unclassified | 790 |
| 68 | Ga0070713_102390947 | 3300005436 | Bacteria | 511 |
| 69 | Ga0070710_10008343 | 3300005437 | Bacteria | 5042 |
| 70 | Ga0070710_10658855 | 3300005437 | Unclassified | 735 |
| 71 | Ga0070701_10018452 | 3300005438 | Unclassified | 3279 |
| 72 | Ga0070711_100014329 | 3300005439 | Bacteria | 4995 |
| 73 | Ga0070711_100044717 | 3300005439 | Bacteria | 3007 |
| 74 | Ga0070711_101410617 | 3300005439 | Unclassified | 606 |
| 75 | Ga0070700_100032387 | 3300005441 | Bacteria | 3140 |
| 76 | Ga0070700_100208972 | 3300005441 | Unclassified | 1376 |
| 77 | Ga0070694_101312324 | 3300005444 | Bacteria | 609 |
| 78 | Ga0070708_100017119 | 3300005445 | Bacteria | 6036 |
| 79 | Ga0070708_100066598 | 3300005445 | Bacteria | 3233 |
| 80 | Ga0070663_100708123 | 3300005455 | Unclassified | 856 |
| 81 | Ga0070678_100008116 | 3300005456 | Bacteria | 6271 |
| 82 | Ga0070678_100048703 | 3300005456 | Unclassified | 3054 |
| 83 | Ga0070662_100019205 | 3300005457 | Bacteria | 4638 |
| 84 | Ga0070662_100443174 | 3300005457 | Bacteria | 1077 |
| 85 | Ga0070681_10059848 | 3300005458 | Bacteria | 3788 |
| 86 | Ga0070681_11889668 | 3300005458 | Unclassified | 524 |
| 87 | Ga0070685_10008348 | 3300005466 | Bacteria | 5317 |
| 88 | Ga0070707_100020548 | 3300005468 | Bacteria | 6231 |
| 89 | Ga0070707_100569072 | 3300005468 | Bacteria | 1095 |
| 90 | Ga0070707_100914871 | 3300005468 | Unclassified | 842 |
| 91 | Ga0070707_101131976 | 3300005468 | Bacteria | 749 |
| 92 | Ga0070698_100057923 | 3300005471 | Bacteria | 3919 |
| 93 | Ga0070699_100065883 | 3300005518 | Bacteria | 3144 |
| 94 | Ga0070699_100115629 | 3300005518 | Unclassified | 2357 |
| 95 | Ga0070699_100330174 | 3300005518 | Bacteria | 1372 |
| 96 | Ga0070699_101337753 | 3300005518 | Bacteria | 657 |
| 97 | Ga0070679_100016491 | 3300005530 | Bacteria | 7129 |
| 98 | Ga0070679_100083741 | 3300005530 | Bacteria | 3177 |
| 99 | Ga0070684_100001521 | 3300005535 | Bacteria | 16768 |
| 100 | Ga0070684_100043522 | 3300005535 | Bacteria | 3878 |
| 101 | Ga0070684_100066005 | 3300005535 | Bacteria | 3177 |
| 102 | Ga0070684_100099009 | 3300005535 | Unclassified | 2601 |
| 103 | Ga0070684_100119607 | 3300005535 | Bacteria | 2369 |
| 104 | Ga0070697_100014979 | 3300005536 | Bacteria | 6086 |
| 105 | Ga0070697_100124525 | 3300005536 | Unclassified | 2158 |
| 106 | Ga0068853_100221421 | 3300005539 | Unclassified | 1728 |
| 107 | Ga0068853_100965420 | 3300005539 | Unclassified | 820 |
| 108 | Ga0068853_101062674 | 3300005539 | Unclassified | 780 |
| 109 | Ga0068853_101121857 | 3300005539 | Unclassified | 759 |
| 110 | Ga0068853_102251285 | 3300005539 | Bacteria | 528 |
| 111 | Ga0070672_100038550 | 3300005543 | Unclassified | 3652 |
| 112 | Ga0070672_100039384 | 3300005543 | Bacteria | 3620 |
| 113 | Ga0070686_100124770 | 3300005544 | Unclassified | 1772 |
| 114 | Ga0070686_100774837 | 3300005544 | Unclassified | 771 |
| 115 | Ga0070696_100364486 | 3300005546 | Unclassified | 1122 |
| 116 | Ga0070696_101342342 | 3300005546 | Unclassified | 608 |
| 117 | Ga0070693_101365616 | 3300005547 | Unclassified | 550 |
| 118 | Ga0070665_100029622 | 3300005548 | Bacteria | 5509 |
| 119 | Ga0070665_100081071 | 3300005548 | Bacteria | 3251 |
| 120 | Ga0070665_100211136 | 3300005548 | Bacteria | 1942 |
| 121 | Ga0070665_101049250 | 3300005548 | Bacteria | 827 |
| 122 | Ga0070665_101323199 | 3300005548 | Bacteria | 730 |
| 123 | Ga0068855_100012300 | 3300005563 | Bacteria | 10341 |
| 124 | Ga0068855_100022659 | 3300005563 | Bacteria | 7524 |
| 125 | Ga0068855_100032209 | 3300005563 | Bacteria | 6259 |
| 126 | Ga0068855_100075160 | 3300005563 | Bacteria | 3924 |
| 127 | Ga0068855_100076390 | 3300005563 | Bacteria | 3888 |
| 128 | Ga0068855_100423968 | 3300005563 | Bacteria | 1455 |
| 129 | Ga0068855_101771168 | 3300005563 | Unclassified | 628 |
| 130 | Ga0070664_100038901 | 3300005564 | Bacteria | 4006 |
| 131 | Ga0070664_100059399 | 3300005564 | Bacteria | 3253 |
| 132 | Ga0070664_100276549 | 3300005564 | Unclassified | 1513 |
| 133 | Ga0070664_100446583 | 3300005564 | Unclassified | 1187 |
| 134 | Ga0068857_100041174 | 3300005577 | Bacteria | 4096 |
| 135 | Ga0068854_100014249 | 3300005578 | Bacteria | 5237 |
| 136 | Ga0068854_100266064 | 3300005578 | Unclassified | 1374 |
| 137 | Ga0068854_100735922 | 3300005578 | Unclassified | 854 |
| 138 | Ga0068856_100008750 | 3300005614 | Bacteria | 9843 |
| 139 | Ga0068856_100011947 | 3300005614 | Bacteria | 8407 |
| 140 | Ga0068856_100037989 | 3300005614 | Bacteria | 4726 |
| 141 | Ga0068856_102683532 | 3300005614 | Unclassified | 503 |
| 142 | Ga0070702_100228929 | 3300005615 | Bacteria | 1248 |
| 143 | Ga0068852_100033382 | 3300005616 | Bacteria | 4272 |
| 144 | Ga0068852_100049566 | 3300005616 | Bacteria | 3593 |
| 145 | Ga0068852_100069722 | 3300005616 | Bacteria | 3083 |
| 146 | Ga0068852_100089631 | 3300005616 | Unclassified | 2749 |
| 147 | Ga0068852_100349034 | 3300005616 | Bacteria | 1444 |
| 148 | Ga0068852_101502079 | 3300005616 | Unclassified | 696 |
| 149 | Ga0068852_101914795 | 3300005616 | Unclassified | 615 |
| 150 | Ga0068859_100075038 | 3300005617 | Bacteria | 3422 |
| 151 | Ga0068859_100160272 | 3300005617 | Bacteria | 2329 |
| 152 | Ga0068859_100732656 | 3300005617 | Bacteria | 1078 |
| 153 | Ga0068859_100865428 | 3300005617 | Bacteria | 989 |
| 154 | Ga0068864_100001175 | 3300005618 | Bacteria | 21803 |
| 155 | Ga0068864_100003620 | 3300005618 | Bacteria | 12774 |
| 156 | Ga0068864_100252745 | 3300005618 | Bacteria | 1637 |
| 157 | Ga0068861_100273428 | 3300005719 | Bacteria | 1452 |
| 158 | Ga0068861_100303801 | 3300005719 | Unclassified | 1383 |
| 159 | Ga0068861_100613389 | 3300005719 | Bacteria | 1000 |
| 160 | Ga0068851_10130036 | 3300005834 | Bacteria | 1361 |
| 161 | Ga0068851_10158446 | 3300005834 | Bacteria | 1242 |
| 162 | Ga0068851_10240970 | 3300005834 | Bacteria | 1022 |
| 163 | Ga0068870_11040645 | 3300005840 | Bacteria | 586 |
| 164 | Ga0068870_11187480 | 3300005840 | Unclassified | 552 |
| 165 | Ga0068863_100015786 | 3300005841 | Bacteria | 7249 |
| 166 | Ga0068863_100031697 | 3300005841 | Bacteria | 5043 |
| 167 | Ga0068863_100063331 | 3300005841 | Bacteria | 3497 |
| 168 | Ga0068858_100019551 | 3300005842 | Bacteria | 6333 |
| 169 | Ga0068858_100025137 | 3300005842 | Bacteria | 5542 |
| 170 | Ga0068858_100200007 | 3300005842 | Bacteria | 1889 |
| 171 | Ga0068860_100010994 | 3300005843 | Bacteria | 8923 |
| 172 | Ga0068860_100156505 | 3300005843 | Unclassified | 2196 |
| 173 | Ga0068860_101172246 | 3300005843 | Unclassified | 788 |
| 174 | Ga0068862_100445085 | 3300005844 | Unclassified | 1220 |
| 175 | Ga0068862_100598594 | 3300005844 | Bacteria | 1058 |
| 176 | Ga0068862_100748202 | 3300005844 | Bacteria | 951 |
| 177 | Ga0081455_10346656 | 3300005937 | Unclassified | 1049 |
| 178 | Ga0070717_10008628 | 3300006028 | Bacteria | 7620 |
| 179 | Ga0070717_10167567 | 3300006028 | Bacteria | 1909 |
| 180 | Ga0070717_10278066 | 3300006028 | Bacteria | 1484 |
| 181 | Ga0070717_10321296 | 3300006028 | Bacteria | 1379 |
| 182 | Ga0075368_10259429 | 3300006042 | Bacteria | 744 |
| 183 | Ga0070715_10043959 | 3300006163 | Bacteria | 1886 |
| 184 | Ga0070716_100019097 | 3300006173 | Bacteria | 3579 |
| 185 | Ga0070716_100868448 | 3300006173 | Unclassified | 704 |
| 186 | Ga0070712_100001905 | 3300006175 | Bacteria | 12750 |
| 187 | Ga0070712_100124316 | 3300006175 | Bacteria | 1946 |
| 188 | Ga0070712_100240969 | 3300006175 | Bacteria | 1440 |
| 189 | Ga0075367_10000410 | 3300006178 | Bacteria | 15802 |
| 190 | Ga0075367_10213509 | 3300006178 | Unclassified | 1207 |
| 191 | Ga0097621_100007667 | 3300006237 | Bacteria | 7739 |
| 192 | Ga0097621_100095196 | 3300006237 | Unclassified | 2497 |
| 193 | Ga0097621_101270308 | 3300006237 | Unclassified | 695 |
| 194 | Ga0068871_100039762 | 3300006358 | Bacteria | 3765 |
| 195 | Ga0068871_101882665 | 3300006358 | Unclassified | 568 |
| 196 | Ga0075428_100000236 | 3300006844 | Bacteria | 53844 |
| 197 | Ga0075430_100001255 | 3300006846 | Bacteria | 20437 |
| 198 | Ga0075430_100002999 | 3300006846 | Bacteria | 14124 |
| 199 | Ga0075430_100010194 | 3300006846 | Bacteria | 7957 |
| 200 | Ga0075430_100690645 | 3300006846 | Unclassified | 841 |
| 201 | Ga0075431_100003430 | 3300006847 | Bacteria | 15377 |
| 202 | Ga0075431_100019086 | 3300006847 | Bacteria | 6985 |
