F478231

General Info

Members Datasets Scaffolds Average Seq Length
735 342 671 196

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0663298|Ga0496126_0663298_201_794
Length 197
Sequence MTTIRKALMETVRFTKMAEGTKEEYELLAARGAAFTVRLPDRILAALDELREGGDGYRVTRFEHSVQTATRAHRDGKDEEYVVMALVHDIGDGLAPYTHSEMIGAVLQPFVRPEIVWIARHHGAFQLYYYAHHYGRDRNVREAHRGHQWFDACAEFCEQYDQVSFDPDYDNLPIEHFQPMVRRVFGQPRYARPDGDS

Samples

Sample ID Description Type Environment
1 2511231004 Pseudomonas sp. GM102 Isolate Nodule
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231007 Pseudomonas sp. GM18 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231016 Pseudomonas sp. GM50 Isolate Nodule
7 2511231021 Pseudomonas sp. GM78 Isolate Nodule
8 2511231022 Pseudomonas sp. GM79 Isolate Nodule
9 2511231023 Pseudomonas sp. GM80 Isolate Nodule
10 2511231031 Pseudomonas sp. GM16 Isolate Nodule
11 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
12 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
13 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
14 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
15 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
16 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
17 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
18 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
19 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
20 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
21 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
22 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
23 2643221585 Pelomonas sp. Root662 Isolate Unclassified
24 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
25 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
26 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
27 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
28 2643221656 Pelomonas sp. Root405 Isolate Unclassified
29 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
30 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
31 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
32 2738541337 Pelomonas sp. BT06 Isolate Unclassified
33 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
34 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
35 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
36 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
37 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
38 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
39 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
40 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
41 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
42 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
43 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
44 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
45 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
46 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
47 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
48 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
49 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
50 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
51 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
52 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
53 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
54 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
55 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
56 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
66 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
74 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
152 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
153 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
178 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
181 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
184 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
185 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
192 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
193 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
194 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
195 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
196 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
197 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
198 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
199 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
200 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
201 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
202 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
203 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
204 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
208 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
209 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
214 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
225 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
226 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
308 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
309 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
314 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
315 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
316 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
324 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
336 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
337 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
338 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
339 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
340 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
341 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
342 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.88
Metatranscriptomes 0.41
Isolates 8.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 1.5
Rhizoplane 2.31
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10012056 3300003322 Bacteria 13768
2 rootH1_10020558 3300003323 Bacteria 3467
3 rootH1_10114129 3300003323 Bacteria 1353
4 Ga0055536_1000041 3300003781 Bacteria 127266
5 Ga0055536_1000042 3300003781 Bacteria 125029
6 Ga0055536_1004420 3300003781 Bacteria 7198
7 Ga0055536_1007529 3300003781 Bacteria 4851
8 Ga0055530_10000063 3300003791 Bacteria 94619
9 Ga0055530_10000174 3300003791 Bacteria 58795
10 Ga0055530_10000411 3300003791 Bacteria 38127
11 Ga0055530_10002068 3300003791 Bacteria 13475
12 Ga0055530_10035526 3300003791 Bacteria 1263
13 Ga0055540_1000278 3300003792 Bacteria 45985
14 Ga0055540_1000318 3300003792 Bacteria 42704
15 Ga0055531_10000412 3300003794 Bacteria 41097
16 Ga0055531_10001746 3300003794 Bacteria 15529
17 Ga0055531_10014294 3300003794 Bacteria 3584
18 Ga0065165_1000806 3300005262 Bacteria 41749
19 Ga0065714_10067840 3300005288 Bacteria 5163
20 Ga0065714_10077559 3300005288 Bacteria 2676
21 Ga0065714_10091407 3300005288 Bacteria 1896
22 Ga0065704_10016922 3300005289 Bacteria 2168
23 Ga0070683_100080622 3300005329 Bacteria 3047
24 Ga0070683_100226489 3300005329 Bacteria 1777
25 Ga0070670_100341714 3300005331 Bacteria 1314
26 Ga0070689_100029810 3300005340 Bacteria 4135
27 Ga0070669_100045051 3300005353 Bacteria 3214
28 Ga0070669_100136641 3300005353 Bacteria 1886
29 Ga0070659_100052719 3300005366 Bacteria 3200
30 Ga0070713_100283654 3300005436 Bacteria 1520
31 Ga0070711_100280486 3300005439 Bacteria 1318
32 Ga0070694_100134776 3300005444 Bacteria 1788
33 Ga0070708_100194289 3300005445 Bacteria 1899
34 Ga0070678_100175672 3300005456 Bacteria 1748
35 Ga0070662_100781482 3300005457 Bacteria 811
36 Ga0070681_10068669 3300005458 Bacteria 3511
37 Ga0070706_100316838 3300005467 Bacteria 1455
38 Ga0070707_100164803 3300005468 Bacteria 2160
39 Ga0070699_100038092 3300005518 Bacteria 4164
40 Ga0070679_100215314 3300005530 Bacteria 1883
41 Ga0070697_100236948 3300005536 Bacteria 1558
42 Ga0070695_100275938 3300005545 Bacteria 1233
43 Ga0070696_100145438 3300005546 Bacteria 1736
44 Ga0070665_100079480 3300005548 Bacteria 3285
45 Ga0070665_100228216 3300005548 Bacteria 1862
46 Ga0068857_100203152 3300005577 Bacteria 1806
47 Ga0068857_100672582 3300005577 Bacteria 982
48 Ga0068856_100107692 3300005614 Bacteria 2783
49 Ga0068858_100189143 3300005842 Bacteria 1945
50 Ga0068858_100563001 3300005842 Bacteria 1104
51 Ga0075363_100296188 3300006048 Bacteria 938
52 Ga0075364_10143619 3300006051 Bacteria 1606
53 Ga0075364_10177054 3300006051 Bacteria 1443
54 Ga0075432_10008785 3300006058 Bacteria 3447
55 Ga0075432_10180657 3300006058 Bacteria 825
56 Ga0070715_10033756 3300006163 Bacteria 2094
57 Ga0070715_10125265 3300006163 Bacteria 1230
58 Ga0070716_100087497 3300006173 Bacteria 1877
59 Ga0070712_100023860 3300006175 Bacteria 4045
60 Ga0075370_10252695 3300006353 Bacteria 1045
61 Ga0068871_100425571 3300006358 Bacteria 1186
62 Ga0075436_100101982 3300006914 Bacteria 1999
63 Ga0075435_100109957 3300007076 Bacteria 2292
64 Ga0099794_10002724 3300007265 Bacteria 6587
65 Ga0099794_10060371 3300007265 Bacteria 1841
66 Ga0099795_10187977 3300007788 Bacteria 866
67 Ga0105251_10062978 3300009011 Bacteria 1741
68 Ga0105244_10003184 3300009036 Bacteria 11908
69 Ga0105244_10037103 3300009036 Bacteria 2549
70 Ga0105244_10188655 3300009036 Bacteria 975
71 Ga0111539_10115694 3300009094 Bacteria 3144
72 Ga0105243_10000162 3300009148 Bacteria 75904
73 Ga0105239_10951413 3300010375 Bacteria 987
74 Ga0105246_10000155 3300011119 Bacteria 32536
75 Ga0157345_1000143 3300012498 Bacteria 12901
76 Ga0157373_10003502 3300013100 Bacteria 11872
77 Ga0157373_10047355 3300013100 Bacteria 3067
78 Ga0157371_10003729 3300013102 Bacteria 13654
79 Ga0157370_10001776 3300013104 Bacteria 26607
80 Ga0157370_10032589 3300013104 Bacteria 5087
81 Ga0157370_10052312 3300013104 Bacteria 3899
82 Ga0157370_10121765 3300013104 Bacteria 2436
83 Ga0157369_10006367 3300013105 Bacteria 13695
84 Ga0157369_10007063 3300013105 Bacteria 12952
85 Ga0157369_10031677 3300013105 Bacteria 5819
86 Ga0163162_10001228 3300013306 Bacteria 23952
87 Ga0157372_10183550 3300013307 Bacteria 2422
88 Ga0157372_10281290 3300013307 Bacteria 1934
89 Ga0157375_10112993 3300013308 Bacteria 2817
90 Ga0163163_10542602 3300014325 Bacteria 1225
91 Ga0182008_10003253 3300014497 Bacteria 9911
92 Ga0182006_1002922 3300015261 Bacteria 9062
93 Ga0163161_10004436 3300017792 Bacteria 9780
94 Ga0163161_10050043 3300017792 Bacteria 3022
95 Ga0163161_10472340 3300017792 Bacteria 1017
96 Ga0209148_1009265 3300025254 Bacteria 1927
97 Ga0209675_1017541 3300025291 Bacteria 2042
98 Ga0209676_1000016 3300025292 Bacteria 655561
99 Ga0209676_1000021 3300025292 Bacteria 609534
100 Ga0209676_1000033 3300025292 Bacteria 463236
101 Ga0209676_1000084 3300025292 Bacteria 274330
102 Ga0209676_1000259 3300025292 Bacteria 111746
103 Ga0209676_1000678 3300025292 Bacteria 48300
104 Ga0209676_1032689 3300025292 Bacteria 1561
105 Ga0209676_1044287 3300025292 Bacteria 1221
106 Ga0209025_1010159 3300025294 Bacteria 6422
107 Ga0209025_1097914 3300025294 Bacteria 938
108 Ga0209050_1000036 3300025298 Bacteria 423070
109 Ga0209050_1000104 3300025298 Bacteria 228921
110 Ga0209050_1000107 3300025298 Bacteria 223303
111 Ga0209051_1000043 3300025303 Bacteria 305473
112 Ga0209051_1000090 3300025303 Bacteria 173748
113 Ga0209257_1000098 3300025304 Bacteria 256390
114 Ga0209257_1000120 3300025304 Bacteria 223025
115 Ga0209257_1000174 3300025304 Bacteria 165255
116 Ga0209257_1005689 3300025304 Bacteria 8578
117 Ga0207696_1003232 3300025711 Bacteria 7518
118 Ga0207696_1012217 3300025711 Bacteria 3045
119 Ga0207655_1000297 3300025728 Bacteria 75120
120 Ga0207655_1005351 3300025728 Bacteria 8757
121 Ga0207655_1005951 3300025728 Bacteria 8173
122 Ga0207713_1000904 3300025735 Bacteria 26862
123 Ga0207684_10061541 3300025910 Bacteria 3188
124 Ga0207684_10159060 3300025910 Bacteria 1945
125 Ga0207693_10029957 3300025915 Bacteria 4295
126 Ga0207663_10515519 3300025916 Bacteria 930
127 Ga0207660_10106363 3300025917 Bacteria 2104
128 Ga0207652_10211914 3300025921 Bacteria 1744
129 Ga0207646_10075203 3300025922 Bacteria 3018
130 Ga0207681_10010392 3300025923 Bacteria 5696
131 Ga0207681_10516310 3300025923 Bacteria 980
132 Ga0207690_10013933 3300025932 Bacteria 4845
133 Ga0207706_10128430 3300025933 Bacteria 2229
134 Ga0207706_10422077 3300025933 Bacteria 1155
135 Ga0207709_10000053 3300025935 Bacteria 225514
136 Ga0207670_10020423 3300025936 Bacteria 4070
137 Ga0207665_10412055 3300025939 Bacteria 1031
138 Ga0207667_10339602 3300025949 Bacteria 1533
139 Ga0207703_10091429 3300026035 Bacteria 2559
140 Ga0207702_10098651 3300026078 Bacteria 2574
141 Ga0207674_10242343 3300026116 Bacteria 1750
142 Ga0207683_10068188 3300026121 Bacteria 3139
143 Ga0209281_1017534 3300027111 Bacteria 1449
144 Ga0209588_1011457 3300027671 Bacteria 2679
145 Ga0207428_10744364 3300027907 Bacteria 699
146 Ga0268266_10040819 3300028379 Bacteria 3956
147 Ga0268264_10645307 3300028381 Bacteria 1047
148 Ga0268264_10743960 3300028381 Bacteria 976
149 Ga0307517_10125729 3300028786 Bacteria 1872
150 Ga0307511_10069438 3300030521 Bacteria 2590
151 Ga0316178_1074314 3300030735 Bacteria 21620
152 Ga0307513_10026909 3300031456 Bacteria 6616
153 Ga0307509_10154927 3300031507 Bacteria 2199
154 Ga0307408_100043286 3300031548 Bacteria 3203
155 Ga0307408_100062538 3300031548 Bacteria 2720
156 Ga0307408_100146097 3300031548 Bacteria 1861
157 Ga0307408_100339421 3300031548 Bacteria 1271
158 Ga0307408_100759601 3300031548 Bacteria 876
159 Ga0307408_100992266 3300031548 Bacteria 773
160 Ga0307516_10652995 3300031730 Bacteria 707
161 Ga0307405_10092853 3300031731 Bacteria 2003
162 Ga0307405_10238874 3300031731 Bacteria 1344
163 Ga0307405_10412334 3300031731 Bacteria 1061
164 Ga0307405_10462843 3300031731 Bacteria 1008
165 Ga0307413_10039463 3300031824 Bacteria 2746
166 Ga0307410_10130051 3300031852 Bacteria 1848
167 Ga0307410_10133193 3300031852 Bacteria 1828
168 Ga0307410_10632905 3300031852 Bacteria 895
169 Ga0307406_10039441 3300031901 Bacteria 2930
170 Ga0307406_10401992 3300031901 Bacteria 1086
171 Ga0307406_10702001 3300031901 Bacteria 845
172 Ga0307407_10042278 3300031903 Bacteria 2554
173 Ga0307412_10055008 3300031911 Bacteria 2645
174 Ga0307412_10072804 3300031911 Bacteria 2349
175 Ga0307412_10079840 3300031911 Bacteria 2258
176 Ga0307412_10114202 3300031911 Bacteria 1933
177 Ga0307412_10223493 3300031911 Bacteria 1445
178 Ga0307412_10435193 3300031911 Bacteria 1076
179 Ga0307412_10541563 3300031911 Bacteria 976
180 Ga0307412_10556179 3300031911 Bacteria 964
181 Ga0307412_11470721 3300031911 Bacteria 618
182 Ga0307409_101208841 3300031995 Bacteria 779
183 Ga0307416_100023954 3300032002 Bacteria 4443
184 Ga0307416_100197817 3300032002 Bacteria 1903
185 Ga0307416_100296603 3300032002 Bacteria 1604
186 Ga0307416_100455895 3300032002 Bacteria 1332
187 Ga0307416_100506890 3300032002 Bacteria 1272
188 Ga0307416_100652117 3300032002 Bacteria 1137
189 Ga0307414_10003389 3300032004 Bacteria 8514
190 Ga0307414_10005872 3300032004 Bacteria 6791
191 Ga0307414_10013889 3300032004 Bacteria 4809
192 Ga0307414_10060347 3300032004 Bacteria 2681
193 Ga0307414_10080013 3300032004 Bacteria 2388
194 Ga0307414_10085351 3300032004 Bacteria 2325
195 Ga0307414_10289001 3300032004 Bacteria 1381
196 Ga0307414_10402495 3300032004 Bacteria 1189
197 Ga0307414_10765296 3300032004 Bacteria 878
198 Ga0307411_10028057 3300032005 Bacteria 3416
199 Ga0307411_10065164 3300032005 Bacteria 2442
200 Ga0307411_10117242 3300032005 Bacteria 1918
201 Ga0307411_10558783 3300032005 Bacteria 977
202 Ga0307411_11069895 3300032005 Bacteria 725
203 Ga0307415_100165558 3300032126 Bacteria 1718
204 Ga0307510_10024905 3300033180 Bacteria 6908
205 Ga0307510_10046980 3300033180 Bacteria 4633
206 Ga0373956_0003525 3300035119 Bacteria 6302
207 Ga0373924_0398543 3300035410 Bacteria 615
208 Ga0373935_0524595 3300035692 Bacteria 862
209 Ga0373933_0031907 3300035724 Bacteria 3059
210 Ga0373937_0034048 3300036401 Bacteria 4631
211 Ga0395900_0135728 3300037418 Bacteria 2520
212 Ga0395905_0001480 3300037471 Bacteria 28107
213 Ga0395905_1103402 3300037471 Bacteria 697
214 Ga0237819_02368 3300038705 Bacteria 3841
215 Ga0400483_223733 3300039062 Bacteria 1201
216 Ga0436361_0763530 3300039447 Bacteria 2724
217 Ga0439438_000923 3300041405 Bacteria 13115