| 203 | Ga0075431_100083054 | 3300006847 | Bacteria | 3307 |
| 204 | Ga0075431_100591272 | 3300006847 | Bacteria | 1094 |
| 205 | Ga0075433_10010718 | 3300006852 | Bacteria | 7372 |
| 206 | Ga0075434_100000241 | 3300006871 | Bacteria | 38088 |
| 207 | Ga0075434_100126219 | 3300006871 | Unclassified | 2575 |
| 208 | Ga0075429_100019572 | 3300006880 | Bacteria | 5866 |
| 209 | Ga0075429_100096777 | 3300006880 | Bacteria | 2575 |
| 210 | Ga0075429_101032239 | 3300006880 | Bacteria | 719 |
| 211 | Ga0075429_101250827 | 3300006880 | Bacteria | 648 |
| 212 | Ga0075429_101391335 | 3300006880 | Unclassified | 611 |
| 213 | Ga0068865_100344114 | 3300006881 | Unclassified | 1206 |
| 214 | Ga0068865_100927830 | 3300006881 | Unclassified | 758 |
| 215 | Ga0068865_101197869 | 3300006881 | Bacteria | 672 |
| 216 | Ga0075436_100001159 | 3300006914 | Bacteria | 17853 |
| 217 | Ga0075436_100009611 | 3300006914 | Bacteria | 6621 |
| 218 | Ga0075436_100028975 | 3300006914 | Unclassified | 3809 |
| 219 | Ga0097620_100075037 | 3300006931 | Bacteria | 3422 |
| 220 | Ga0097620_100160283 | 3300006931 | Bacteria | 2329 |
| 221 | Ga0097620_100732593 | 3300006931 | Bacteria | 1078 |
| 222 | Ga0097620_100865433 | 3300006931 | Bacteria | 989 |
| 223 | Ga0075435_100000001 | 3300007076 | Bacteria | 207579 |
| 224 | Ga0075435_101635621 | 3300007076 | Bacteria | 565 |
| 225 | Ga0075435_101822273 | 3300007076 | Bacteria | 534 |
| 226 | Ga0099794_10007311 | 3300007265 | Bacteria | 4529 |
| 227 | Ga0099794_10011763 | 3300007265 | Bacteria | 3756 |
| 228 | Ga0099795_10022305 | 3300007788 | Bacteria | 2088 |
| 229 | Ga0105240_10001710 | 3300009093 | Bacteria | 37068 |
| 230 | Ga0105240_10014934 | 3300009093 | Bacteria | 10580 |
| 231 | Ga0105240_10039522 | 3300009093 | Bacteria | 6040 |
| 232 | Ga0105240_10065194 | 3300009093 | Bacteria | 4522 |
| 233 | Ga0105240_10069455 | 3300009093 | Bacteria | 4360 |
| 234 | Ga0105240_10124540 | 3300009093 | Unclassified | 3099 |
| 235 | Ga0105240_10143997 | 3300009093 | Bacteria | 2846 |
| 236 | Ga0105240_10160332 | 3300009093 | Bacteria | 2672 |
| 237 | Ga0105240_10174153 | 3300009093 | Bacteria | 2545 |
| 238 | Ga0105240_10333024 | 3300009093 | Bacteria | 1727 |
| 239 | Ga0105240_10581292 | 3300009093 | Bacteria | 1236 |
| 240 | Ga0105240_11266415 | 3300009093 | Unclassified | 779 |
| 241 | Ga0111539_10000494 | 3300009094 | Bacteria | 50039 |
| 242 | Ga0105245_10011325 | 3300009098 | Bacteria | 7766 |
| 243 | Ga0105245_10046411 | 3300009098 | Bacteria | 3883 |
| 244 | Ga0105245_10338396 | 3300009098 | Unclassified | 1487 |
| 245 | Ga0105245_11234390 | 3300009098 | Unclassified | 796 |
| 246 | Ga0105245_11949077 | 3300009098 | Unclassified | 641 |
| 247 | Ga0105247_10009738 | 3300009101 | Bacteria | 5827 |
| 248 | Ga0114129_10171961 | 3300009147 | Unclassified | 2953 |
| 249 | Ga0114129_10354627 | 3300009147 | Bacteria | 1942 |
| 250 | Ga0114129_11825516 | 3300009147 | Bacteria | 739 |
| 251 | Ga0114129_12060155 | 3300009147 | Bacteria | 689 |
| 252 | Ga0114129_12115739 | 3300009147 | Bacteria | 679 |
| 253 | Ga0105243_10244656 | 3300009148 | Unclassified | 1598 |
| 254 | Ga0105243_10480069 | 3300009148 | Bacteria | 1173 |
| 255 | Ga0105243_10885273 | 3300009148 | Bacteria | 887 |
| 256 | Ga0105241_10010727 | 3300009174 | Bacteria | 6725 |
| 257 | Ga0105241_10027935 | 3300009174 | Bacteria | 4201 |
| 258 | Ga0105241_10108004 | 3300009174 | Bacteria | 2224 |
| 259 | Ga0105241_10141249 | 3300009174 | Unclassified | 1961 |
| 260 | Ga0105241_10433381 | 3300009174 | Bacteria | 1159 |
| 261 | Ga0105241_10585193 | 3300009174 | Unclassified | 1006 |
| 262 | Ga0105242_10071435 | 3300009176 | Unclassified | 2880 |
| 263 | Ga0105242_10119282 | 3300009176 | Bacteria | 2261 |
| 264 | Ga0105242_10442062 | 3300009176 | Bacteria | 1224 |
| 265 | Ga0105242_10806963 | 3300009176 | Bacteria | 929 |
| 266 | Ga0105242_11327427 | 3300009176 | Unclassified | 744 |
| 267 | Ga0105248_10019778 | 3300009177 | Bacteria | 7457 |
| 268 | Ga0105248_10195532 | 3300009177 | Bacteria | 2279 |
| 269 | Ga0105248_10294172 | 3300009177 | Unclassified | 1828 |
| 270 | Ga0105248_10400712 | 3300009177 | Unclassified | 1545 |
| 271 | Ga0105237_10005868 | 3300009545 | Bacteria | 13768 |
| 272 | Ga0105237_10058984 | 3300009545 | Bacteria | 3840 |
| 273 | Ga0105237_10066995 | 3300009545 | Bacteria | 3585 |
| 274 | Ga0105237_10083144 | 3300009545 | Bacteria | 3193 |
| 275 | Ga0105237_10687327 | 3300009545 | Unclassified | 1030 |
| 276 | Ga0105237_10732919 | 3300009545 | Unclassified | 995 |
| 277 | Ga0105238_10000448 | 3300009551 | Bacteria | 43255 |
| 278 | Ga0105238_10013498 | 3300009551 | Bacteria | 8247 |
| 279 | Ga0105238_10018224 | 3300009551 | Bacteria | 7141 |
| 280 | Ga0105238_10028211 | 3300009551 | Bacteria | 5718 |
| 281 | Ga0105238_10065890 | 3300009551 | Unclassified | 3623 |
| 282 | Ga0105238_10317094 | 3300009551 | Bacteria | 1544 |
| 283 | Ga0105238_10361939 | 3300009551 | Bacteria | 1440 |
| 284 | Ga0105238_10419297 | 3300009551 | Unclassified | 1333 |
| 285 | Ga0105238_10476313 | 3300009551 | Bacteria | 1247 |
| 286 | Ga0105238_11003087 | 3300009551 | Bacteria | 856 |
| 287 | Ga0105249_10007397 | 3300009553 | Bacteria | 9582 |
| 288 | Ga0105249_10047270 | 3300009553 | Unclassified | 3921 |
| 289 | Ga0105249_10187197 | 3300009553 | Unclassified | 2018 |
| 290 | Ga0105249_10208896 | 3300009553 | Unclassified | 1915 |
| 291 | Ga0099796_10489336 | 3300010159 | Unclassified | 550 |
| 292 | Ga0105239_10043572 | 3300010375 | Bacteria | 4919 |
| 293 | Ga0105239_10079658 | 3300010375 | Bacteria | 3604 |
| 294 | Ga0105239_10168630 | 3300010375 | Bacteria | 2448 |
| 295 | Ga0105239_11400680 | 3300010375 | Bacteria | 807 |
| 296 | Ga0105239_12305529 | 3300010375 | Unclassified | 626 |
| 297 | Ga0105246_10011660 | 3300011119 | Bacteria | 5460 |
| 298 | Ga0105246_10017100 | 3300011119 | Bacteria | 4606 |
| 299 | Ga0105246_11651503 | 3300011119 | Unclassified | 607 |
| 300 | Ga0105246_12296820 | 3300011119 | Unclassified | 527 |
| 301 | Ga0157339_1072044 | 3300012505 | Unclassified | 500 |
| 302 | Ga0157324_1055608 | 3300012506 | Bacteria | 527 |
| 303 | Ga0157373_10141884 | 3300013100 | Bacteria | 1689 |
| 304 | Ga0157373_10159543 | 3300013100 | Bacteria | 1587 |
| 305 | Ga0157371_10156114 | 3300013102 | Bacteria | 1628 |
| 306 | Ga0157371_10164997 | 3300013102 | Bacteria | 1582 |
| 307 | Ga0157371_10934716 | 3300013102 | Unclassified | 659 |
| 308 | Ga0157370_10021074 | 3300013104 | Bacteria | 6498 |
| 309 | Ga0157370_10058291 | 3300013104 | Bacteria | 3670 |
| 310 | Ga0157370_10184424 | 3300013104 | Unclassified | 1938 |
| 311 | Ga0157370_10212371 | 3300013104 | Unclassified | 1793 |
| 312 | Ga0157370_10844527 | 3300013104 | Bacteria | 832 |
| 313 | Ga0157369_10017034 | 3300013105 | Bacteria | 8166 |
| 314 | Ga0157369_10020563 | 3300013105 | Bacteria | 7379 |
| 315 | Ga0157369_10067319 | 3300013105 | Bacteria | 3851 |
| 316 | Ga0157369_10237471 | 3300013105 | Bacteria | 1904 |
| 317 | Ga0157369_10241480 | 3300013105 | Bacteria | 1887 |
| 318 | Ga0157369_10316068 | 3300013105 | Unclassified | 1624 |
| 319 | Ga0157369_10393091 | 3300013105 | Bacteria | 1439 |
| 320 | Ga0157369_10635237 | 3300013105 | Unclassified | 1101 |
| 321 | Ga0157369_10694307 | 3300013105 | Bacteria | 1048 |
| 322 | Ga0157374_10037953 | 3300013296 | Bacteria | 4425 |
| 323 | Ga0157374_10065213 | 3300013296 | Bacteria | 3420 |
| 324 | Ga0157374_10275920 | 3300013296 | Bacteria | 1659 |
| 325 | Ga0157378_10037263 | 3300013297 | Bacteria | 4306 |
| 326 | Ga0157378_10231237 | 3300013297 | Unclassified | 1762 |
| 327 | Ga0157378_10335744 | 3300013297 | Bacteria | 1472 |
| 328 | Ga0157378_10629986 | 3300013297 | Bacteria | 1086 |
| 329 | Ga0163162_10144165 | 3300013306 | Unclassified | 2496 |
| 330 | Ga0163162_10149686 | 3300013306 | Unclassified | 2451 |
| 331 | Ga0163162_10983136 | 3300013306 | Unclassified | 954 |
| 332 | Ga0163162_11896170 | 3300013306 | Unclassified | 682 |
| 333 | Ga0163162_12475376 | 3300013306 | Viruses | 597 |
| 334 | Ga0157372_10003416 | 3300013307 | Bacteria | 17134 |
| 335 | Ga0157372_10008627 | 3300013307 | Bacteria | 10826 |
| 336 | Ga0157372_10019220 | 3300013307 | Bacteria | 7357 |
| 337 | Ga0157372_10071713 | 3300013307 | Bacteria | 3902 |
| 338 | Ga0157372_10145515 | 3300013307 | Bacteria | 2733 |
| 339 | Ga0157372_10318557 | 3300013307 | Unclassified | 1810 |