218 Ga0439438_001061 3300041405 Bacteria 12247
219 Ga0439438_010911 3300041405 Bacteria 2852
220 Ga0439447_003511 3300041407 Bacteria 5564
221 Ga0439447_045284 3300041407 Bacteria 1062
222 Ga0439466_0004829 3300041411 Bacteria 5181
223 Ga0439466_0031401 3300041411 Bacteria 1816
224 Ga0439466_0099333 3300041411 Bacteria 908
225 Ga0451789_0899180 3300041443 Bacteria 627
226 Ga0451841_0453392 3300041498 Bacteria 1455
227 Ga0439437_000022 3300042000 Bacteria 12184
228 Ga0439445_0084717 3300042004 Bacteria 888
229 Ga0439432_003835 3300042006 Bacteria 5543
230 Ga0439451_000492 3300042009 Bacteria 7623
231 Ga0439451_003515 3300042009 Bacteria 3178
232 Ga0439452_000228 3300042010 Bacteria 39646
233 Ga0439452_000887 3300042010 Bacteria 13768
234 Ga0439452_005669 3300042010 Bacteria 3996
235 Ga0439452_032686 3300042010 Bacteria 1269
236 Ga0439455_0121919 3300042012 Bacteria 731
237 Ga0439456_000846 3300042013 Bacteria 6187
238 Ga0439456_015178 3300042013 Bacteria 1608
239 Ga0439456_016896 3300042013 Bacteria 1528
240 Ga0439463_061554 3300042016 Bacteria 959
241 Ga0450911_000109 3300042115 Bacteria 34092
242 Ga0450911_000586 3300042115 Bacteria 11210
243 Ga0450911_000664 3300042115 Bacteria 10293
244 Ga0450911_001017 3300042115 Bacteria 7151
245 Ga0450911_018217 3300042115 Bacteria 922
246 Ga0450922_001334 3300042124 Bacteria 2435
247 Ga0450890_002436 3300042127 Bacteria 2561
248 Ga0450900_024871 3300042136 Bacteria 851
249 Ga0450902_002639 3300042137 Bacteria 2550
250 Ga0450902_012270 3300042137 Bacteria 1369
251 Ga0450902_020192 3300042137 Bacteria 1097
252 Ga0450903_002399 3300042138 Bacteria 3339
253 Ga0450904_000351 3300042139 Bacteria 9603
254 Ga0450904_004766 3300042139 Bacteria 1397
255 Ga0450906_000113 3300042145 Bacteria 14042
256 Ga0450906_007555 3300042145 Bacteria 2142
257 Ga0450907_034413 3300042146 Bacteria 864
258 Ga0450910_003593 3300042147 Bacteria 2064
259 Ga0450908_010450 3300042184 Bacteria 1712
260 Ga0450909_000292 3300042185 Bacteria 6160
261 Ga0439434_0034399 3300042435 Bacteria 1547
262 Ga0439464_0020000 3300042439 Bacteria 1831
263 Ga0450916_000745 3300042530 Bacteria 3003
264 Ga0450918_003338 3300042531 Bacteria 2983
265 Ga0450918_028788 3300042531 Bacteria 978
266 Ga0439440_0007444 3300042993 Bacteria 2224
267 Ga0466957_0579549 3300044842 Bacteria 784
268 Ga0451576_0499717 3300045051 Bacteria 1278
269 Ga0451576_1447878 3300045051 Bacteria 714
270 Ga0466967_0626043 3300045976 Bacteria 1063
271 Ga0495617_005747 3300046452 Bacteria 4380
272 Ga0495617_026777 3300046452 Bacteria 1941
273 Ga0495617_048235 3300046452 Bacteria 1417
274 Ga0495617_140815 3300046452 Bacteria 770
275 Ga0495617_141361 3300046452 Bacteria 768
276 Ga0495627_000294 3300046453 Bacteria 49457
277 Ga0495627_001723 3300046453 Bacteria 11931
278 Ga0495627_028962 3300046453 Bacteria 1765
279 Ga0495627_081888 3300046453 Bacteria 935
280 Ga0495592_0183625 3300046454 Bacteria 1423
281 Ga0495590_0001607 3300046457 Bacteria 9664
282 Ga0495590_0004330 3300046457 Bacteria 5738
283 Ga0495590_0064064 3300046457 Bacteria 1286
284 Ga0495590_0095853 3300046457 Bacteria 1052
285 Ga0495591_000264 3300046458 Bacteria 49787
286 Ga0495591_000779 3300046458 Bacteria 22757
287 Ga0495591_001542 3300046458 Bacteria 14133
288 Ga0495591_001583 3300046458 Bacteria 13825
289 Ga0495591_006851 3300046458 Bacteria 4949
290 Ga0495591_007918 3300046458 Bacteria 4430
291 Ga0495591_018875 3300046458 Bacteria 2326
292 Ga0495591_036133 3300046458 Bacteria 1440
293 Ga0495591_042273 3300046458 Bacteria 1289
294 Ga0495591_057609 3300046458 Bacteria 1041
295 Ga0495638_0004020 3300046460 Bacteria 11286
296 Ga0495638_0007343 3300046460 Bacteria 7910
297 Ga0495638_0017011 3300046460 Bacteria 4859
298 Ga0495638_0046463 3300046460 Bacteria 2727
299 Ga0495638_0063009 3300046460 Bacteria 2287
300 Ga0495638_0093210 3300046460 Bacteria 1811
301 Ga0495638_0209299 3300046460 Bacteria 1096
302 Ga0495650_0000252 3300046471 Bacteria 105475
303 Ga0495650_0004225 3300046471 Bacteria 9946
304 Ga0495650_0005746 3300046471 Bacteria 7922
305 Ga0495650_0006190 3300046471 Bacteria 7513
306 Ga0495650_0013627 3300046471 Bacteria 4287
307 Ga0495650_0017220 3300046471 Bacteria 3628
308 Ga0495650_0038328 3300046471 Bacteria 2077
309 Ga0495650_0113758 3300046471 Bacteria 1002
310 Ga0495605_0001812 3300046474 Bacteria 13680
311 Ga0495605_0003840 3300046474 Bacteria 8913
312 Ga0495605_0050564 3300046474 Bacteria 2027
313 Ga0495605_0111437 3300046474 Bacteria 1248
314 Ga0495605_0120391 3300046474 Bacteria 1190
315 Ga0495584_0003081 3300046491 Bacteria 9267
316 Ga0495584_0008042 3300046491 Bacteria 5482
317 Ga0495584_0011758 3300046491 Bacteria 4475
318 Ga0495584_0012361 3300046491 Bacteria 4357
319 Ga0495584_0016505 3300046491 Bacteria 3765
320 Ga0495584_0024704 3300046491 Bacteria 3047
321 Ga0495584_0039118 3300046491 Bacteria 2396
322 Ga0495584_0063013 3300046491 Bacteria 1863
323 Ga0495584_0092976 3300046491 Bacteria 1521
324 Ga0495584_0134190 3300046491 Bacteria 1256
325 Ga0495584_0258107 3300046491 Bacteria 886
326 Ga0495585_0001397 3300046492 Bacteria 19044
327 Ga0495585_0003265 3300046492 Bacteria 11043
328 Ga0495585_0003336 3300046492 Bacteria 10894
329 Ga0495585_0010127 3300046492 Bacteria 5631
330 Ga0495585_0014588 3300046492 Bacteria 4572
331 Ga0495585_0037032 3300046492 Bacteria 2748
332 Ga0495585_0057295 3300046492 Bacteria 2150
333 Ga0495585_0058935 3300046492 Bacteria 2117
334 Ga0495585_0218900 3300046492 Bacteria 961
335 Ga0495596_0000004 3300046500 Bacteria 163832
336 Ga0495596_0049580 3300046500 Bacteria 1646
337 Ga0495596_0114882 3300046500 Bacteria 1045
338 Ga0495607_0000234 3300046501 Bacteria 59488
339 Ga0495607_0002691 3300046501 Bacteria 14180
340 Ga0495607_0013818 3300046501 Bacteria 5276
341 Ga0495607_0017981 3300046501 Bacteria 4518
342 Ga0495607_0028312 3300046501 Bacteria 3459
343 Ga0495607_0032571 3300046501 Bacteria 3179
344 Ga0495607_0043439 3300046501 Bacteria 2657
345 Ga0495607_0072888 3300046501 Bacteria 1910
346 Ga0495607_0134096 3300046501 Bacteria 1284
347 Ga0495607_0188745 3300046501 Bacteria 1028
348 Ga0495607_0294622 3300046501 Bacteria 765
349 Ga0495607_0294634 3300046501 Bacteria 765
350 Ga0495583_0001199 3300046506 Bacteria 27850
351 Ga0495583_0004374 3300046506 Bacteria 10173
352 Ga0495583_0054324 3300046506 Bacteria 1814
353 Ga0495606_0000027 3300046507 Bacteria 253573
354 Ga0495606_0000167 3300046507 Bacteria 115739
355 Ga0495606_0000432 3300046507 Bacteria 69645
356 Ga0495606_0004330 3300046507 Bacteria 14273
357 Ga0495606_0004584 3300046507 Bacteria 13708
358 Ga0495606_0008054 3300046507 Bacteria 9247
359 Ga0495606_0031869 3300046507 Bacteria 3659
360 Ga0495606_0033966 3300046507 Bacteria 3508
361 Ga0495606_0037407 3300046507 Bacteria 3297
362 Ga0495606_0138700 3300046507 Bacteria 1438
363 Ga0495606_0169322 3300046507 Bacteria 1268
364 Ga0495606_0188470 3300046507 Bacteria 1184
365 Ga0495606_0221842 3300046507 Bacteria 1064
366 Ga0495606_0234503 3300046507 Bacteria 1026
367 Ga0495610_0001754 3300046512 Bacteria 18984
368 Ga0495610_0004292 3300046512 Bacteria 10605
369 Ga0495610_0005652 3300046512 Bacteria 8814
370 Ga0495610_0036818 3300046512 Bacteria 2497
371 Ga0495610_0037611 3300046512 Bacteria 2461
372 Ga0495610_0040776 3300046512 Bacteria 2336
373 Ga0495610_0042341 3300046512 Bacteria 2278
374 Ga0495610_0131779 3300046512 Bacteria 1084
375 Ga0495610_0232050 3300046512 Bacteria 740
376 Ga0495616_0002308 3300046513 Bacteria 12756
377 Ga0495616_0003473 3300046513 Bacteria 10080
378 Ga0495616_0010604 3300046513 Bacteria 5325
379 Ga0495616_0012448 3300046513 Bacteria 4829
380 Ga0495616_0018182 3300046513 Bacteria 3863
381 Ga0495620_0002095 3300046515 Bacteria 11596
382 Ga0495620_0003062 3300046515 Bacteria 9601
383 Ga0495620_0003879 3300046515 Bacteria 8530
384 Ga0495620_0004015 3300046515 Bacteria 8355
385 Ga0495620_0004328 3300046515 Bacteria 8024
386 Ga0495620_0062615 3300046515 Bacteria 1544
387 Ga0495631_0000149 3300046518 Bacteria 47491
388 Ga0495631_0002305 3300046518 Bacteria 10884
389 Ga0495631_0004457 3300046518 Bacteria 7459
390 Ga0495631_0076998 3300046518 Bacteria 1439