| 340 | Ga0157372_10340039 | 3300013307 | Bacteria | 1748 |
| 341 | Ga0157372_11378402 | 3300013307 | Bacteria | 813 |
| 342 | Ga0157372_11437151 | 3300013307 | Unclassified | 795 |
| 343 | Ga0157375_10005215 | 3300013308 | Bacteria | 11274 |
| 344 | Ga0157375_10013655 | 3300013308 | Bacteria | 7239 |
| 345 | Ga0157375_10050715 | 3300013308 | Unclassified | 4072 |
| 346 | Ga0157375_10639472 | 3300013308 | Bacteria | 1221 |
| 347 | Ga0157375_11489072 | 3300013308 | Bacteria | 799 |
| 348 | Ga0157375_13193912 | 3300013308 | Unclassified | 547 |
| 349 | Ga0163163_10023120 | 3300014325 | Bacteria | 5896 |
| 350 | Ga0163163_10040387 | 3300014325 | Bacteria | 4556 |
| 351 | Ga0163163_10078963 | 3300014325 | Unclassified | 3288 |
| 352 | Ga0163163_10102280 | 3300014325 | Unclassified | 2889 |
| 353 | Ga0163163_10324403 | 3300014325 | Unclassified | 1593 |
| 354 | Ga0163163_10349093 | 3300014325 | Bacteria | 1535 |
| 355 | Ga0157380_12516220 | 3300014326 | Unclassified | 581 |
| 356 | Ga0157377_10227993 | 3300014745 | Bacteria | 1196 |
| 357 | Ga0157379_10180311 | 3300014968 | Bacteria | 1908 |
| 358 | Ga0157379_10628734 | 3300014968 | Unclassified | 1004 |
| 359 | Ga0157379_12265690 | 3300014968 | Bacteria | 540 |
| 360 | Ga0157376_10019885 | 3300014969 | Bacteria | 5184 |
| 361 | Ga0157376_10032039 | 3300014969 | Bacteria | 4216 |
| 362 | Ga0157376_10147303 | 3300014969 | Bacteria | 2119 |
| 363 | Ga0157376_10881678 | 3300014969 | Unclassified | 912 |
| 364 | Ga0157376_12159537 | 3300014969 | Bacteria | 595 |
| 365 | Ga0157376_12931220 | 3300014969 | Unclassified | 516 |
| 366 | Ga0163161_10876162 | 3300017792 | Bacteria | 759 |
| 367 | Ga0206353_10849453 | 3300020082 | Bacteria | 1123 |
| 368 | Ga0154015_1045672 | 3300020610 | Unclassified | 1002 |
| 369 | Ga0213876_10158729 | 3300021384 | Bacteria | 1203 |
| 370 | Ga0207697_10037447 | 3300025315 | Bacteria | 1987 |
| 371 | Ga0207656_10145239 | 3300025321 | Bacteria | 1120 |
| 372 | Ga0207692_10009034 | 3300025898 | Bacteria | 4150 |
| 373 | Ga0207692_10060731 | 3300025898 | Bacteria | 1956 |
| 374 | Ga0207692_10340276 | 3300025898 | Bacteria | 923 |
| 375 | Ga0207710_10004198 | 3300025900 | Bacteria | 6314 |
| 376 | Ga0207688_10081534 | 3300025901 | Bacteria | 1848 |
| 377 | Ga0207685_10133560 | 3300025905 | Bacteria | 1104 |
| 378 | Ga0207699_10000427 | 3300025906 | Bacteria | 21540 |
| 379 | Ga0207705_10000016 | 3300025909 | Bacteria | 377359 |
| 380 | Ga0207705_10153590 | 3300025909 | Bacteria | 1726 |
| 381 | Ga0207705_10271470 | 3300025909 | Bacteria | 1297 |
| 382 | Ga0207705_10882906 | 3300025909 | Bacteria | 693 |
| 383 | Ga0207654_10004442 | 3300025911 | Bacteria | 7078 |
| 384 | Ga0207654_10005037 | 3300025911 | Bacteria | 6672 |
| 385 | Ga0207654_10026583 | 3300025911 | Bacteria | 3135 |
| 386 | Ga0207654_10096742 | 3300025911 | Bacteria | 1811 |
| 387 | Ga0207707_10001453 | 3300025912 | Bacteria | 21897 |
| 388 | Ga0207707_10066232 | 3300025912 | Unclassified | 3146 |
| 389 | Ga0207695_10000790 | 3300025913 | Bacteria | 59450 |
| 390 | Ga0207695_10023135 | 3300025913 | Bacteria | 7031 |
| 391 | Ga0207695_10029616 | 3300025913 | Bacteria | 6042 |
| 392 | Ga0207695_10058861 | 3300025913 | Unclassified | 3987 |
| 393 | Ga0207695_10095524 | 3300025913 | Bacteria | 2976 |
| 394 | Ga0207695_10127302 | 3300025913 | Bacteria | 2508 |
| 395 | Ga0207695_10326122 | 3300025913 | Unclassified | 1424 |
| 396 | Ga0207695_10687938 | 3300025913 | Bacteria | 903 |
| 397 | Ga0207671_10000082 | 3300025914 | Bacteria | 146424 |
| 398 | Ga0207671_10088755 | 3300025914 | Bacteria | 2326 |
| 399 | Ga0207671_10205827 | 3300025914 | Unclassified | 1538 |
| 400 | Ga0207671_10474042 | 3300025914 | Unclassified | 997 |
| 401 | Ga0207693_10000631 | 3300025915 | Bacteria | 31514 |
| 402 | Ga0207693_10105343 | 3300025915 | Bacteria | 2212 |
| 403 | Ga0207693_10134225 | 3300025915 | Bacteria | 1946 |
| 404 | Ga0207693_10263516 | 3300025915 | Bacteria | 1351 |
| 405 | Ga0207693_10448949 | 3300025915 | Bacteria | 1008 |
| 406 | Ga0207663_10027468 | 3300025916 | Bacteria | 3318 |
| 407 | Ga0207663_10087348 | 3300025916 | Bacteria | 2059 |
| 408 | Ga0207660_10119709 | 3300025917 | Bacteria | 1993 |
| 409 | Ga0207660_10218920 | 3300025917 | Bacteria | 1493 |
| 410 | Ga0207660_11460793 | 3300025917 | Bacteria | 553 |
| 411 | Ga0207662_10109212 | 3300025918 | Unclassified | 1723 |
| 412 | Ga0207649_10044518 | 3300025920 | Bacteria | 2718 |
| 413 | Ga0207649_11661369 | 3300025920 | Unclassified | 506 |
| 414 | Ga0207652_10016574 | 3300025921 | Bacteria | 6018 |
| 415 | Ga0207652_10038318 | 3300025921 | Bacteria | 4063 |
| 416 | Ga0207652_10278634 | 3300025921 | Unclassified | 1508 |
| 417 | Ga0207646_10119782 | 3300025922 | Bacteria | 2364 |
| 418 | Ga0207646_10348558 | 3300025922 | Unclassified | 1338 |
| 419 | Ga0207681_10034386 | 3300025923 | Unclassified | 3332 |
| 420 | Ga0207694_10000521 | 3300025924 | Bacteria | 34747 |
| 421 | Ga0207694_10001298 | 3300025924 | Bacteria | 21540 |
| 422 | Ga0207694_10013978 | 3300025924 | Bacteria | 6053 |
| 423 | Ga0207694_10358615 | 3300025924 | Bacteria | 1208 |
| 424 | Ga0207694_10861679 | 3300025924 | Unclassified | 766 |
| 425 | Ga0207650_10060586 | 3300025925 | Unclassified | 2824 |
| 426 | Ga0207650_11905277 | 3300025925 | Unclassified | 502 |
| 427 | Ga0207659_10117781 | 3300025926 | Bacteria | 2030 |
| 428 | Ga0207659_10405879 | 3300025926 | Bacteria | 1140 |
| 429 | Ga0207659_10602460 | 3300025926 | Unclassified | 937 |
| 430 | Ga0207687_10023878 | 3300025927 | Bacteria | 4079 |
| 431 | Ga0207700_10000680 | 3300025928 | Bacteria | 19794 |
| 432 | Ga0207700_10073010 | 3300025928 | Bacteria | 2648 |
| 433 | Ga0207700_10187559 | 3300025928 | Unclassified | 1736 |
| 434 | Ga0207700_11250866 | 3300025928 | Unclassified | 662 |
| 435 | Ga0207664_10002901 | 3300025929 | Bacteria | 11398 |
| 436 | Ga0207644_10002309 | 3300025931 | Bacteria | 12360 |
| 437 | Ga0207644_10126658 | 3300025931 | Unclassified | 1950 |
| 438 | Ga0207706_10058168 | 3300025933 | Unclassified | 3405 |
| 439 | Ga0207686_10126881 | 3300025934 | Bacteria | 1745 |
| 440 | Ga0207709_11535475 | 3300025935 | Bacteria | 553 |
| 441 | Ga0207670_10564711 | 3300025936 | Unclassified | 931 |
| 442 | Ga0207669_10112791 | 3300025937 | Bacteria | 1826 |
| 443 | Ga0207669_10645244 | 3300025937 | Bacteria | 865 |
| 444 | Ga0207669_11646670 | 3300025937 | Unclassified | 548 |
| 445 | Ga0207704_10263914 | 3300025938 | Unclassified | 1300 |
| 446 | Ga0207704_10320646 | 3300025938 | Unclassified | 1195 |
| 447 | Ga0207665_10000116 | 3300025939 | Bacteria | 52238 |
| 448 | Ga0207665_10010575 | 3300025939 | Bacteria | 6061 |
| 449 | Ga0207665_10049809 | 3300025939 | Bacteria | 2816 |
| 450 | Ga0207665_10278980 | 3300025939 | Bacteria | 1243 |
| 451 | Ga0207691_10152698 | 3300025940 | Unclassified | 2029 |
| 452 | Ga0207691_10743530 | 3300025940 | Bacteria | 826 |
| 453 | Ga0207691_10883978 | 3300025940 | Bacteria | 748 |
| 454 | Ga0207711_10009708 | 3300025941 | Bacteria | 8014 |
| 455 | Ga0207711_10071208 | 3300025941 | Bacteria | 3016 |
| 456 | Ga0207689_10000630 | 3300025942 | Bacteria | 33610 |
| 457 | Ga0207689_10730054 | 3300025942 | Bacteria | 836 |
| 458 | Ga0207661_10002618 | 3300025944 | Bacteria | 12385 |
| 459 | Ga0207661_10035133 | 3300025944 | Bacteria | 3903 |
| 460 | Ga0207661_11145212 | 3300025944 | Bacteria | 716 |
| 461 | Ga0207679_10028054 | 3300025945 | Bacteria | 3902 |
| 462 | Ga0207679_10104107 | 3300025945 | Bacteria | 2226 |
| 463 | Ga0207679_10349005 | 3300025945 | Bacteria | 1289 |
| 464 | Ga0207667_10000563 | 3300025949 | Bacteria | 48455 |
| 465 | Ga0207667_10014457 | 3300025949 | Bacteria | 8999 |
| 466 | Ga0207667_10110992 | 3300025949 | Bacteria | 2828 |
| 467 | Ga0207667_10789919 | 3300025949 | Bacteria | 947 |
| 468 | Ga0207651_10196739 | 3300025960 | Bacteria | 1612 |
| 469 | Ga0207651_11107696 | 3300025960 | Unclassified | 710 |
| 470 | Ga0207712_10017427 | 3300025961 | Unclassified | 4664 |
| 471 | Ga0207712_10316950 | 3300025961 | Unclassified | 1285 |
| 472 | Ga0207668_10620632 | 3300025972 | Bacteria | 943 |
| 473 | Ga0207640_10751687 | 3300025981 | Bacteria | 841 |
| 474 | Ga0207640_11150023 | 3300025981 | Bacteria | 688 |
| 475 | Ga0207658_10036442 | 3300025986 | Bacteria | 3526 |
| 476 | Ga0207677_10006654 | 3300026023 | Bacteria | 6344 |
| 477 | Ga0207703_10021088 | 3300026035 | Bacteria | 5098 |
| 478 | Ga0207703_10117172 | 3300026035 | Unclassified | 2281 |
| 479 | Ga0207639_11913816 | 3300026041 | Bacteria | 554 |
| 480 | Ga0207708_10039806 | 3300026075 | Bacteria | 3583 |
| 481 | Ga0207708_10267538 | 3300026075 | Unclassified | 1381 |
| 482 | Ga0207708_10303209 | 3300026075 | Bacteria | 1300 |
| 483 | Ga0207702_10003586 | 3300026078 | Bacteria | 14105 |
| 484 | Ga0207702_10036567 | 3300026078 | Bacteria | 4108 |
| 485 | Ga0207702_10581406 | 3300026078 | Bacteria | 1098 |
| 486 | Ga0207641_10004412 | 3300026088 | Bacteria | 12192 |
| 487 | Ga0207641_10019591 | 3300026088 | Bacteria | 5555 |
| 488 | Ga0207676_10038388 | 3300026095 | Bacteria | 3654 |
| 489 | Ga0207676_10176564 | 3300026095 | Bacteria | 1866 |
| 490 | Ga0207676_11918432 | 3300026095 | Unclassified | 591 |
| 491 | Ga0207674_10001574 | 3300026116 | Bacteria | 29383 |
| 492 | Ga0207674_10003124 | 3300026116 | Bacteria | 20428 |
| 493 | Ga0207674_10574649 | 3300026116 | Unclassified | 1089 |
| 494 | Ga0207675_100327971 | 3300026118 | Bacteria | 1496 |
| 495 | Ga0207675_101060841 | 3300026118 | Bacteria | 829 |
| 496 | Ga0207675_101784278 | 3300026118 | Bacteria | 635 |
| 497 | Ga0207683_10049866 | 3300026121 | Bacteria | 3665 |
| 498 | Ga0207683_10073608 | 3300026121 | Bacteria | 3022 |
| 499 | Ga0207683_10202484 | 3300026121 | Bacteria | 1805 |
| 500 | Ga0207683_10508870 | 3300026121 | Unclassified | 1112 |
| 501 | Ga0207698_10009499 | 3300026142 | Bacteria | 6205 |
| 502 | Ga0207698_10112759 | 3300026142 | Bacteria | 2283 |
| 503 | Ga0207698_10482188 | 3300026142 | Bacteria | 1203 |
| 504 | Ga0207698_10850027 | 3300026142 | Unclassified | 917 |
| 505 | Ga0209588_1003824 | 3300027671 | Bacteria | 4199 |
| 506 | Ga0209813_10160877 | 3300027866 | Unclassified | 810 |
| 507 | Ga0209974_10318875 | 3300027876 | Unclassified | 598 |
| 508 | Ga0207428_10003638 | 3300027907 | Bacteria | 14861 |
| 509 | Ga0268266_10035094 | 3300028379 | Unclassified | 4266 |
| 510 | Ga0268266_10173122 | 3300028379 | Bacteria | 1960 |
| 511 | Ga0268265_10296409 | 3300028380 | Bacteria | 1454 |
| 512 | Ga0268265_10436807 | 3300028380 | Bacteria | 1219 |
| 513 | Ga0268265_10785306 | 3300028380 | Bacteria | 927 |
| 514 | Ga0268265_12056979 | 3300028380 | Unclassified | 578 |
| 515 | Ga0268264_10028240 | 3300028381 | Bacteria | 4587 |
| 516 | Ga0268264_10841329 | 3300028381 | Unclassified | 919 |
| 517 | Ga0265338_10844727 | 3300028800 | Unclassified | 626 |
| 518 | Ga0316177_1048794 | 3300030731 | Bacteria | 698 |
| 519 | Ga0316177_1067344 | 3300030731 | Bacteria | 795 |
| 520 | Ga0265760_10339069 | 3300031090 | Unclassified | 537 |
| 521 | Ga0265316_10262415 | 3300031344 | Bacteria | 1266 |
| 522 | Ga0307408_100011515 | 3300031548 | Bacteria | 5843 |
| 523 | Ga0307408_100012942 | 3300031548 | Bacteria | 5532 |
| 524 | Ga0307408_100116777 | 3300031548 | Bacteria | 2060 |
| 525 | Ga0307408_100201613 | 3300031548 | Bacteria | 1611 |
| 526 | Ga0307408_100522259 | 3300031548 | Bacteria | 1043 |
| 527 | Ga0307408_102086324 | 3300031548 | Unclassified | 546 |
| 528 | Ga0265314_10240185 | 3300031711 | Bacteria | 1046 |
| 529 | Ga0307405_10030103 | 3300031731 | Bacteria | 3180 |
| 530 | Ga0307405_10768310 | 3300031731 | Bacteria | 804 |
| 531 | Ga0307405_10915925 | 3300031731 | Bacteria | 742 |
| 532 | Ga0307413_10241257 | 3300031824 | Bacteria | 1334 |
| 533 | Ga0307413_11253931 | 3300031824 | Unclassified | 647 |
| 534 | Ga0307413_11329450 | 3300031824 | Unclassified | 630 |
| 535 | Ga0307410_10087110 | 3300031852 | Unclassified | 2208 |
| 536 | Ga0307410_10162008 | 3300031852 | Bacteria | 1677 |
| 537 | Ga0307410_10836522 | 3300031852 | Unclassified | 785 |
| 538 | Ga0307406_10090589 | 3300031901 | Bacteria | 2058 |
| 539 | Ga0307406_10715605 | 3300031901 | Bacteria | 837 |
| 540 | Ga0307406_11262798 | 3300031901 | Unclassified | 643 |
| 541 | Ga0307407_10322013 | 3300031903 | Unclassified | 1085 |
| 542 | Ga0307407_10456638 | 3300031903 | Bacteria | 928 |
| 543 | Ga0307412_10008743 | 3300031911 | Bacteria | 5795 |
| 544 | Ga0307412_10556407 | 3300031911 | Bacteria | 964 |
| 545 | Ga0307412_11085969 | 3300031911 | Bacteria | 711 |
| 546 | Ga0307409_100047286 | 3300031995 | Bacteria | 3264 |
| 547 | Ga0307409_100915944 | 3300031995 | Unclassified | 891 |
| 548 | Ga0307416_100007392 | 3300032002 | Bacteria | 6982 |
| 549 | Ga0307416_100237140 | 3300032002 | Bacteria | 1764 |
| 550 | Ga0307416_100325409 | 3300032002 | Bacteria | 1542 |
| 551 | Ga0307416_100689852 | 3300032002 | Bacteria | 1109 |
| 552 | Ga0307416_101807214 | 3300032002 | Bacteria | 715 |
| 553 | Ga0307414_10016774 | 3300032004 | Bacteria | 4464 |
| 554 | Ga0307414_10095199 | 3300032004 | Bacteria | 2225 |
| 555 | Ga0307414_10241092 | 3300032004 | Bacteria | 1497 |
| 556 | Ga0307414_10707312 | 3300032004 | Bacteria | 913 |
| 557 | Ga0307414_11278209 | 3300032004 | Unclassified | 680 |
| 558 | Ga0307411_10017458 | 3300032005 | Bacteria | 4090 |
| 559 | Ga0307411_10484290 | 3300032005 | Bacteria | 1042 |
| 560 | Ga0307411_11850892 | 3300032005 | Bacteria | 561 |
| 561 | Ga0307415_102286821 | 3300032126 | Unclassified | 530 |
| 562 | Ga0373926_0030681 | 3300035083 | Unclassified | 1894 |
| 563 | Ga0373934_0045787 | 3300035086 | Unclassified | 1730 |
| 564 | Ga0373936_0096787 | 3300035113 | Unclassified | 1242 |
| 565 | Ga0373953_0023525 | 3300035117 | Bacteria | 2333 |
| 566 | Ga0373954_0226305 | 3300035118 | Unclassified | 920 |
| 567 | Ga0373956_0364519 | 3300035119 | Unclassified | 689 |
| 568 | Ga0373957_0016560 | 3300035120 | Bacteria | 2553 |
| 569 | Ga0373943_0096214 | 3300035170 | Unclassified | 1541 |
| 570 | Ga0373946_0322934 | 3300035171 | Unclassified | 767 |
| 571 | Ga0373946_0466238 | 3300035171 | Bacteria | 645 |
| 572 | Ga0373955_0029472 | 3300035172 | Unclassified | 2854 |
| 573 | Ga0316574_0148777 | 3300035398 | Bacteria | 1509 |
| 574 | Ga0373924_0422760 | 3300035410 | Unclassified | 596 |
| 575 | Ga0373931_0788027 | 3300035691 | Bacteria | 633 |
| 576 | Ga0373927_0063670 | 3300035695 | Unclassified | 2385 |
| 577 | Ga0373927_0187686 | 3300035695 | Unclassified | 1356 |
| 578 | Ga0373927_0948814 | 3300035695 | Bacteria | 568 |
| 579 | Ga0373933_0272066 | 3300035724 | Unclassified | 1093 |
| 580 | Ga0373947_0061556 | 3300035725 | Unclassified | 2281 |
| 581 | Ga0373937_0028128 | 3300036401 | Bacteria | 5087 |
| 582 | Ga0373937_0353072 | 3300036401 | Unclassified | 1393 |
| 583 | Ga0373937_1000013 | 3300036401 | Unclassified | 785 |
| 584 | Ga0373925_0272826 | 3300037068 | Bacteria | 1361 |
| 585 | Ga0395905_0104394 | 3300037471 | Bacteria | 2661 |
| 586 | Ga0395905_1760699 | 3300037471 | Unclassified | 525 |
| 587 | Ga0436364_0579380 | 3300037853 | Bacteria | 672 |
| 588 | Ga0436364_0764407 | 3300037853 | Bacteria | 11998 |
| 589 | Ga0436365_0004838 | 3300039437 | Bacteria | 1203 |
| 590 | Ga0436365_0315914 | 3300039437 | Bacteria | 1662 |
| 591 | Ga0436363_1386824 | 3300039450 | Unclassified | 637 |
| 592 | Ga0439439_0156143 | 3300041406 | Bacteria | 649 |
| 593 | Ga0439441_004546 | 3300042001 | Bacteria | 2110 |
| 594 | Ga0439445_0014094 | 3300042004 | Bacteria | 1943 |
| 595 | Ga0439448_0310798 | 3300042005 | Bacteria | 560 |
| 596 | Ga0439449_0217751 | 3300042007 | Bacteria | 716 |
| 597 | Ga0439462_0037195 | 3300042015 | Bacteria | 1296 |
| 598 | Ga0439462_0072830 | 3300042015 | Bacteria | 934 |
| 599 | Ga0439462_0142336 | 3300042015 | Unclassified | 672 |
| 600 | Ga0450898_100259 | 3300042134 | Bacteria | 605 |
| 601 | Ga0439434_0097830 | 3300042435 | Unclassified | 943 |
| 602 | Ga0439464_0013788 | 3300042439 | Bacteria | 2169 |
| 603 | Ga0466965_0824548 | 3300044683 | Bacteria | 538 |
| 604 | Ga0466963_0019720 | 3300044694 | Bacteria | 4234 |
| 605 | Ga0466960_0774286 | 3300044901 | Bacteria | 580 |
| 606 | Ga0466959_0541745 | 3300045049 | Unclassified | 785 |
| 607 | Ga0451576_0844788 | 3300045051 | Unclassified | 961 |
| 608 | Ga0451576_1819636 | 3300045051 | Bacteria | 629 |
| 609 | Ga0466958_0643505 | 3300045836 | Unclassified | 690 |
| 610 | Ga0466967_0429718 | 3300045976 | Bacteria | 1288 |
| 611 | Ga0495651_0357060 | 3300046462 | Unclassified | 964 |
| 612 | Ga0495653_0549864 | 3300046463 | Unclassified | 714 |
| 613 | Ga0495580_0004600 | 3300046472 | Bacteria | 11577 |
| 614 | Ga0495582_0206482 | 3300046473 | Bacteria | 1122 |
| 615 | Ga0495639_0423485 | 3300046475 | Bacteria | 674 |