391 Ga0495631_0129927 3300046518 Bacteria 1082
392 Ga0495632_0030521 3300046519 Bacteria 2796
393 Ga0495632_0034500 3300046519 Bacteria 2588
394 Ga0495632_0036575 3300046519 Bacteria 2496
395 Ga0495632_0056595 3300046519 Bacteria 1916
396 Ga0495637_0000115 3300046520 Bacteria 58484
397 Ga0495637_0000654 3300046520 Bacteria 24163
398 Ga0495637_0001934 3300046520 Bacteria 11745
399 Ga0495637_0002446 3300046520 Bacteria 10261
400 Ga0495637_0004911 3300046520 Bacteria 6885
401 Ga0495637_0010206 3300046520 Bacteria 4551
402 Ga0495637_0010283 3300046520 Bacteria 4533
403 Ga0495637_0015761 3300046520 Bacteria 3541
404 Ga0495637_0021681 3300046520 Bacteria 2942
405 Ga0495637_0038394 3300046520 Bacteria 2073
406 Ga0495637_0055376 3300046520 Bacteria 1644
407 Ga0495637_0119874 3300046520 Bacteria 1013
408 Ga0495643_0000017 3300046522 Bacteria 313381
409 Ga0495643_0002097 3300046522 Bacteria 16505
410 Ga0495643_0002834 3300046522 Bacteria 13196
411 Ga0495643_0008137 3300046522 Bacteria 6675
412 Ga0495643_0012757 3300046522 Bacteria 5056
413 Ga0495643_0095018 3300046522 Bacteria 1534
414 Ga0495643_0210009 3300046522 Bacteria 929
415 Ga0495643_0210615 3300046522 Bacteria 928
416 Ga0495643_0212589 3300046522 Bacteria 922
417 Ga0495644_0005006 3300046523 Bacteria 5186
418 Ga0495644_0014553 3300046523 Bacteria 3012
419 Ga0495644_0042611 3300046523 Bacteria 1709
420 Ga0495648_0000984 3300046524 Bacteria 29405
421 Ga0495648_0002891 3300046524 Bacteria 15445
422 Ga0495648_0005805 3300046524 Bacteria 10172
423 Ga0495648_0007492 3300046524 Bacteria 8730
424 Ga0495648_0026103 3300046524 Bacteria 3938
425 Ga0495648_0045096 3300046524 Bacteria 2745
426 Ga0495648_0069100 3300046524 Bacteria 2057
427 Ga0495648_0076627 3300046524 Bacteria 1919
428 Ga0495648_0116778 3300046524 Bacteria 1441
429 Ga0495648_0169728 3300046524 Bacteria 1119
430 Ga0495642_0002441 3300046528 Bacteria 7567
431 Ga0495642_0236055 3300046528 Bacteria 799
432 Ga0495652_0659055 3300046529 Bacteria 708
433 Ga0495654_0000562 3300046530 Bacteria 29977
434 Ga0495654_0002377 3300046530 Bacteria 12142
435 Ga0495654_0003492 3300046530 Bacteria 9597
436 Ga0495654_0006522 3300046530 Bacteria 6617
437 Ga0495654_0007462 3300046530 Bacteria 6106
438 Ga0495654_0041327 3300046530 Bacteria 2293
439 Ga0495654_0098420 3300046530 Bacteria 1349
440 Ga0495654_0112840 3300046530 Bacteria 1238
441 Ga0495654_0119617 3300046530 Bacteria 1193
442 Ga0495654_0140797 3300046530 Bacteria 1075
443 Ga0495654_0183025 3300046530 Bacteria 906
444 Ga0495609_0000167 3300046538 Bacteria 68911
445 Ga0495609_0007889 3300046538 Bacteria 5261
446 Ga0495609_0010937 3300046538 Bacteria 4334
447 Ga0495609_0128818 3300046538 Bacteria 1084
448 Ga0495597_0003183 3300046542 Bacteria 9806
449 Ga0495597_0015167 3300046542 Bacteria 3650
450 Ga0495597_0076975 3300046542 Bacteria 1430
451 Ga0495622_0001087 3300046557 Bacteria 14206
452 Ga0495622_0005194 3300046557 Bacteria 6035
453 Ga0495622_0150388 3300046557 Bacteria 1054
454 Ga0495633_0001003 3300046558 Bacteria 23142
455 Ga0495633_0002568 3300046558 Bacteria 12719
456 Ga0495633_0333178 3300046558 Bacteria 688
457 Ga0495656_0359253 3300046615 Bacteria 756
458 Ga0495668_0000001 3300046616 Bacteria 1013420
459 Ga0495668_0000940 3300046616 Bacteria 32529
460 Ga0495668_0003395 3300046616 Bacteria 11971
461 Ga0495668_0023851 3300046616 Bacteria 3483
462 Ga0495668_0066858 3300046616 Bacteria 1977
463 Ga0495611_0000389 3300046648 Bacteria 27902
464 Ga0495611_0002128 3300046648 Bacteria 9264
465 Ga0495611_0100941 3300046648 Bacteria 1340
466 Ga0495611_0115178 3300046648 Bacteria 1252
467 Ga0495625_0000134 3300046660 Bacteria 115073
468 Ga0495625_0001920 3300046660 Bacteria 23504
469 Ga0495625_0011342 3300046660 Bacteria 7277
470 Ga0495625_0023743 3300046660 Bacteria 4680
471 Ga0495625_0041046 3300046660 Bacteria 3369
472 Ga0495625_0043260 3300046660 Bacteria 3267
473 Ga0495625_0093804 3300046660 Bacteria 2071
474 Ga0495625_0146097 3300046660 Bacteria 1592
475 Ga0495625_0174420 3300046660 Bacteria 1433
476 Ga0495625_0205310 3300046660 Bacteria 1298
477 Ga0495659_0022129 3300046664 Bacteria 2147
478 Ga0495661_0000088 3300046665 Bacteria 111782
479 Ga0495661_0008979 3300046665 Bacteria 6879
480 Ga0495661_0066139 3300046665 Bacteria 2128
481 Ga0495661_0071483 3300046665 Bacteria 2027
482 Ga0495661_0107480 3300046665 Bacteria 1560
483 Ga0495661_0149759 3300046665 Bacteria 1261
484 Ga0495661_0161533 3300046665 Bacteria 1202
485 Ga0495661_0187417 3300046665 Bacteria 1092
486 Ga0495661_0216117 3300046665 Bacteria 995
487 Ga0495661_0267606 3300046665 Bacteria 866
488 Ga0495588_0174771 3300046674 Bacteria 1135
489 Ga0495658_0070719 3300046683 Bacteria 2026
490 Ga0495658_0113516 3300046683 Bacteria 1631
491 Ga0495613_0149140 3300046689 Bacteria 1669
492 Ga0495670_0001008 3300046691 Bacteria 13684
493 Ga0495670_0001827 3300046691 Bacteria 10464
494 Ga0495670_0034921 3300046691 Bacteria 2505
495 Ga0495670_0125963 3300046691 Bacteria 1333
496 Ga0495671_0000415 3300046692 Bacteria 34078
497 Ga0495671_0008110 3300046692 Bacteria 5928
498 Ga0495671_0032798 3300046692 Bacteria 2649
499 Ga0495671_0038716 3300046692 Bacteria 2409
500 Ga0495671_0058186 3300046692 Bacteria 1912
501 Ga0495671_0101086 3300046692 Bacteria 1409
502 Ga0495671_0216479 3300046692 Bacteria 927
503 Ga0495649_0002749 3300046694 Bacteria 12244
504 Ga0495649_0003541 3300046694 Bacteria 10493
505 Ga0495649_0015332 3300046694 Bacteria 4363
506 Ga0495649_0024472 3300046694 Bacteria 3366
507 Ga0495649_0051679 3300046694 Bacteria 2228
508 Ga0495649_0073950 3300046694 Bacteria 1825
509 Ga0495649_0076099 3300046694 Bacteria 1797
510 Ga0495649_0091165 3300046694 Bacteria 1625
511 Ga0495649_0101904 3300046694 Bacteria 1525
512 Ga0495589_0001040 3300046794 Bacteria 16709
513 Ga0495589_0027780 3300046794 Bacteria 2859
514 Ga0495589_0039648 3300046794 Bacteria 2353
515 Ga0495589_0089435 3300046794 Bacteria 1495
516 Ga0495589_0140742 3300046794 Bacteria 1155
517 Ga0495589_0347368 3300046794 Bacteria 684
518 Ga0495660_0002844 3300046810 Bacteria 10874
519 Ga0495660_0031049 3300046810 Bacteria 3006
520 Ga0495660_0038328 3300046810 Bacteria 2664
521 Ga0495660_0042187 3300046810 Bacteria 2521
522 Ga0495660_0059247 3300046810 Bacteria 2060
523 Ga0495660_0067709 3300046810 Bacteria 1901
524 Ga0495660_0071356 3300046810 Bacteria 1841
525 Ga0495660_0078911 3300046810 Bacteria 1729
526 Ga0495660_0106128 3300046810 Bacteria 1439
527 Ga0495660_0126678 3300046810 Bacteria 1285
528 Ga0495660_0145568 3300046810 Bacteria 1174
529 Ga0495660_0146266 3300046810 Bacteria 1171
530 Ga0495660_0155903 3300046810 Bacteria 1124
531 Ga0495660_0176292 3300046810 Bacteria 1038
532 Ga0495581_0342779 3300047315 Bacteria 872
533 Ga0495604_0089291 3300047317 Bacteria 2291
534 Ga0495672_0003397 3300047320 Bacteria 13683
535 Ga0495672_0005137 3300047320 Bacteria 10445
536 Ga0495672_0110212 3300047320 Bacteria 1478
537 Ga0495672_0135188 3300047320 Bacteria 1293
538 Ga0495672_0195550 3300047320 Bacteria 1014
539 Ga0495672_0196093 3300047320 Bacteria 1012
540 Ga0495672_0222008 3300047320 Bacteria 932
541 Ga0495676_0000018 3300047321 Bacteria 178380
542 Ga0495676_0005024 3300047321 Bacteria 12131
543 Ga0495680_0061105 3300047322 Bacteria 2900
544 Ga0495683_0000217 3300047323 Bacteria 54243
545 Ga0495683_0045859 3300047323 Bacteria 2195
546 Ga0495683_0066167 3300047323 Bacteria 1781
547 Ga0495683_0242211 3300047323 Bacteria 795
548 Ga0495683_0244836 3300047323 Bacteria 789
549 Ga0495679_001426 3300047446 Bacteria 13611
550 Ga0495679_002236 3300047446 Bacteria 10052
551 Ga0495679_008371 3300047446 Bacteria 4211
552 Ga0495679_031744 3300047446 Bacteria 1701
553 Ga0495685_010530 3300047447 Bacteria 3103
554 Ga0495673_0001075 3300047469 Bacteria 23963
555 Ga0495673_0002192 3300047469 Bacteria 14155
556 Ga0495673_0003526 3300047469 Bacteria 10297
557 Ga0495673_0004319 3300047469 Bacteria 8948
558 Ga0495673_0007446 3300047469 Bacteria 6292
559 Ga0495673_0033062 3300047469 Bacteria 2404
560 Ga0495673_0056910 3300047469 Bacteria 1689
561 Ga0495673_0077146 3300047469 Bacteria 1388
562 Ga0495673_0212344 3300047469 Bacteria 719