| 616 | Ga0495664_0099620 | 3300046477 | Bacteria | 1750 |
| 617 | Ga0495630_0078467 | 3300046517 | Bacteria | 2490 |
| 618 | Ga0495665_0467126 | 3300046531 | Bacteria | 637 |
| 619 | Ga0495640_0454629 | 3300046533 | Viruses | 782 |
| 620 | Ga0495667_0627445 | 3300046559 | Bacteria | 669 |
| 621 | Ga0495635_0758542 | 3300046663 | Unclassified | 627 |
| 622 | Ga0495659_0175540 | 3300046664 | Bacteria | 871 |
| 623 | Ga0495623_0673573 | 3300046679 | Unclassified | 532 |
| 624 | Ga0495646_0424877 | 3300046680 | Unclassified | 689 |
| 625 | Ga0495647_0204636 | 3300046681 | Bacteria | 867 |
| 626 | Ga0495600_0748689 | 3300046809 | Unclassified | 585 |
| 627 | Ga0495581_0224902 | 3300047315 | Bacteria | 1098 |
| 628 | Ga0495581_0912785 | 3300047315 | Bacteria | 501 |
| 629 | Ga0495604_0133621 | 3300047317 | Unclassified | 1781 |
| 630 | Ga0495674_0030953 | 3300047319 | Bacteria | 4863 |
| 631 | Ga0495674_0107985 | 3300047319 | Bacteria | 2362 |
| 632 | Ga0495674_0231243 | 3300047319 | Bacteria | 1526 |
| 633 | Ga0495672_0113640 | 3300047320 | Bacteria | 1450 |
| 634 | Ga0495683_0332011 | 3300047323 | Unclassified | 646 |
| 635 | Ga0495675_0500779 | 3300047444 | Unclassified | 698 |
| 636 | Ga0495684_0200179 | 3300047471 | Bacteria | 1473 |
| 637 | Ga0496101_0401416 | 3300048904 | Bacteria | 1079 |
| 638 | Ga0496102_0077062 | 3300048905 | Unclassified | 3068 |
| 639 | Ga0496103_0845868 | 3300048906 | Bacteria | 575 |
| 640 | Ga0496106_0033265 | 3300048909 | Bacteria | 3847 |
| 641 | Ga0496106_0228762 | 3300048909 | Unclassified | 1484 |
| 642 | Ga0496107_0111396 | 3300048910 | Bacteria | 2012 |
| 643 | Ga0496108_0015078 | 3300048911 | Bacteria | 6309 |
| 644 | Ga0496108_1754896 | 3300048911 | Unclassified | 509 |
| 645 | Ga0496109_0002699 | 3300048912 | Bacteria | 14878 |
| 646 | Ga0496110_0004460 | 3300048913 | Bacteria | 10854 |
| 647 | Ga0496111_0098571 | 3300048914 | Unclassified | 2146 |
| 648 | Ga0496112_0048531 | 3300048915 | Unclassified | 4162 |
| 649 | Ga0496113_0001631 | 3300048916 | Bacteria | 12647 |
| 650 | Ga0496114_1582848 | 3300048917 | Bacteria | 543 |
| 651 | Ga0501290_065212 | 3300049513 | Bacteria | 594 |
| 652 | Ga0501291_022653 | 3300049514 | Bacteria | 1009 |
| 653 | Ga0501297_006903 | 3300049520 | Bacteria | 1222 |
| 654 | Ga0501298_042810 | 3300049521 | Bacteria | 922 |
| 655 | Ga0501299_001004 | 3300049522 | Bacteria | 3513 |
| 656 | Ga0501303_002678 | 3300049526 | Bacteria | 1389 |
| 657 | Ga0501032_0237172 | 3300049569 | Bacteria | 1185 |
| 658 | Ga0501033_0076693 | 3300049570 | Bacteria | 2454 |
| 659 | Ga0501036_0843976 | 3300049572 | Unclassified | 753 |
| 660 | Ga0501039_0396631 | 3300049575 | Bacteria | 1084 |
| 661 | Ga0501039_1599237 | 3300049575 | Unclassified | 500 |
| 662 | Ga0501040_1011496 | 3300049576 | Unclassified | 603 |
| 663 | Ga0501072_0514987 | 3300049588 | Bacteria | 946 |
| 664 | Ga0501072_0880375 | 3300049588 | Unclassified | 700 |
| 665 | Ga0501074_0671126 | 3300049590 | Unclassified | 732 |
| 666 | Ga0501076_0345297 | 3300049592 | Bacteria | 1222 |
| 667 | Ga0501076_0447712 | 3300049592 | Bacteria | 1063 |
| 668 | Ga0501076_1191252 | 3300049592 | Bacteria | 627 |
| 669 | Ga0501077_0857070 | 3300049593 | Bacteria | 584 |
| 670 | Ga0501077_1028745 | 3300049593 | Unclassified | 530 |
| 671 | Ga0501206_011173 | 3300049653 | Bacteria | 1210 |
| 672 | Ga0501208_089866 | 3300049655 | Bacteria | 644 |
| 673 | Ga0501216_013742 | 3300049660 | Bacteria | 1347 |
| 674 | Ga0501217_158889 | 3300049661 | Bacteria | 680 |
| 675 | Ga0501224_028658 | 3300049664 | Bacteria | 834 |
| 676 | Ga0501252_042158 | 3300049682 | Bacteria | 666 |
| 677 | Ga0501260_023338 | 3300049689 | Bacteria | 681 |
| 678 | Ga0501261_107280 | 3300049690 | Bacteria | 538 |
| 679 | Ga0501225_0039780 | 3300049705 | Bacteria | 1295 |
| 680 | Ga0501234_040371 | 3300049707 | Bacteria | 763 |
| 681 | Ga0501079_0611588 | 3300049741 | Unclassified | 858 |
| 682 | Ga0501080_0927832 | 3300049742 | Bacteria | 758 |
| 683 | Ga0501080_1681108 | 3300049742 | Unclassified | 536 |
| 684 | Ga0501081_0111602 | 3300049743 | Bacteria | 1941 |
| 685 | Ga0501081_0179074 | 3300049743 | Bacteria | 1533 |
| 686 | Ga0501081_1353129 | 3300049743 | Bacteria | 540 |
| 687 | Ga0501268_084379 | 3300049765 | Unclassified | 660 |
| 688 | Ga0501270_014589 | 3300049767 | Bacteria | 1109 |
| 689 | Ga0501283_015577 | 3300049779 | Bacteria | 1171 |
| 690 | Ga0501283_054351 | 3300049779 | Bacteria | 714 |
| 691 | Ga0501045_1090659 | 3300049824 | Unclassified | 584 |
| 692 | nmdc:mga06z11_257431_c1 | 3300050494 | Bacteria | 1029 |
| 693 | nmdc:mga06z11_325243_c1 | 3300050494 | Bacteria | 918 |
| 694 | nmdc:mga06z11_334384_c1 | 3300050494 | Unclassified | 905 |
| 695 | nmdc:mga07m45_844135_c1 | 3300050496 | Unclassified | 524 |
| 696 | nmdc:mga05p37_1244684_c1 | 3300050507 | Bacteria | 764 |
| 697 | nmdc:mga05p37_1506126_c1 | 3300050507 | Bacteria | 669 |
| 698 | nmdc:mga05p37_381338_c1 | 3300050507 | Unclassified | 1652 |
| 699 | nmdc:mga09592_1251666_c1 | 3300050508 | Unclassified | 612 |
| 700 | nmdc:mga09592_29376_c1 | 3300050508 | Bacteria | 4573 |
| 701 | nmdc:mga09592_577359_c1 | 3300050508 | Bacteria | 964 |
| 702 | nmdc:mga09592_885912_c1 | 3300050508 | Bacteria | 751 |
| 703 | nmdc:mga0qj67_24760_c1 | 3300050509 | Unclassified | 4631 |
| 704 | nmdc:mga0qj67_3051_c1 | 3300050509 | Bacteria | 12034 |
| 705 | nmdc:mga0qj67_651366_c1 | 3300050509 | Unclassified | 840 |
| 706 | nmdc:mga0qj67_9687_c1 | 3300050509 | Bacteria | 7175 |
| 707 | nmdc:mga06r32_305925_c1 | 3300050510 | Bacteria | 1575 |
| 708 | nmdc:mga06r32_502000_c1 | 3300050510 | Bacteria | 1190 |
| 709 | nmdc:mga06r32_59519_c1 | 3300050510 | Bacteria | 3674 |
| 710 | nmdc:mga06r32_7329_c1 | 3300050510 | Bacteria | 9929 |
| 711 | nmdc:mga08y16_800146_c1 | 3300050511 | Bacteria | 936 |
| 712 | nmdc:mga08y16_944_c1 | 3300050511 | Bacteria | 28257 |
| 713 | nmdc:mga0n895_23_c1 | 3300050512 | Bacteria | 92165 |
| 714 | nmdc:mga0rr50_11_c1 | 3300050513 | Bacteria | 216152 |
| 715 | nmdc:mga08x19_294783_c1 | 3300050514 | Unclassified | 1126 |
| 716 | nmdc:mga08x19_342_c1 | 3300050514 | Bacteria | 33694 |
| 717 | nmdc:mga08x19_46494_c2 | 3300050514 | Bacteria | 2067 |
| 718 | nmdc:mga0a205_20208_c1 | 3300050515 | Bacteria | 6282 |
| 719 | nmdc:mga0a205_5146_c1 | 3300050515 | Bacteria | 11763 |
| 720 | nmdc:mga0a205_93402_c1 | 3300050515 | Bacteria | 2907 |
| 721 | Ga0495601_0048564 | 3300053077 | Bacteria | 2673 |
| 722 | Ga0495601_0797112 | 3300053077 | Unclassified | 600 |
| 723 | Ga0500568_0003612 | 3300053139 | Bacteria | 8538 |
| 724 | Ga0500599_013114 | 3300053736 | Bacteria | 1118 |
| 725 | Ga0501084_0094692 | 3300054114 | Bacteria | 2508 |
| 726 | Ga0501084_0196752 | 3300054114 | Bacteria | 1701 |
| 727 | Ga0501084_0333734 | 3300054114 | Bacteria | 1281 |
| 728 | Ga0501084_0500638 | 3300054114 | Bacteria | 1027 |
| 729 | Ga0590071_047227 | 3300059421 | Unclassified | 1041 |
| 730 | Ga0590074_008685 | 3300059423 | Bacteria | 1691 |
| 731 | Ga0590075_047661 | 3300059424 | Bacteria | 1099 |
| 732 | Ga0590075_146972 | 3300059424 | Unclassified | 621 |
| 733 | Ga0501082_0757739 | 3300060353 | Bacteria | 850 |
| 734 | Ga0501082_1353232 | 3300060353 | Bacteria | 622 |
| 735 | Ga0501082_1948956 | 3300060353 | Unclassified | 512 |
| 736 | Ga0530510_0020340 | 3300061734 | Bacteria | 4719 |
| 737 | Ga0065712_10129503 | |||
| 738 | rootH2_10029268 | |||
| 739 | rootH1_10167616 | |||
| 740 | Ga0058861_11874416 | |||
| 741 | Ga0058862_12864595 | |||
| 742 | Ga0065714_10120485 | |||
| 743 | Ga0065712_10000917 | |||
| 744 | Ga0065712_10219885 | |||
| 745 | Ga0065715_10101055 | |||
| 746 | Ga0065715_10206861 | |||
| 747 | Ga0065715_10509543 | |||
| 748 | Ga0065707_10208508 | |||
| 749 | Ga0065707_10900229 | |||
| 750 | Ga0065707_11085347 | |||
| 751 | Ga0070658_10000010 | |||
| 752 | Ga0070658_10225570 | |||
| 753 | Ga0070658_10243245 | |||
| 754 | Ga0070683_100002402 | |||
| 755 | Ga0070683_100024209 | |||
| 756 | Ga0070683_100306042 | |||
| 757 | Ga0070670_100046451 | |||
| 758 | Ga0070670_100199424 | |||
| 759 | Ga0070670_100339214 | |||
| 760 | Ga0068869_100038282 | |||
| 761 | Ga0068869_100060505 | |||
| 762 | Ga0070666_10005963 | |||
| 763 | Ga0070666_11460234 | |||
| 764 | Ga0070680_100047909 | |||
| 765 | Ga0070682_100014074 | |||
| 766 | Ga0070682_101894921 | |||