563 Ga0495681_0003361 3300047470 Bacteria 11135
564 Ga0495681_0008798 3300047470 Bacteria 6286
565 Ga0495681_0009250 3300047470 Bacteria 6091
566 Ga0495681_0015123 3300047470 Bacteria 4379
567 Ga0495681_0018432 3300047470 Bacteria 3846
568 Ga0495681_0024628 3300047470 Bacteria 3163
569 Ga0495681_0033755 3300047470 Bacteria 2557
570 Ga0495681_0034021 3300047470 Bacteria 2543
571 Ga0495681_0055225 3300047470 Bacteria 1852
572 Ga0495681_0093808 3300047470 Bacteria 1321
573 Ga0495681_0099802 3300047470 Bacteria 1270
574 Ga0495686_0003379 3300047472 Bacteria 13896
575 Ga0495686_0007931 3300047472 Bacteria 7881
576 Ga0495686_0008555 3300047472 Bacteria 7497
577 Ga0495686_0266678 3300047472 Bacteria 956
578 Ga0495602_0008372 3300048088 Bacteria 10809
579 Ga0495626_0000172 3300048091 Bacteria 79971
580 Ga0495626_0000216 3300048091 Bacteria 68946
581 Ga0495626_0001853 3300048091 Bacteria 15869
582 Ga0495626_0007749 3300048091 Bacteria 5949
583 Ga0495626_0011815 3300048091 Bacteria 4599
584 Ga0495626_0064937 3300048091 Bacteria 1652
585 Ga0495626_0069190 3300048091 Bacteria 1590
586 Ga0495626_0075810 3300048091 Bacteria 1502
587 Ga0495626_0103034 3300048091 Bacteria 1242
588 Ga0496102_0020736 3300048905 Bacteria 5808
589 Ga0496102_0090487 3300048905 Bacteria 2832
590 Ga0496103_0337393 3300048906 Bacteria 969
591 Ga0496104_0306694 3300048907 Bacteria 1500
592 Ga0496106_0171427 3300048909 Bacteria 1720
593 Ga0496107_0282353 3300048910 Bacteria 1236
594 Ga0496108_0404994 3300048911 Bacteria 1191
595 Ga0496109_0023680 3300048912 Bacteria 5451
596 Ga0496109_0085340 3300048912 Bacteria 2914
597 Ga0496110_0016404 3300048913 Bacteria 6183
598 Ga0496112_0232886 3300048915 Bacteria 1796
599 Ga0496116_0000936 3300048919 Bacteria 35925
600 Ga0496116_0003902 3300048919 Bacteria 14533
601 Ga0496116_0193619 3300048919 Bacteria 1073
602 Ga0496118_0202442 3300048921 Bacteria 1174
603 Ga0496121_0008363 3300048924 Bacteria 12211
604 Ga0496121_0071244 3300048924 Bacteria 2796
605 Ga0496122_0034067 3300048925 Bacteria 4175
606 Ga0496123_0093014 3300048926 Bacteria 1782
607 Ga0496124_0020565 3300048927 Bacteria 6093
608 Ga0496124_0402695 3300048927 Bacteria 949
609 Ga0496125_0094321 3300048928 Bacteria 2230
610 Ga0496126_0568843 3300048929 Bacteria 897
611 Ga0496126_0663298 3300048929 Bacteria 815
612 Ga0495678_002211 3300049459 Bacteria 13640
613 Ga0495678_002245 3300049459 Bacteria 13452
614 Ga0495678_002671 3300049459 Bacteria 11803
615 Ga0495678_010990 3300049459 Bacteria 4357
616 Ga0495678_020457 3300049459 Bacteria 2929
617 Ga0495678_031180 3300049459 Bacteria 2225
618 Ga0495678_067754 3300049459 Bacteria 1317
619 Ga0495678_092940 3300049459 Bacteria 1058
620 Ga0495678_115754 3300049459 Bacteria 907
621 Ga0495682_0047811 3300049460 Bacteria 1560
622 Ga0501031_0108655 3300049568 Bacteria 1811
623 Ga0501032_0025564 3300049569 Bacteria 4069
624 Ga0501034_0108480 3300049571 Bacteria 2767
625 Ga0501036_0009156 3300049572 Bacteria 8141
626 Ga0501038_0017779 3300049574 Bacteria 6425
627 Ga0501039_0043147 3300049575 Bacteria 3484
628 Ga0501039_0158740 3300049575 Bacteria 1777
629 Ga0501043_0021833 3300049579 Bacteria 5020
630 Ga0501043_0099213 3300049579 Bacteria 2289
631 Ga0501046_0231046 3300049580 Bacteria 1367
632 Ga0501047_0000598 3300049581 Bacteria 38369
633 Ga0501048_0288221 3300049582 Bacteria 1168
634 Ga0501067_0009501 3300049583 Bacteria 5386
635 Ga0501068_0000042 3300049584 Bacteria 48007
636 Ga0501069_0005495 3300049585 Bacteria 6596
637 Ga0501070_0130393 3300049586 Bacteria 2077
638 Ga0501072_0000004 3300049588 Bacteria 282897
639 Ga0501073_0462574 3300049589 Bacteria 877
640 Ga0501074_0003700 3300049590 Bacteria 10839
641 Ga0501075_0572193 3300049591 Bacteria 862
642 Ga0501076_0005826 3300049592 Bacteria 8889
643 Ga0501077_0004746 3300049593 Bacteria 8264
644 Ga0501240_003085 3300049673 Bacteria 1827
645 Ga0501079_0011435 3300049741 Bacteria 6774
646 Ga0501080_0024373 3300049742 Bacteria 5608
647 Ga0501083_0004101 3300049744 Bacteria 10256
648 Ga0501241_004867 3300049758 Bacteria 2508
649 Ga0501262_017184 3300049759 Bacteria 963
650 Ga0501269_002261 3300049766 Bacteria 2390
651 Ga0501280_007577 3300049776 Bacteria 1517
652 Ga0501035_0127922 3300049822 Bacteria 2216
653 Ga0501035_0162760 3300049822 Bacteria 1931
654 Ga0501035_0807838 3300049822 Bacteria 749
655 Ga0501044_0032096 3300049823 Bacteria 5521
656 Ga0501226_000006 3300049853 Bacteria 259153
657 nmdc:mga00v17_441996_c1 3300050491 Bacteria 844
658 nmdc:mga0rr50_77931_c1 3300050513 Bacteria 2548
659 nmdc:mga08x19_509867_c1 3300050514 Bacteria 850
660 Ga0500572_001081 3300053111 Bacteria 8023
661 Ga0500592_005174 3300053116 Bacteria 2072
662 Ga0500595_026562 3300053119 Bacteria 1994
663 Ga0500568_0016977 3300053139 Bacteria 3222
664 Ga0500627_0000149 3300053158 Bacteria 20586
665 Ga0500649_155733 3300053722 Bacteria 812
666 Ga0501084_0000552 3300054114 Bacteria 28547
667 Ga0587083_0002115 3300059505 Bacteria 2408
668 Ga0587088_015475 3300059508 Bacteria 1202
669 Ga0587067_025154 3300059640 Bacteria 1057
670 Ga0501082_0015460 3300060353 Bacteria 6568
671 Ga0530510_0015841 3300061734 Bacteria 5330

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_0899180 Ga0451789_0899180_18_581 183
2 3300042016 Ga0439463_061554 Ga0439463_061554_372_944 183
3 3300046492 Ga0495585_0037032 Ga0495585_0037032_1527_2111 183
4 3300046501 Ga0495607_0028312 Ga0495607_0028312_2863_3438 183
5 3300046507 Ga0495606_0037407 Ga0495606_0037407_1607_2191 183
6 3300046515 Ga0495620_0062615 Ga0495620_0062615_26_592 183
7 3300046528 Ga0495642_0002441 Ga0495642_0002441_2830_3414 183
8 3300046615 Ga0495656_0359253 Ga0495656_0359253_141_725 183
9 3300046794 Ga0495589_0347368 Ga0495589_0347368_80_664 183
10 3300046810 Ga0495660_0059247 Ga0495660_0059247_1087_1671 183
11 3300046810 Ga0495660_0146266 Ga0495660_0146266_594_1157 183
12 3300047320 Ga0495672_0222008 Ga0495672_0222008_351_917 183
13 3300047323 Ga0495683_0242211 Ga0495683_0242211_132_716 183
14 3300049758 Ga0501241_004867 Ga0501241_004867_583_1146 183
15 3300049766 Ga0501269_002261 Ga0501269_002261_704_1267 183
16 3300005439 Ga0070711_100280486 Ga0070711_1002804862 184
17 3300006163 Ga0070715_10125265 Ga0070715_101252652 184
18 3300006173 Ga0070716_100087497 Ga0070716_1000874972 184
19 3300025916 Ga0207663_10515519 Ga0207663_105155192 184
20 3300025939 Ga0207665_10412055 Ga0207665_104120552 184
21 3300041498 Ga0451841_0453392 Ga0451841_0453392_64_645 184
22 3300046683 Ga0495658_0113516 Ga0495658_0113516_816_1385 184
23 3300049822 Ga0501035_0162760 Ga0501035_0162760_571_1143 185
24 3300045976 Ga0466967_0626043 Ga0466967_0626043_335_910 186
25 3300005445 Ga0070708_100194289 Ga0070708_1001942893 188
26 3300005467 Ga0070706_100316838 Ga0070706_1003168382 188
27 3300005518 Ga0070699_100038092 Ga0070699_1000380923 188
28 3300006914 Ga0075436_100101982 Ga0075436_1001019823 188
29 3300025910 Ga0207684_10159060 Ga0207684_101590602 188
30 3300044842 Ga0466957_0579549 Ga0466957_0579549_175_759 188
31 3300049759 Ga0501262_017184 Ga0501262_017184_47_625 188
32 iso_pu_bacteria 2511231004 2511252775 188
33 iso_pu_bacteria 2511231006 2511267592 188
34 iso_pu_bacteria 2511231007 2511271990 188
35 iso_pu_bacteria 2511231008 2511280220 188
36 iso_pu_bacteria 2511231010 2511292092 188
37 iso_pu_bacteria 2511231016 2511327117 188
38 iso_pu_bacteria 2511231021 2511354311 188
39 iso_pu_bacteria 2511231022 2511365247 188
40 iso_pu_bacteria 2511231023 2511371940 188
41 iso_pu_bacteria 2511231031 2511416178 188
42 iso_pu_bacteria 2512047018 2512324996 188
43 iso_pu_bacteria 2582580891 2583791120 188
44 iso_pu_bacteria 2597489887 2597856735 188
45 iso_pu_bacteria 2599185185 2599483758 188
46 iso_pu_bacteria 2600254931 2600365705 188
47 iso_pu_bacteria 2600255318 2601801138 188
48 iso_pu_bacteria 2603880185 2606073232 188
49 iso_pu_bacteria 2603880199 2606126107 188
50 iso_pu_bacteria 2623620443 2624479319 188
51 iso_pu_bacteria 2643221565 2643841853 188
52 iso_pu_bacteria 2643221585 2643934037 188
53 iso_pu_bacteria 2643221639 2644220106 188
54 iso_pu_bacteria 2643221646 2644261120 188