| 767 | Ga0068868_100019841 | |||
| 768 | Ga0068868_101909022 | |||
| 769 | Ga0070689_100153502 | |||
| 770 | Ga0070689_101822825 | |||
| 771 | Ga0070689_102016695 | |||
| 772 | Ga0070661_100013639 | |||
| 773 | Ga0070661_100332406 | |||
| 774 | Ga0070661_100569472 | |||
| 775 | Ga0070661_101729451 | |||
| 776 | Ga0070692_10242261 | |||
| 777 | Ga0070668_100054270 | |||
| 778 | Ga0070669_100261020 | |||
| 779 | Ga0070669_100324083 | |||
| 780 | Ga0070675_100052114 | |||
| 781 | Ga0070675_100448152 | |||
| 782 | Ga0070675_102069906 | |||
| 783 | Ga0070671_100011138 | |||
| 784 | Ga0070671_100092761 | |||
| 785 | Ga0070674_100257215 | |||
| 786 | Ga0070674_100453301 | |||
| 787 | Ga0070674_100592858 | |||
| 788 | Ga0070674_100885773 | |||
| 789 | Ga0070673_100052665 | |||
| 790 | Ga0070673_100200986 | |||
| 791 | Ga0070688_100008063 | |||
| 792 | Ga0070688_100038931 | |||
| 793 | Ga0070667_100014626 | |||
| 794 | Ga0070667_100024020 | |||
| 795 | Ga0070703_10247904 | |||
| 796 | Ga0070709_10000905 | |||
| 797 | Ga0070709_11511448 | |||
| 798 | Ga0070714_100166445 | |||
| 799 | Ga0070713_100000393 | |||
| 800 | Ga0070713_100125223 | |||
| 801 | Ga0070713_100460907 | |||
| 802 | Ga0070713_100929589 | |||
| 803 | Ga0070713_101041052 | |||
| 804 | Ga0070713_102390947 | |||
| 805 | Ga0070710_10008343 | |||
| 806 | Ga0070710_10658855 | |||
| 807 | Ga0070701_10018452 | |||
| 808 | Ga0070711_100014329 | |||
| 809 | Ga0070711_100044717 | |||
| 810 | Ga0070711_101410617 | |||
| 811 | Ga0070700_100032387 | |||
| 812 | Ga0070700_100208972 | |||
| 813 | Ga0070694_101312324 | |||
| 814 | Ga0070708_100017119 | |||
| 815 | Ga0070708_100066598 | |||
| 816 | Ga0070663_100708123 | |||
| 817 | Ga0070678_100008116 | |||
| 818 | Ga0070678_100048703 | |||
| 819 | Ga0070662_100019205 | |||
| 820 | Ga0070662_100443174 | |||
| 821 | Ga0070681_10059848 | |||
| 822 | Ga0070681_11889668 | |||
| 823 | Ga0070685_10008348 | |||
| 824 | Ga0070707_100020548 | |||
| 825 | Ga0070707_100569072 | |||
| 826 | Ga0070707_100914871 | |||
| 827 | Ga0070707_101131976 | |||
| 828 | Ga0070698_100057923 | |||
| 829 | Ga0070699_100065883 | |||
| 830 | Ga0070699_100115629 | |||
| 831 | Ga0070699_100330174 | |||
| 832 | Ga0070699_101337753 | |||
| 833 | Ga0070679_100016491 | |||
| 834 | Ga0070679_100083741 | |||
| 835 | Ga0070684_100001521 | |||
| 836 | Ga0070684_100043522 | |||
| 837 | Ga0070684_100066005 | |||
| 838 | Ga0070684_100099009 | |||
| 839 | Ga0070684_100119607 | |||
| 840 | Ga0070697_100014979 | |||
| 841 | Ga0070697_100124525 | |||
| 842 | Ga0068853_100221421 | |||
| 843 | Ga0068853_100965420 | |||
| 844 | Ga0068853_101062674 | |||
| 845 | Ga0068853_101121857 | |||
| 846 | Ga0068853_102251285 | |||
| 847 | Ga0070672_100038550 | |||
| 848 | Ga0070672_100039384 | |||
| 849 | Ga0070686_100124770 | |||
| 850 | Ga0070686_100774837 | |||
| 851 | Ga0070696_100364486 | |||
| 852 | Ga0070696_101342342 | |||
| 853 | Ga0070693_101365616 | |||
| 854 | Ga0070665_100029622 | |||
| 855 | Ga0070665_100081071 | |||
| 856 | Ga0070665_100211136 | |||
| 857 | Ga0070665_101049250 | |||
| 858 | Ga0070665_101323199 | |||
| 859 | Ga0068855_100012300 | |||
| 860 | Ga0068855_100022659 | |||
| 861 | Ga0068855_100032209 | |||
| 862 | Ga0068855_100075160 | |||
| 863 | Ga0068855_100076390 | |||
| 864 | Ga0068855_100423968 | |||
| 865 | Ga0068855_101771168 | |||
| 866 | Ga0070664_100038901 | |||
| 867 | Ga0070664_100059399 | |||
| 868 | Ga0070664_100276549 | |||
| 869 | Ga0070664_100446583 | |||
| 870 | Ga0068857_100041174 | |||
| 871 | Ga0068854_100014249 | |||
| 872 | Ga0068854_100266064 | |||
| 873 | Ga0068854_100735922 | |||
| 874 | Ga0068856_100008750 | |||
| 875 | Ga0068856_100011947 | |||
| 876 | Ga0068856_100037989 | |||
| 877 | Ga0068856_102683532 | |||
| 878 | Ga0070702_100228929 | |||
| 879 | Ga0068852_100033382 | |||
| 880 | Ga0068852_100049566 | |||
| 881 | Ga0068852_100069722 | |||
| 882 | Ga0068852_100089631 | |||
| 883 | Ga0068852_100349034 | |||
| 884 | Ga0068852_101502079 | |||
| 885 | Ga0068852_101914795 | |||
| 886 | Ga0068859_100075038 | |||
| 887 | Ga0068859_100160272 | |||
| 888 | Ga0068859_100732656 | |||
| 889 | Ga0068859_100865428 | |||
| 890 | Ga0068864_100001175 | |||
| 891 | Ga0068864_100003620 | |||
| 892 | Ga0068864_100252745 | |||
| 893 | Ga0068861_100273428 | |||
| 894 | Ga0068861_100303801 | |||
| 895 | Ga0068861_100613389 | |||
| 896 | Ga0068851_10130036 | |||
| 897 | Ga0068851_10158446 | |||
| 898 | Ga0068851_10240970 | |||
| 899 | Ga0068870_11040645 | |||
| 900 | Ga0068870_11187480 | |||
| 901 | Ga0068863_100015786 | |||
| 902 | Ga0068863_100031697 | |||
| 903 | Ga0068863_100063331 | |||
| 904 | Ga0068858_100019551 | |||
| 905 | Ga0068858_100025137 | |||
| 906 | Ga0068858_100200007 | |||
| 907 | Ga0068860_100010994 | |||
| 908 | Ga0068860_100156505 | |||
| 909 | Ga0068860_101172246 | |||
| 910 | Ga0068862_100445085 | |||
| 911 | Ga0068862_100598594 | |||
| 912 | Ga0068862_100748202 | |||
| 913 | Ga0081455_10346656 | |||
| 914 | Ga0070717_10008628 | |||
| 915 | Ga0070717_10167567 | |||
| 916 | Ga0070717_10278066 | |||
| 917 | Ga0070717_10321296 | |||
| 918 | Ga0075368_10259429 | |||
| 919 | Ga0070715_10043959 | |||
| 920 | Ga0070716_100019097 | |||
| 921 | Ga0070716_100868448 | |||
| 922 | Ga0070712_100001905 | |||
| 923 | Ga0070712_100124316 | |||
| 924 | Ga0070712_100240969 | |||
| 925 | Ga0075367_10000410 | |||
| 926 | Ga0075367_10213509 | |||
| 927 | Ga0097621_100007667 | |||
| 928 | Ga0097621_100095196 | |||
| 929 | Ga0097621_101270308 | |||
| 930 | Ga0068871_100039762 | |||
| 931 | Ga0068871_101882665 | |||
| 932 | Ga0075428_100000236 | |||
| 933 | Ga0075430_100001255 | |||
| 934 | Ga0075430_100002999 | |||
| 935 | Ga0075430_100010194 | |||
| 936 | Ga0075430_100690645 | |||
| 937 | Ga0075431_100003430 | |||
| 938 | Ga0075431_100019086 | |||
| 939 | Ga0075431_100083054 | |||
| 940 | Ga0075431_100591272 | |||
| 941 | Ga0075433_10010718 | |||
| 942 | Ga0075434_100000241 | |||
| 943 | Ga0075434_100126219 | |||
| 944 | Ga0075429_100019572 | |||
| 945 | Ga0075429_100096777 | |||
| 946 | Ga0075429_101032239 | |||
| 947 | Ga0075429_101250827 | |||
| 948 | Ga0075429_101391335 | |||
| 949 | Ga0068865_100344114 | |||
| 950 | Ga0068865_100927830 | |||
| 951 | Ga0068865_101197869 | |||
| 952 | Ga0075436_100001159 | |||
| 953 | Ga0075436_100009611 | |||
| 954 | Ga0075436_100028975 | |||
| 955 | Ga0097620_100075037 | |||
| 956 | Ga0097620_100160283 | |||
| 957 | Ga0097620_100732593 | |||
| 958 | Ga0097620_100865433 | |||
| 959 | Ga0075435_100000001 | |||
| 960 | Ga0075435_101635621 | |||
| 961 | Ga0075435_101822273 | |||
| 962 | Ga0099794_10007311 | |||
| 963 | Ga0099794_10011763 | |||
| 964 | Ga0099795_10022305 | |||
| 965 | Ga0105240_10001710 | |||
| 966 | Ga0105240_10014934 | |||
| 967 | Ga0105240_10039522 | |||
| 968 | Ga0105240_10065194 | |||
| 969 | Ga0105240_10069455 | |||
| 970 | Ga0105240_10124540 | |||
| 971 | Ga0105240_10143997 | |||
| 972 | Ga0105240_10160332 | |||
| 973 | Ga0105240_10174153 | |||
| 974 | Ga0105240_10333024 | |||
| 975 | Ga0105240_10581292 | |||
| 976 | Ga0105240_11266415 | |||
| 977 | Ga0111539_10000494 | |||
| 978 | Ga0105245_10011325 | |||
| 979 | Ga0105245_10046411 | |||
| 980 | Ga0105245_10338396 | |||
| 981 | Ga0105245_11234390 | |||
| 982 | Ga0105245_11949077 | |||
| 983 | Ga0105247_10009738 | |||
| 984 | Ga0114129_10171961 | |||
| 985 | Ga0114129_10354627 | |||
| 986 | Ga0114129_11825516 | |||
| 987 | Ga0114129_12060155 | |||
| 988 | Ga0114129_12115739 | |||
| 989 | Ga0105243_10244656 | |||
| 990 | Ga0105243_10480069 | |||
| 991 | Ga0105243_10885273 | |||
| 992 | Ga0105241_10010727 | |||
| 993 | Ga0105241_10027935 | |||
| 994 | Ga0105241_10108004 | |||
| 995 | Ga0105241_10141249 | |||
| 996 | Ga0105241_10433381 | |||
| 997 | Ga0105241_10585193 | |||
| 998 | Ga0105242_10071435 | |||
| 999 | Ga0105242_10119282 | |||
| 1000 | Ga0105242_10442062 | |||
| 1001 | Ga0105242_10806963 | |||
| 1002 | Ga0105242_11327427 | |||
| 1003 | Ga0105248_10019778 | |||
| 1004 | Ga0105248_10195532 | |||
| 1005 | Ga0105248_10294172 | |||
| 1006 | Ga0105248_10400712 | |||
| 1007 | Ga0105237_10005868 | |||
| 1008 | Ga0105237_10058984 | |||
| 1009 | Ga0105237_10066995 | |||
| 1010 | Ga0105237_10083144 | |||
| 1011 | Ga0105237_10687327 | |||
| 1012 | Ga0105237_10732919 | |||
| 1013 | Ga0105238_10000448 | |||
| 1014 | Ga0105238_10013498 | |||
| 1015 | Ga0105238_10018224 | |||