55 iso_pu_bacteria 2643221656 2644315524 188
56 iso_pu_bacteria 2713897148 2715751842 188
57 iso_pu_bacteria 2713897149 2715754890 188
58 iso_pu_bacteria 2718217725 2718633166 188
59 iso_pu_bacteria 2738541337 2739053277 188
60 iso_pu_bacteria 2738543020 2739285503 188
61 iso_pu_bacteria 2738543021 2739290816 188
62 iso_pu_bacteria 2738543025 2739314222 188
63 iso_pu_bacteria 2842805378 2842806915 188
64 iso_pu_bacteria 2842832357 2842832809 188
65 iso_pu_bacteria 2842843487 2842848105 188
66 iso_pu_bacteria 2878029506 2878031328 188
67 iso_pu_bacteria 2919063839 2919064203 188
68 iso_pu_bacteria 2919385768 2919386287 188
69 iso_pu_bacteria 2919456309 2919457225 188
70 iso_pu_bacteria 2919487758 2919491436 188
71 iso_pu_bacteria 2969304461 2969306096 188
72 iso_pu_bacteria 2974289157 2974292244 188
73 iso_pu_bacteria 2984286254 2984290861 188
74 iso_pu_bacteria 2998139840 2998141497 188
75 iso_pu_bacteria 3007395558 3007400718 188
76 iso_pu_bacteria 3007511990 3007512899 188
77 iso_pu_bacteria 3007614139 3007618925 188
78 iso_pu_bacteria 3007619802 3007620302 188
79 iso_pu_bacteria 3007718800 3007723176 188
80 iso_pu_bacteria 3007855910 3007856094 188
81 iso_pu_bacteria 3007861166 3007863263 188
82 iso_pu_bacteria 8011350971 8011352473 188
83 iso_pu_bacteria 8015687852 8015689396 188
84 iso_pu_bacteria 8029995093 8029999251 188
85 iso_pu_bacteria 8055770955 8055772532 188
86 iso_pu_bacteria 8056155041 8056156752 188
87 iso_pu_bacteria 8056166840 8056169489 188
88 iso_pu_bacteria 8056177738 8056181039 188
89 3300005536 Ga0070697_100236948 Ga0070697_1002369482 189
90 3300006048 Ga0075363_100296188 Ga0075363_1002961882 189
91 3300006353 Ga0075370_10252695 Ga0075370_102526952 189
92 3300006358 Ga0068871_100425571 Ga0068871_1004255712 189
93 3300010375 Ga0105239_10951413 Ga0105239_109514132 189
94 3300025254 Ga0209148_1009265 Ga0209148_10092652 189
95 3300042012 Ga0439455_0121919 Ga0439455_0121919_43_636 189
96 3300047315 Ga0495581_0342779 Ga0495581_0342779_242_826 189
97 3300047322 Ga0495680_0061105 Ga0495680_0061105_2122_2706 189
98 3300048929 Ga0496126_0663298 Ga0496126_0663298_201_794 189
99 3300053119 Ga0500595_026562 Ga0500595_026562_31_645 189
100 iso_pu_bacteria 2643221560 2643822856 189
101 iso_pu_bacteria 2643221563 2643832523 189
102 iso_pu_bacteria 2643221608 2644053682 189
103 iso_pu_bacteria 2852653556 2852654880 189
104 iso_pu_bacteria 2852680915 2852681418 189
105 iso_pu_bacteria 8056120720 8056122245 189
106 3300005444 Ga0070694_100134776 Ga0070694_1001347762 190
107 3300005545 Ga0070695_100275938 Ga0070695_1002759382 190
108 3300005546 Ga0070696_100145438 Ga0070696_1001454382 190
109 3300042137 Ga0450902_012270 Ga0450902_012270_610_1182 190
110 3300046453 Ga0495627_081888 Ga0495627_081888_338_910 190
111 3300046457 Ga0495590_0004330 Ga0495590_0004330_360_932 190
112 3300046458 Ga0495591_000264 Ga0495591_000264_36125_36697 190
113 3300046460 Ga0495638_0046463 Ga0495638_0046463_378_950 190
114 3300046471 Ga0495650_0005746 Ga0495650_0005746_6480_7052 190
115 3300046474 Ga0495605_0050564 Ga0495605_0050564_232_804 190
116 3300046491 Ga0495584_0012361 Ga0495584_0012361_3481_4053 190
117 3300046500 Ga0495596_0000004 Ga0495596_0000004_149466_150038 190
118 3300046501 Ga0495607_0294622 Ga0495607_0294622_104_676 190
119 3300046501 Ga0495607_0294634 Ga0495607_0294634_104_676 190
120 3300046507 Ga0495606_0033966 Ga0495606_0033966_1456_2028 190
121 3300046512 Ga0495610_0037611 Ga0495610_0037611_1224_1796 190
122 3300046515 Ga0495620_0004328 Ga0495620_0004328_6319_6891 190
123 3300046518 Ga0495631_0004457 Ga0495631_0004457_422_994 190
124 3300046519 Ga0495632_0056595 Ga0495632_0056595_128_700 190
125 3300046520 Ga0495637_0000654 Ga0495637_0000654_8091_8663 190
126 3300046522 Ga0495643_0012757 Ga0495643_0012757_1177_1749 190
127 3300046522 Ga0495643_0210009 Ga0495643_0210009_143_715 190
128 3300046523 Ga0495644_0005006 Ga0495644_0005006_3391_3963 190
129 3300046524 Ga0495648_0076627 Ga0495648_0076627_506_1078 190
130 3300046530 Ga0495654_0003492 Ga0495654_0003492_5292_5864 190
131 3300046542 Ga0495597_0015167 Ga0495597_0015167_1602_2174 190
132 3300046616 Ga0495668_0000940 Ga0495668_0000940_29973_30545 190
133 3300046660 Ga0495625_0011342 Ga0495625_0011342_1505_2077 190
134 3300046665 Ga0495661_0187417 Ga0495661_0187417_90_662 190
135 3300046692 Ga0495671_0216479 Ga0495671_0216479_124_696 190
136 3300046694 Ga0495649_0073950 Ga0495649_0073950_1217_1789 190
137 3300046794 Ga0495589_0089435 Ga0495589_0089435_232_804 190
138 3300046810 Ga0495660_0038328 Ga0495660_0038328_356_928 190
139 3300047320 Ga0495672_0196093 Ga0495672_0196093_206_778 190
140 3300047469 Ga0495673_0033062 Ga0495673_0033062_1709_2281 190
141 3300047470 Ga0495681_0024628 Ga0495681_0024628_2468_3040 190
142 3300048091 Ga0495626_0001853 Ga0495626_0001853_8558_9130 190
143 3300049459 Ga0495678_020457 Ga0495678_020457_2268_2840 190
144 3300049459 Ga0495678_115754 Ga0495678_115754_104_676 190
145 3300005329 Ga0070683_100226489 Ga0070683_1002264893 191
146 3300005331 Ga0070670_100341714 Ga0070670_1003417142 191
147 3300005436 Ga0070713_100283654 Ga0070713_1002836543 191
148 3300005468 Ga0070707_100164803 Ga0070707_1001648031 191
149 3300005530 Ga0070679_100215314 Ga0070679_1002153142 191
150 3300006163 Ga0070715_10033756 Ga0070715_100337562 191
151 3300007076 Ga0075435_100109957 Ga0075435_1001099573 191
152 3300007265 Ga0099794_10060371 Ga0099794_100603712 191
153 3300013307 Ga0157372_10183550 Ga0157372_101835501 191
154 3300025910 Ga0207684_10061541 Ga0207684_100615413 191
155 3300025921 Ga0207652_10211914 Ga0207652_102119143 191
156 3300025922 Ga0207646_10075203 Ga0207646_100752033 191
157 3300035119 Ga0373956_0003525 Ga0373956_0003525_2837_3424 191
158 3300035410 Ga0373924_0398543 Ga0373924_0398543_17_604 191
159 3300035692 Ga0373935_0524595 Ga0373935_0524595_244_831 191
160 3300035724 Ga0373933_0031907 Ga0373933_0031907_2437_3024 191
161 3300036401 Ga0373937_0034048 Ga0373937_0034048_1896_2483 191
162 3300037471 Ga0395905_1103402 Ga0395905_1103402_112_687 191
163 3300046528 Ga0495642_0236055 Ga0495642_0236055_41_637 191
164 3300046683 Ga0495658_0070719 Ga0495658_0070719_1106_1699 191
165 3300047447 Ga0495685_010530 Ga0495685_010530_786_1367 191
166 3300048905 Ga0496102_0020736 Ga0496102_0020736_3476_4081 191
167 3300048907 Ga0496104_0306694 Ga0496104_0306694_431_1036 191
168 3300048909 Ga0496106_0171427 Ga0496106_0171427_170_775 191
169 3300048910 Ga0496107_0282353 Ga0496107_0282353_601_1206 191
170 3300048911 Ga0496108_0404994 Ga0496108_0404994_294_899 191
171 3300048912 Ga0496109_0023680 Ga0496109_0023680_4552_5157 191
172 3300048912 Ga0496109_0085340 Ga0496109_0085340_213_818 191
173 3300048913 Ga0496110_0016404 Ga0496110_0016404_2223_2828 191
174 3300050513 nmdc:mga0rr50_77931_c1 nmdc:mga0rr50_77931_c1_450_1037 191
175 3300050514 nmdc:mga08x19_509867_c1 nmdc:mga08x19_509867_c1_257_835 191
176 iso_pu_bacteria 2643221603 2644026505 191
177 3300003322 rootL2_10012056 rootL2_1001205614 192
178 3300003323 rootH1_10020558 rootH1_100205585 192
179 3300003323 rootH1_10114129 rootH1_101141292 192
180 3300003781 Ga0055536_1000041 Ga0055536_100004148 192
181 3300003781 Ga0055536_1000042 Ga0055536_100004288 192
182 3300003781 Ga0055536_1004420 Ga0055536_10044202 192
183 3300003781 Ga0055536_1007529 Ga0055536_10075293 192
184 3300003791 Ga0055530_10000063 Ga0055530_1000006332 192
185 3300003791 Ga0055530_10000174 Ga0055530_1000017420 192
186 3300003791 Ga0055530_10000411 Ga0055530_1000041128 192
187 3300003791 Ga0055530_10002068 Ga0055530_100020689 192
188 3300003791 Ga0055530_10035526 Ga0055530_100355262 192
189 3300003792 Ga0055540_1000278 Ga0055540_100027831 192
190 3300003792 Ga0055540_1000318 Ga0055540_100031823 192
191 3300003794 Ga0055531_10000412 Ga0055531_1000041214 192
192 3300003794 Ga0055531_10001746 Ga0055531_1000174611 192
193 3300003794 Ga0055531_10014294 Ga0055531_100142944 192
194 3300005262 Ga0065165_1000806 Ga0065165_100080616 192
195 3300005288 Ga0065714_10067840 Ga0065714_100678404 192
196 3300005288 Ga0065714_10077559 Ga0065714_100775592 192
197 3300005288 Ga0065714_10091407 Ga0065714_100914073 192