| 1016 | Ga0105238_10028211 | |||
| 1017 | Ga0105238_10065890 | |||
| 1018 | Ga0105238_10317094 | |||
| 1019 | Ga0105238_10361939 | |||
| 1020 | Ga0105238_10419297 | |||
| 1021 | Ga0105238_10476313 | |||
| 1022 | Ga0105238_11003087 | |||
| 1023 | Ga0105249_10007397 | |||
| 1024 | Ga0105249_10047270 | |||
| 1025 | Ga0105249_10187197 | |||
| 1026 | Ga0105249_10208896 | |||
| 1027 | Ga0099796_10489336 | |||
| 1028 | Ga0105239_10043572 | |||
| 1029 | Ga0105239_10079658 | |||
| 1030 | Ga0105239_10168630 | |||
| 1031 | Ga0105239_11400680 | |||
| 1032 | Ga0105239_12305529 | |||
| 1033 | Ga0105246_10011660 | |||
| 1034 | Ga0105246_10017100 | |||
| 1035 | Ga0105246_11651503 | |||
| 1036 | Ga0105246_12296820 | |||
| 1037 | Ga0157339_1072044 | |||
| 1038 | Ga0157324_1055608 | |||
| 1039 | Ga0157373_10141884 | |||
| 1040 | Ga0157373_10159543 | |||
| 1041 | Ga0157371_10156114 | |||
| 1042 | Ga0157371_10164997 | |||
| 1043 | Ga0157371_10934716 | |||
| 1044 | Ga0157370_10021074 | |||
| 1045 | Ga0157370_10058291 | |||
| 1046 | Ga0157370_10184424 | |||
| 1047 | Ga0157370_10212371 | |||
| 1048 | Ga0157370_10844527 | |||
| 1049 | Ga0157369_10017034 | |||
| 1050 | Ga0157369_10020563 | |||
| 1051 | Ga0157369_10067319 | |||
| 1052 | Ga0157369_10237471 | |||
| 1053 | Ga0157369_10241480 | |||
| 1054 | Ga0157369_10316068 | |||
| 1055 | Ga0157369_10393091 | |||
| 1056 | Ga0157369_10635237 | |||
| 1057 | Ga0157369_10694307 | |||
| 1058 | Ga0157374_10037953 | |||
| 1059 | Ga0157374_10065213 | |||
| 1060 | Ga0157374_10275920 | |||
| 1061 | Ga0157378_10037263 | |||
| 1062 | Ga0157378_10231237 | |||
| 1063 | Ga0157378_10335744 | |||
| 1064 | Ga0157378_10629986 | |||
| 1065 | Ga0163162_10144165 | |||
| 1066 | Ga0163162_10149686 | |||
| 1067 | Ga0163162_10983136 | |||
| 1068 | Ga0163162_11896170 | |||
| 1069 | Ga0163162_12475376 | |||
| 1070 | Ga0157372_10003416 | |||
| 1071 | Ga0157372_10008627 | |||
| 1072 | Ga0157372_10019220 | |||
| 1073 | Ga0157372_10071713 | |||
| 1074 | Ga0157372_10145515 | |||
| 1075 | Ga0157372_10318557 | |||
| 1076 | Ga0157372_10340039 | |||
| 1077 | Ga0157372_11378402 | |||
| 1078 | Ga0157372_11437151 | |||
| 1079 | Ga0157375_10005215 | |||
| 1080 | Ga0157375_10013655 | |||
| 1081 | Ga0157375_10050715 | |||
| 1082 | Ga0157375_10639472 | |||
| 1083 | Ga0157375_11489072 | |||
| 1084 | Ga0157375_13193912 | |||
| 1085 | Ga0163163_10023120 | |||
| 1086 | Ga0163163_10040387 | |||
| 1087 | Ga0163163_10078963 | |||
| 1088 | Ga0163163_10102280 | |||
| 1089 | Ga0163163_10324403 | |||
| 1090 | Ga0163163_10349093 | |||
| 1091 | Ga0157380_12516220 | |||
| 1092 | Ga0157377_10227993 | |||
| 1093 | Ga0157379_10180311 | |||
| 1094 | Ga0157379_10628734 | |||
| 1095 | Ga0157379_12265690 | |||
| 1096 | Ga0157376_10019885 | |||
| 1097 | Ga0157376_10032039 | |||
| 1098 | Ga0157376_10147303 | |||
| 1099 | Ga0157376_10881678 | |||
| 1100 | Ga0157376_12159537 | |||
| 1101 | Ga0157376_12931220 | |||
| 1102 | Ga0163161_10876162 | |||
| 1103 | Ga0206353_10849453 | |||
| 1104 | Ga0154015_1045672 | |||
| 1105 | Ga0213876_10158729 | |||
| 1106 | Ga0207697_10037447 | |||
| 1107 | Ga0207656_10145239 | |||
| 1108 | Ga0207692_10009034 | |||
| 1109 | Ga0207692_10060731 | |||
| 1110 | Ga0207692_10340276 | |||
| 1111 | Ga0207710_10004198 | |||
| 1112 | Ga0207688_10081534 | |||
| 1113 | Ga0207685_10133560 | |||
| 1114 | Ga0207699_10000427 | |||
| 1115 | Ga0207705_10000016 | |||
| 1116 | Ga0207705_10153590 | |||
| 1117 | Ga0207705_10271470 | |||
| 1118 | Ga0207705_10882906 | |||
| 1119 | Ga0207654_10004442 | |||
| 1120 | Ga0207654_10005037 | |||
| 1121 | Ga0207654_10026583 | |||
| 1122 | Ga0207654_10096742 | |||
| 1123 | Ga0207707_10001453 | |||
| 1124 | Ga0207707_10066232 | |||
| 1125 | Ga0207695_10000790 | |||
| 1126 | Ga0207695_10023135 | |||
| 1127 | Ga0207695_10029616 | |||
| 1128 | Ga0207695_10058861 | |||
| 1129 | Ga0207695_10095524 | |||
| 1130 | Ga0207695_10127302 | |||
| 1131 | Ga0207695_10326122 | |||
| 1132 | Ga0207695_10687938 | |||
| 1133 | Ga0207671_10000082 | |||
| 1134 | Ga0207671_10088755 | |||
| 1135 | Ga0207671_10205827 | |||
| 1136 | Ga0207671_10474042 | |||
| 1137 | Ga0207693_10000631 | |||
| 1138 | Ga0207693_10105343 | |||
| 1139 | Ga0207693_10134225 | |||
| 1140 | Ga0207693_10263516 | |||
| 1141 | Ga0207693_10448949 | |||
| 1142 | Ga0207663_10027468 | |||
| 1143 | Ga0207663_10087348 | |||
| 1144 | Ga0207660_10119709 | |||
| 1145 | Ga0207660_10218920 | |||
| 1146 | Ga0207660_11460793 | |||
| 1147 | Ga0207662_10109212 | |||
| 1148 | Ga0207649_10044518 | |||
| 1149 | Ga0207649_11661369 | |||
| 1150 | Ga0207652_10016574 | |||
| 1151 | Ga0207652_10038318 | |||
| 1152 | Ga0207652_10278634 | |||
| 1153 | Ga0207646_10119782 | |||
| 1154 | Ga0207646_10348558 | |||
| 1155 | Ga0207681_10034386 | |||
| 1156 | Ga0207694_10000521 | |||
| 1157 | Ga0207694_10001298 | |||
| 1158 | Ga0207694_10013978 | |||
| 1159 | Ga0207694_10358615 | |||
| 1160 | Ga0207694_10861679 | |||
| 1161 | Ga0207650_10060586 | |||
| 1162 | Ga0207650_11905277 | |||
| 1163 | Ga0207659_10117781 | |||
| 1164 | Ga0207659_10405879 | |||
| 1165 | Ga0207659_10602460 | |||
| 1166 | Ga0207687_10023878 | |||
| 1167 | Ga0207700_10000680 | |||
| 1168 | Ga0207700_10073010 | |||
| 1169 | Ga0207700_10187559 | |||
| 1170 | Ga0207700_11250866 | |||
| 1171 | Ga0207664_10002901 | |||
| 1172 | Ga0207644_10002309 | |||
| 1173 | Ga0207644_10126658 | |||
| 1174 | Ga0207706_10058168 | |||
| 1175 | Ga0207686_10126881 | |||
| 1176 | Ga0207709_11535475 | |||
| 1177 | Ga0207670_10564711 | |||
| 1178 | Ga0207669_10112791 | |||
| 1179 | Ga0207669_10645244 | |||
| 1180 | Ga0207669_11646670 | |||
| 1181 | Ga0207704_10263914 | |||
| 1182 | Ga0207704_10320646 | |||
| 1183 | Ga0207665_10000116 | |||
| 1184 | Ga0207665_10010575 | |||
| 1185 | Ga0207665_10049809 | |||
| 1186 | Ga0207665_10278980 | |||
| 1187 | Ga0207691_10152698 | |||
| 1188 | Ga0207691_10743530 | |||
| 1189 | Ga0207691_10883978 | |||
| 1190 | Ga0207711_10009708 | |||
| 1191 | Ga0207711_10071208 | |||
| 1192 | Ga0207689_10000630 | |||
| 1193 | Ga0207689_10730054 | |||
| 1194 | Ga0207661_10002618 | |||
| 1195 | Ga0207661_10035133 | |||
| 1196 | Ga0207661_11145212 | |||
| 1197 | Ga0207679_10028054 | |||
| 1198 | Ga0207679_10104107 | |||
| 1199 | Ga0207679_10349005 | |||
| 1200 | Ga0207667_10000563 | |||
| 1201 | Ga0207667_10014457 | |||
| 1202 | Ga0207667_10110992 | |||
| 1203 | Ga0207667_10789919 | |||
| 1204 | Ga0207651_10196739 | |||
| 1205 | Ga0207651_11107696 | |||
| 1206 | Ga0207712_10017427 | |||
| 1207 | Ga0207712_10316950 | |||
| 1208 | Ga0207668_10620632 | |||
| 1209 | Ga0207640_10751687 | |||
| 1210 | Ga0207640_11150023 | |||
| 1211 | Ga0207658_10036442 | |||
| 1212 | Ga0207677_10006654 | |||
| 1213 | Ga0207703_10021088 | |||
| 1214 | Ga0207703_10117172 | |||
| 1215 | Ga0207639_11913816 | |||
| 1216 | Ga0207708_10039806 | |||
| 1217 | Ga0207708_10267538 | |||
| 1218 | Ga0207708_10303209 | |||
| 1219 | Ga0207702_10003586 | |||
| 1220 | Ga0207702_10036567 | |||
| 1221 | Ga0207702_10581406 | |||
| 1222 | Ga0207641_10004412 | |||
| 1223 | Ga0207641_10019591 | |||
| 1224 | Ga0207676_10038388 | |||
| 1225 | Ga0207676_10176564 | |||
| 1226 | Ga0207676_11918432 | |||
| 1227 | Ga0207674_10001574 | |||
| 1228 | Ga0207674_10003124 | |||
| 1229 | Ga0207674_10574649 | |||
| 1230 | Ga0207675_100327971 | |||
| 1231 | Ga0207675_101060841 | |||
| 1232 | Ga0207675_101784278 | |||
| 1233 | Ga0207683_10049866 | |||
| 1234 | Ga0207683_10073608 | |||
| 1235 | Ga0207683_10202484 | |||
| 1236 | Ga0207683_10508870 | |||
| 1237 | Ga0207698_10009499 | |||
| 1238 | Ga0207698_10112759 | |||
| 1239 | Ga0207698_10482188 | |||
| 1240 | Ga0207698_10850027 | |||
| 1241 | Ga0209588_1003824 | |||
| 1242 | Ga0209813_10160877 | |||
| 1243 | Ga0209974_10318875 | |||
| 1244 | Ga0207428_10003638 | |||
| 1245 | Ga0268266_10035094 | |||
| 1246 | Ga0268266_10173122 | |||
| 1247 | Ga0268265_10296409 | |||
| 1248 | Ga0268265_10436807 | |||
| 1249 | Ga0268265_10785306 | |||
| 1250 | Ga0268265_12056979 | |||
| 1251 | Ga0268264_10028240 | |||
| 1252 | Ga0268264_10841329 | |||
| 1253 | Ga0265338_10844727 | |||
| 1254 | Ga0316177_1048794 | |||
| 1255 | Ga0316177_1067344 | |||
| 1256 | Ga0265760_10339069 | |||
| 1257 | Ga0265316_10262415 | |||
| 1258 | Ga0307408_100011515 | |||
| 1259 | Ga0307408_100012942 | |||
| 1260 | Ga0307408_100116777 | |||
| 1261 | Ga0307408_100201613 | |||