198 3300005289 Ga0065704_10016922 Ga0065704_100169221 192
199 3300005329 Ga0070683_100080622 Ga0070683_1000806223 192
200 3300005340 Ga0070689_100029810 Ga0070689_1000298102 192
201 3300005353 Ga0070669_100045051 Ga0070669_1000450512 192
202 3300005353 Ga0070669_100136641 Ga0070669_1001366413 192
203 3300005366 Ga0070659_100052719 Ga0070659_1000527194 192
204 3300005456 Ga0070678_100175672 Ga0070678_1001756722 192
205 3300005457 Ga0070662_100781482 Ga0070662_1007814821 192
206 3300005458 Ga0070681_10068669 Ga0070681_100686692 192
207 3300005548 Ga0070665_100079480 Ga0070665_1000794801 192
208 3300005548 Ga0070665_100228216 Ga0070665_1002282162 192
209 3300005577 Ga0068857_100203152 Ga0068857_1002031522 192
210 3300005577 Ga0068857_100672582 Ga0068857_1006725822 192
211 3300005614 Ga0068856_100107692 Ga0068856_1001076922 192
212 3300005842 Ga0068858_100189143 Ga0068858_1001891432 192
213 3300005842 Ga0068858_100563001 Ga0068858_1005630012 192
214 3300006051 Ga0075364_10143619 Ga0075364_101436192 192
215 3300006051 Ga0075364_10177054 Ga0075364_101770543 192
216 3300006058 Ga0075432_10008785 Ga0075432_100087853 192
217 3300006058 Ga0075432_10180657 Ga0075432_101806572 192
218 3300006175 Ga0070712_100023860 Ga0070712_1000238602 192
219 3300007265 Ga0099794_10002724 Ga0099794_100027245 192
220 3300007788 Ga0099795_10187977 Ga0099795_101879771 192
221 3300009011 Ga0105251_10062978 Ga0105251_100629782 192
222 3300009036 Ga0105244_10003184 Ga0105244_100031845 192
223 3300009036 Ga0105244_10037103 Ga0105244_100371033 192
224 3300009036 Ga0105244_10188655 Ga0105244_101886552 192
225 3300009094 Ga0111539_10115694 Ga0111539_101156943 192
226 3300009148 Ga0105243_10000162 Ga0105243_1000016215 192
227 3300011119 Ga0105246_10000155 Ga0105246_1000015531 192
228 3300012498 Ga0157345_1000143 Ga0157345_10001438 192
229 3300013100 Ga0157373_10003502 Ga0157373_100035025 192
230 3300013100 Ga0157373_10047355 Ga0157373_100473552 192
231 3300013102 Ga0157371_10003729 Ga0157371_100037299 192
232 3300013104 Ga0157370_10001776 Ga0157370_100017769 192
233 3300013104 Ga0157370_10032589 Ga0157370_100325894 192
234 3300013104 Ga0157370_10052312 Ga0157370_100523124 192
235 3300013104 Ga0157370_10121765 Ga0157370_101217654 192
236 3300013105 Ga0157369_10006367 Ga0157369_100063677 192
237 3300013105 Ga0157369_10007063 Ga0157369_100070634 192
238 3300013105 Ga0157369_10031677 Ga0157369_100316773 192
239 3300013306 Ga0163162_10001228 Ga0163162_1000122815 192
240 3300013307 Ga0157372_10281290 Ga0157372_102812903 192
241 3300013308 Ga0157375_10112993 Ga0157375_101129932 192
242 3300014325 Ga0163163_10542602 Ga0163163_105426022 192
243 3300014497 Ga0182008_10003253 Ga0182008_100032538 192
244 3300015261 Ga0182006_1002922 Ga0182006_10029227 192
245 3300017792 Ga0163161_10004436 Ga0163161_100044368 192
246 3300017792 Ga0163161_10050043 Ga0163161_100500434 192
247 3300017792 Ga0163161_10472340 Ga0163161_104723402 192
248 3300025291 Ga0209675_1017541 Ga0209675_10175413 192
249 3300025292 Ga0209676_1000016 Ga0209676_1000016425 192
250 3300025292 Ga0209676_1000021 Ga0209676_1000021122 192
251 3300025292 Ga0209676_1000033 Ga0209676_1000033246 192
252 3300025292 Ga0209676_1000084 Ga0209676_1000084267 192
253 3300025292 Ga0209676_1000259 Ga0209676_100025983 192
254 3300025292 Ga0209676_1000678 Ga0209676_100067810 192
255 3300025292 Ga0209676_1032689 Ga0209676_10326892 192
256 3300025292 Ga0209676_1044287 Ga0209676_10442872 192
257 3300025294 Ga0209025_1010159 Ga0209025_10101598 192
258 3300025294 Ga0209025_1097914 Ga0209025_10979142 192
259 3300025298 Ga0209050_1000036 Ga0209050_1000036133 192
260 3300025298 Ga0209050_1000104 Ga0209050_1000104109 192
261 3300025298 Ga0209050_1000107 Ga0209050_1000107121 192
262 3300025303 Ga0209051_1000043 Ga0209051_1000043205 192
263 3300025303 Ga0209051_1000090 Ga0209051_100009035 192
264 3300025304 Ga0209257_1000098 Ga0209257_1000098108 192
265 3300025304 Ga0209257_1000120 Ga0209257_100012089 192
266 3300025304 Ga0209257_1000174 Ga0209257_1000174148 192
267 3300025304 Ga0209257_1005689 Ga0209257_10056893 192
268 3300025711 Ga0207696_1003232 Ga0207696_10032326 192
269 3300025711 Ga0207696_1012217 Ga0207696_10122173 192
270 3300025728 Ga0207655_1000297 Ga0207655_100029726 192
271 3300025728 Ga0207655_1005351 Ga0207655_10053517 192
272 3300025728 Ga0207655_1005951 Ga0207655_10059516 192
273 3300025735 Ga0207713_1000904 Ga0207713_100090414 192
274 3300025915 Ga0207693_10029957 Ga0207693_100299572 192
275 3300025917 Ga0207660_10106363 Ga0207660_101063632 192
276 3300025923 Ga0207681_10010392 Ga0207681_100103924 192
277 3300025923 Ga0207681_10516310 Ga0207681_105163102 192
278 3300025932 Ga0207690_10013933 Ga0207690_100139333 192
279 3300025933 Ga0207706_10128430 Ga0207706_101284302 192
280 3300025933 Ga0207706_10422077 Ga0207706_104220772 192
281 3300025935 Ga0207709_10000053 Ga0207709_1000005315 192
282 3300025936 Ga0207670_10020423 Ga0207670_100204232 192
283 3300025949 Ga0207667_10339602 Ga0207667_103396022 192
284 3300026035 Ga0207703_10091429 Ga0207703_100914292 192
285 3300026078 Ga0207702_10098651 Ga0207702_100986514 192
286 3300026116 Ga0207674_10242343 Ga0207674_102423433 192
287 3300026121 Ga0207683_10068188 Ga0207683_100681885 192
288 3300027111 Ga0209281_1017534 Ga0209281_10175343 192
289 3300027671 Ga0209588_1011457 Ga0209588_10114571 192
290 3300027907 Ga0207428_10744364 Ga0207428_107443641 192
291 3300028379 Ga0268266_10040819 Ga0268266_100408193 192
292 3300028381 Ga0268264_10645307 Ga0268264_106453072 192
293 3300028381 Ga0268264_10743960 Ga0268264_107439601 192
294 3300028786 Ga0307517_10125729 Ga0307517_101257292 192
295 3300030521 Ga0307511_10069438 Ga0307511_100694382 192
296 3300030735 Ga0316178_1074314 Ga0316178_107431413 192
297 3300031456 Ga0307513_10026909 Ga0307513_100269095 192
298 3300031507 Ga0307509_10154927 Ga0307509_101549273 192
299 3300031548 Ga0307408_100043286 Ga0307408_1000432864 192
300 3300031548 Ga0307408_100062538 Ga0307408_1000625384 192
301 3300031548 Ga0307408_100146097 Ga0307408_1001460973 192
302 3300031548 Ga0307408_100339421 Ga0307408_1003394211 192
303 3300031548 Ga0307408_100759601 Ga0307408_1007596012 192
304 3300031548 Ga0307408_100992266 Ga0307408_1009922661 192
305 3300031730 Ga0307516_10652995 Ga0307516_106529951 192
306 3300031731 Ga0307405_10092853 Ga0307405_100928533 192
307 3300031731 Ga0307405_10238874 Ga0307405_102388743 192
308 3300031731 Ga0307405_10412334 Ga0307405_104123342 192
309 3300031731 Ga0307405_10462843 Ga0307405_104628432 192
310 3300031824 Ga0307413_10039463 Ga0307413_100394632 192
311 3300031852 Ga0307410_10130051 Ga0307410_101300513 192
312 3300031852 Ga0307410_10133193 Ga0307410_101331932 192
313 3300031852 Ga0307410_10632905 Ga0307410_106329052 192
314 3300031901 Ga0307406_10039441 Ga0307406_100394412 192
315 3300031901 Ga0307406_10401992 Ga0307406_104019921 192
316 3300031901 Ga0307406_10702001 Ga0307406_107020012 192
317 3300031903 Ga0307407_10042278 Ga0307407_100422782 192
318 3300031911 Ga0307412_10055008 Ga0307412_100550082 192
319 3300031911 Ga0307412_10072804 Ga0307412_100728043 192
320 3300031911 Ga0307412_10079840 Ga0307412_100798402 192
321 3300031911 Ga0307412_10114202 Ga0307412_101142024 192
322 3300031911 Ga0307412_10223493 Ga0307412_102234932 192
323 3300031911 Ga0307412_10435193 Ga0307412_104351931 192
324 3300031911 Ga0307412_10541563 Ga0307412_105415631 192
325 3300031911 Ga0307412_10556179 Ga0307412_105561792 192
326 3300031911 Ga0307412_11470721 Ga0307412_114707211 192
327 3300031995 Ga0307409_101208841 Ga0307409_1012088411 192
328 3300032002 Ga0307416_100023954 Ga0307416_1000239543 192
329 3300032002 Ga0307416_100197817 Ga0307416_1001978172 192
330 3300032002 Ga0307416_100296603 Ga0307416_1002966032 192
331 3300032002 Ga0307416_100455895 Ga0307416_1004558951 192
332 3300032002 Ga0307416_100506890 Ga0307416_1005068902 192
333 3300032002 Ga0307416_100652117 Ga0307416_1006521172 192
334 3300032004 Ga0307414_10003389 Ga0307414_100033892 192
335 3300032004 Ga0307414_10005872 Ga0307414_1000587211 192
336 3300032004 Ga0307414_10013889 Ga0307414_100138894 192