| 1262 | Ga0307408_100522259 | |||
| 1263 | Ga0307408_102086324 | |||
| 1264 | Ga0265314_10240185 | |||
| 1265 | Ga0307405_10030103 | |||
| 1266 | Ga0307405_10768310 | |||
| 1267 | Ga0307405_10915925 | |||
| 1268 | Ga0307413_10241257 | |||
| 1269 | Ga0307413_11253931 | |||
| 1270 | Ga0307413_11329450 | |||
| 1271 | Ga0307410_10087110 | |||
| 1272 | Ga0307410_10162008 | |||
| 1273 | Ga0307410_10836522 | |||
| 1274 | Ga0307406_10090589 | |||
| 1275 | Ga0307406_10715605 | |||
| 1276 | Ga0307406_11262798 | |||
| 1277 | Ga0307407_10322013 | |||
| 1278 | Ga0307407_10456638 | |||
| 1279 | Ga0307412_10008743 | |||
| 1280 | Ga0307412_10556407 | |||
| 1281 | Ga0307412_11085969 | |||
| 1282 | Ga0307409_100047286 | |||
| 1283 | Ga0307409_100915944 | |||
| 1284 | Ga0307416_100007392 | |||
| 1285 | Ga0307416_100237140 | |||
| 1286 | Ga0307416_100325409 | |||
| 1287 | Ga0307416_100689852 | |||
| 1288 | Ga0307416_101807214 | |||
| 1289 | Ga0307414_10016774 | |||
| 1290 | Ga0307414_10095199 | |||
| 1291 | Ga0307414_10241092 | |||
| 1292 | Ga0307414_10707312 | |||
| 1293 | Ga0307414_11278209 | |||
| 1294 | Ga0307411_10017458 | |||
| 1295 | Ga0307411_10484290 | |||
| 1296 | Ga0307411_11850892 | |||
| 1297 | Ga0307415_102286821 | |||
| 1298 | Ga0373926_0030681 | |||
| 1299 | Ga0373934_0045787 | |||
| 1300 | Ga0373936_0096787 | |||
| 1301 | Ga0373953_0023525 | |||
| 1302 | Ga0373954_0226305 | |||
| 1303 | Ga0373956_0364519 | |||
| 1304 | Ga0373957_0016560 | |||
| 1305 | Ga0373943_0096214 | |||
| 1306 | Ga0373946_0322934 | |||
| 1307 | Ga0373946_0466238 | |||
| 1308 | Ga0373955_0029472 | |||
| 1309 | Ga0316574_0148777 | |||
| 1310 | Ga0373924_0422760 | |||
| 1311 | Ga0373931_0788027 | |||
| 1312 | Ga0373927_0063670 | |||
| 1313 | Ga0373927_0187686 | |||
| 1314 | Ga0373927_0948814 | |||
| 1315 | Ga0373933_0272066 | |||
| 1316 | Ga0373947_0061556 | |||
| 1317 | Ga0373937_0028128 | |||
| 1318 | Ga0373937_0353072 | |||
| 1319 | Ga0373937_1000013 | |||
| 1320 | Ga0373925_0272826 | |||
| 1321 | Ga0395905_0104394 | |||
| 1322 | Ga0395905_1760699 | |||
| 1323 | Ga0436364_0579380 | |||
| 1324 | Ga0436364_0764407 | |||
| 1325 | Ga0436365_0004838 | |||
| 1326 | Ga0436365_0315914 | |||
| 1327 | Ga0436363_1386824 | |||
| 1328 | Ga0439439_0156143 | |||
| 1329 | Ga0439441_004546 | |||
| 1330 | Ga0439445_0014094 | |||
| 1331 | Ga0439448_0310798 | |||
| 1332 | Ga0439449_0217751 | |||
| 1333 | Ga0439462_0037195 | |||
| 1334 | Ga0439462_0072830 | |||
| 1335 | Ga0439462_0142336 | |||
| 1336 | Ga0450898_100259 | |||
| 1337 | Ga0439434_0097830 | |||
| 1338 | Ga0439464_0013788 | |||
| 1339 | Ga0466965_0824548 | |||
| 1340 | Ga0466963_0019720 | |||
| 1341 | Ga0466960_0774286 | |||
| 1342 | Ga0466959_0541745 | |||
| 1343 | Ga0451576_0844788 | |||
| 1344 | Ga0451576_1819636 | |||
| 1345 | Ga0466958_0643505 | |||
| 1346 | Ga0466967_0429718 | |||
| 1347 | Ga0495651_0357060 | |||
| 1348 | Ga0495653_0549864 | |||
| 1349 | Ga0495580_0004600 | |||
| 1350 | Ga0495582_0206482 | |||
| 1351 | Ga0495639_0423485 | |||
| 1352 | Ga0495664_0099620 | |||
| 1353 | Ga0495630_0078467 | |||
| 1354 | Ga0495665_0467126 | |||
| 1355 | Ga0495640_0454629 | |||
| 1356 | Ga0495667_0627445 | |||
| 1357 | Ga0495635_0758542 | |||
| 1358 | Ga0495659_0175540 | |||
| 1359 | Ga0495623_0673573 | |||
| 1360 | Ga0495646_0424877 | |||
| 1361 | Ga0495647_0204636 | |||
| 1362 | Ga0495600_0748689 | |||
| 1363 | Ga0495581_0224902 | |||
| 1364 | Ga0495581_0912785 | |||
| 1365 | Ga0495604_0133621 | |||
| 1366 | Ga0495674_0030953 | |||
| 1367 | Ga0495674_0107985 | |||
| 1368 | Ga0495674_0231243 | |||
| 1369 | Ga0495672_0113640 | |||
| 1370 | Ga0495683_0332011 | |||
| 1371 | Ga0495675_0500779 | |||
| 1372 | Ga0495684_0200179 | |||
| 1373 | Ga0496101_0401416 | |||
| 1374 | Ga0496102_0077062 | |||
| 1375 | Ga0496103_0845868 | |||
| 1376 | Ga0496106_0033265 | |||
| 1377 | Ga0496106_0228762 | |||
| 1378 | Ga0496107_0111396 | |||
| 1379 | Ga0496108_0015078 | |||
| 1380 | Ga0496108_1754896 | |||
| 1381 | Ga0496109_0002699 | |||
| 1382 | Ga0496110_0004460 | |||
| 1383 | Ga0496111_0098571 | |||
| 1384 | Ga0496112_0048531 | |||
| 1385 | Ga0496113_0001631 | |||
| 1386 | Ga0496114_1582848 | |||
| 1387 | Ga0501290_065212 | |||
| 1388 | Ga0501291_022653 | |||
| 1389 | Ga0501297_006903 | |||
| 1390 | Ga0501298_042810 | |||
| 1391 | Ga0501299_001004 | |||
| 1392 | Ga0501303_002678 | |||
| 1393 | Ga0501032_0237172 | |||
| 1394 | Ga0501033_0076693 | |||
| 1395 | Ga0501036_0843976 | |||
| 1396 | Ga0501039_0396631 | |||
| 1397 | Ga0501039_1599237 | |||
| 1398 | Ga0501040_1011496 | |||
| 1399 | Ga0501072_0514987 | |||
| 1400 | Ga0501072_0880375 | |||
| 1401 | Ga0501074_0671126 | |||
| 1402 | Ga0501076_0345297 | |||
| 1403 | Ga0501076_0447712 | |||
| 1404 | Ga0501076_1191252 | |||
| 1405 | Ga0501077_0857070 | |||
| 1406 | Ga0501077_1028745 | |||
| 1407 | Ga0501206_011173 | |||
| 1408 | Ga0501208_089866 | |||
| 1409 | Ga0501216_013742 | |||
| 1410 | Ga0501217_158889 | |||
| 1411 | Ga0501224_028658 | |||
| 1412 | Ga0501252_042158 | |||
| 1413 | Ga0501260_023338 | |||
| 1414 | Ga0501261_107280 | |||
| 1415 | Ga0501225_0039780 | |||
| 1416 | Ga0501234_040371 | |||
| 1417 | Ga0501079_0611588 | |||
| 1418 | Ga0501080_0927832 | |||
| 1419 | Ga0501080_1681108 | |||
| 1420 | Ga0501081_0111602 | |||
| 1421 | Ga0501081_0179074 | |||
| 1422 | Ga0501081_1353129 | |||
| 1423 | Ga0501268_084379 | |||
| 1424 | Ga0501270_014589 | |||
| 1425 | Ga0501283_015577 | |||
| 1426 | Ga0501283_054351 | |||
| 1427 | Ga0501045_1090659 | |||
| 1428 | nmdc:mga06z11_257431_c1 | |||
| 1429 | nmdc:mga06z11_325243_c1 | |||
| 1430 | nmdc:mga06z11_334384_c1 | |||
| 1431 | nmdc:mga07m45_844135_c1 | |||
| 1432 | nmdc:mga05p37_1244684_c1 | |||
| 1433 | nmdc:mga05p37_1506126_c1 | |||
| 1434 | nmdc:mga05p37_381338_c1 | |||
| 1435 | nmdc:mga09592_1251666_c1 | |||
| 1436 | nmdc:mga09592_29376_c1 | |||
| 1437 | nmdc:mga09592_577359_c1 | |||
| 1438 | nmdc:mga09592_885912_c1 | |||
| 1439 | nmdc:mga0qj67_24760_c1 | |||
| 1440 | nmdc:mga0qj67_3051_c1 | |||
| 1441 | nmdc:mga0qj67_651366_c1 | |||
| 1442 | nmdc:mga0qj67_9687_c1 | |||
| 1443 | nmdc:mga06r32_305925_c1 | |||
| 1444 | nmdc:mga06r32_502000_c1 | |||
| 1445 | nmdc:mga06r32_59519_c1 | |||
| 1446 | nmdc:mga06r32_7329_c1 | |||
| 1447 | nmdc:mga08y16_800146_c1 | |||
| 1448 | nmdc:mga08y16_944_c1 | |||
| 1449 | nmdc:mga0n895_23_c1 | |||
| 1450 | nmdc:mga0rr50_11_c1 | |||
| 1451 | nmdc:mga08x19_294783_c1 | |||
| 1452 | nmdc:mga08x19_342_c1 | |||
| 1453 | nmdc:mga08x19_46494_c2 | |||
| 1454 | nmdc:mga0a205_20208_c1 | |||
| 1455 | nmdc:mga0a205_5146_c1 | |||
| 1456 | nmdc:mga0a205_93402_c1 | |||
| 1457 | Ga0495601_0048564 | |||
| 1458 | Ga0495601_0797112 | |||
| 1459 | Ga0500568_0003612 | |||
| 1460 | Ga0500599_013114 | |||
| 1461 | Ga0501084_0094692 | |||
| 1462 | Ga0501084_0196752 | |||
| 1463 | Ga0501084_0333734 | |||
| 1464 | Ga0501084_0500638 | |||
| 1465 | Ga0590071_047227 | |||
| 1466 | Ga0590074_008685 | |||
| 1467 | Ga0590075_047661 | |||
| 1468 | Ga0590075_146972 | |||
| 1469 | Ga0501082_0757739 | |||
| 1470 | Ga0501082_1353232 | |||
| 1471 | Ga0501082_1948956 | |||
| 1472 | Ga0530510_0020340 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9415 | 17 | 114 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9306 | 16 | 115 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9297 | 16 | 114 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9254 | 16 | 114 |
| 7wjp-assembly1.cif.gz_A-2 | structure of padr-like protein from listeria monocytogenes | 0.9022 | 16 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9254 | 16 | 114 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8862 | 12 | 114 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.886 | 19 | 97 | 1.10.10.10 |
| 4g9yA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.885 | 18 | 108 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8819 | 16 | 114 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L4ZKY0-F1-model_v4 | Transcriptional regulator PadR-family | 0.9924 | 9 | 115 |
|
| AF-A0A848X716-F1-model_v4 | PadR family transcriptional regulator | 0.9923 | 16 | 114 |
|
| AF-A0A2V8HL98-F1-model_v4 | PadR family transcriptional regulator | 0.9907 | 16 | 115 |
|
| AF-A0A7V0Y143-F1-model_v4 | PadR family transcriptional regulator | 0.99 | 16 | 116 |
|
| AF-A0A843TB24-F1-model_v4 | PadR family transcriptional regulator | 0.9889 | 16 | 115 |
|