337 3300032004 Ga0307414_10060347 Ga0307414_100603472 192
338 3300032004 Ga0307414_10080013 Ga0307414_100800132 192
339 3300032004 Ga0307414_10085351 Ga0307414_100853512 192
340 3300032004 Ga0307414_10289001 Ga0307414_102890013 192
341 3300032004 Ga0307414_10402495 Ga0307414_104024952 192
342 3300032004 Ga0307414_10765296 Ga0307414_107652962 192
343 3300032005 Ga0307411_10028057 Ga0307411_100280571 192
344 3300032005 Ga0307411_10065164 Ga0307411_100651642 192
345 3300032005 Ga0307411_10117242 Ga0307411_101172422 192
346 3300032005 Ga0307411_10558783 Ga0307411_105587832 192
347 3300032005 Ga0307411_11069895 Ga0307411_110698951 192
348 3300032126 Ga0307415_100165558 Ga0307415_1001655582 192
349 3300033180 Ga0307510_10024905 Ga0307510_100249057 192
350 3300033180 Ga0307510_10046980 Ga0307510_100469805 192
351 3300037418 Ga0395900_0135728 Ga0395900_0135728_673_1272 192
352 3300037471 Ga0395905_0001480 Ga0395905_0001480_7790_8368 192
353 3300038705 Ga0237819_02368 Ga0237819_02368_3181_3771 192
354 3300039062 Ga0400483_223733 Ga0400483_223733_93_689 192
355 3300039447 Ga0436361_0763530 Ga0436361_0763530_2083_2670 192
356 3300041405 Ga0439438_000923 Ga0439438_000923_11037_11627 192
357 3300041405 Ga0439438_001061 Ga0439438_001061_1489_2079 192
358 3300041405 Ga0439438_010911 Ga0439438_010911_715_1305 192
359 3300041407 Ga0439447_003511 Ga0439447_003511_4170_4760 192
360 3300041407 Ga0439447_045284 Ga0439447_045284_294_884 192
361 3300041411 Ga0439466_0004829 Ga0439466_0004829_4462_5052 192
362 3300041411 Ga0439466_0031401 Ga0439466_0031401_381_971 192
363 3300041411 Ga0439466_0099333 Ga0439466_0099333_192_782 192
364 3300042000 Ga0439437_000022 Ga0439437_000022_1697_2284 192
365 3300042004 Ga0439445_0084717 Ga0439445_0084717_103_693 192
366 3300042006 Ga0439432_003835 Ga0439432_003835_2797_3387 192
367 3300042009 Ga0439451_000492 Ga0439451_000492_6005_6595 192
368 3300042009 Ga0439451_003515 Ga0439451_003515_709_1299 192
369 3300042010 Ga0439452_000228 Ga0439452_000228_30945_31535 192
370 3300042010 Ga0439452_000887 Ga0439452_000887_10904_11494 192
371 3300042010 Ga0439452_005669 Ga0439452_005669_72_662 192
372 3300042010 Ga0439452_032686 Ga0439452_032686_542_1132 192
373 3300042013 Ga0439456_000846 Ga0439456_000846_1308_1898 192
374 3300042013 Ga0439456_015178 Ga0439456_015178_87_677 192
375 3300042013 Ga0439456_016896 Ga0439456_016896_510_1097 192
376 3300042115 Ga0450911_000109 Ga0450911_000109_29439_30026 192
377 3300042115 Ga0450911_000586 Ga0450911_000586_9040_9630 192
378 3300042115 Ga0450911_000664 Ga0450911_000664_2717_3307 192
379 3300042115 Ga0450911_001017 Ga0450911_001017_1403_1993 192
380 3300042115 Ga0450911_018217 Ga0450911_018217_127_717 192
381 3300042124 Ga0450922_001334 Ga0450922_001334_13_603 192
382 3300042127 Ga0450890_002436 Ga0450890_002436_1755_2345 192
383 3300042136 Ga0450900_024871 Ga0450900_024871_77_667 192
384 3300042137 Ga0450902_002639 Ga0450902_002639_1044_1634 192
385 3300042137 Ga0450902_020192 Ga0450902_020192_415_1005 192
386 3300042138 Ga0450903_002399 Ga0450903_002399_576_1166 192
387 3300042139 Ga0450904_000351 Ga0450904_000351_8039_8626 192
388 3300042139 Ga0450904_004766 Ga0450904_004766_692_1282 192
389 3300042145 Ga0450906_000113 Ga0450906_000113_12612_13202 192
390 3300042145 Ga0450906_007555 Ga0450906_007555_1152_1742 192
391 3300042146 Ga0450907_034413 Ga0450907_034413_75_665 192
392 3300042147 Ga0450910_003593 Ga0450910_003593_957_1547 192
393 3300042184 Ga0450908_010450 Ga0450908_010450_424_1014 192
394 3300042185 Ga0450909_000292 Ga0450909_000292_1210_1800 192
395 3300042435 Ga0439434_0034399 Ga0439434_0034399_782_1372 192
396 3300042439 Ga0439464_0020000 Ga0439464_0020000_264_854 192
397 3300042530 Ga0450916_000745 Ga0450916_000745_1136_1723 192
398 3300042531 Ga0450918_003338 Ga0450918_003338_851_1441 192
399 3300042531 Ga0450918_028788 Ga0450918_028788_60_650 192
400 3300042993 Ga0439440_0007444 Ga0439440_0007444_1469_2059 192
401 3300045051 Ga0451576_0499717 Ga0451576_0499717_73_663 192
402 3300045051 Ga0451576_1447878 Ga0451576_1447878_60_668 192
403 3300046452 Ga0495617_005747 Ga0495617_005747_1979_2569 192
404 3300046452 Ga0495617_026777 Ga0495617_026777_1157_1747 192
405 3300046452 Ga0495617_048235 Ga0495617_048235_647_1237 192
406 3300046452 Ga0495617_140815 Ga0495617_140815_101_691 192
407 3300046452 Ga0495617_141361 Ga0495617_141361_123_713 192
408 3300046453 Ga0495627_000294 Ga0495627_000294_37446_38036 192
409 3300046453 Ga0495627_001723 Ga0495627_001723_9394_9984 192
410 3300046453 Ga0495627_028962 Ga0495627_028962_58_648 192
411 3300046454 Ga0495592_0183625 Ga0495592_0183625_721_1308 192
412 3300046457 Ga0495590_0001607 Ga0495590_0001607_8269_8859 192
413 3300046457 Ga0495590_0064064 Ga0495590_0064064_84_674 192
414 3300046457 Ga0495590_0095853 Ga0495590_0095853_305_895 192
415 3300046458 Ga0495591_000779 Ga0495591_000779_9164_9763 192
416 3300046458 Ga0495591_001542 Ga0495591_001542_2187_2777 192
417 3300046458 Ga0495591_001583 Ga0495591_001583_1946_2536 192
418 3300046458 Ga0495591_006851 Ga0495591_006851_3761_4351 192
419 3300046458 Ga0495591_007918 Ga0495591_007918_3250_3840 192
420 3300046458 Ga0495591_018875 Ga0495591_018875_1388_1978 192
421 3300046458 Ga0495591_036133 Ga0495591_036133_762_1352 192
422 3300046458 Ga0495591_042273 Ga0495591_042273_369_959 192
423 3300046458 Ga0495591_057609 Ga0495591_057609_392_982 192
424 3300046460 Ga0495638_0004020 Ga0495638_0004020_9029_9619 192
425 3300046460 Ga0495638_0007343 Ga0495638_0007343_416_1006 192
426 3300046460 Ga0495638_0017011 Ga0495638_0017011_2269_2859 192
427 3300046460 Ga0495638_0063009 Ga0495638_0063009_1604_2194 192
428 3300046460 Ga0495638_0093210 Ga0495638_0093210_184_774 192
429 3300046460 Ga0495638_0209299 Ga0495638_0209299_209_799 192
430 3300046471 Ga0495650_0000252 Ga0495650_0000252_8716_9315 192
431 3300046471 Ga0495650_0004225 Ga0495650_0004225_986_1576 192
432 3300046471 Ga0495650_0006190 Ga0495650_0006190_993_1583 192
433 3300046471 Ga0495650_0013627 Ga0495650_0013627_365_955 192
434 3300046471 Ga0495650_0017220 Ga0495650_0017220_1910_2500 192
435 3300046471 Ga0495650_0038328 Ga0495650_0038328_682_1272 192
436 3300046471 Ga0495650_0113758 Ga0495650_0113758_73_663 192
437 3300046474 Ga0495605_0001812 Ga0495605_0001812_1783_2373 192
438 3300046474 Ga0495605_0003840 Ga0495605_0003840_3761_4360 192
439 3300046474 Ga0495605_0111437 Ga0495605_0111437_397_987 192
440 3300046474 Ga0495605_0120391 Ga0495605_0120391_368_958 192
441 3300046491 Ga0495584_0003081 Ga0495584_0003081_6844_7434 192
442 3300046491 Ga0495584_0008042 Ga0495584_0008042_1213_1803 192
443 3300046491 Ga0495584_0011758 Ga0495584_0011758_2068_2658 192
444 3300046491 Ga0495584_0016505 Ga0495584_0016505_69_659 192
445 3300046491 Ga0495584_0024704 Ga0495584_0024704_1910_2500 192
446 3300046491 Ga0495584_0039118 Ga0495584_0039118_199_789 192
447 3300046491 Ga0495584_0063013 Ga0495584_0063013_25_624 192
448 3300046491 Ga0495584_0092976 Ga0495584_0092976_345_935 192
449 3300046491 Ga0495584_0134190 Ga0495584_0134190_137_727 192
450 3300046491 Ga0495584_0258107 Ga0495584_0258107_124_729 192
451 3300046492 Ga0495585_0001397 Ga0495585_0001397_10804_11394 192
452 3300046492 Ga0495585_0003265 Ga0495585_0003265_2416_3006 192
453 3300046492 Ga0495585_0003336 Ga0495585_0003336_1105_1704 192
454 3300046492 Ga0495585_0010127 Ga0495585_0010127_3494_4084 192
455 3300046492 Ga0495585_0014588 Ga0495585_0014588_578_1168 192
456 3300046492 Ga0495585_0057295 Ga0495585_0057295_1182_1772 192
457 3300046492 Ga0495585_0058935 Ga0495585_0058935_71_661 192
458 3300046492 Ga0495585_0218900 Ga0495585_0218900_293_883 192
459 3300046500 Ga0495596_0049580 Ga0495596_0049580_692_1294 192
460 3300046500 Ga0495596_0114882 Ga0495596_0114882_334_924 192
461 3300046501 Ga0495607_0000234 Ga0495607_0000234_1716_2321 192
462 3300046501 Ga0495607_0002691 Ga0495607_0002691_1786_2376 192
463 3300046501 Ga0495607_0013818 Ga0495607_0013818_1852_2442 192
464 3300046501 Ga0495607_0017981 Ga0495607_0017981_2764_3354 192
465 3300046501 Ga0495607_0032571 Ga0495607_0032571_245_844 192
466 3300046501 Ga0495607_0043439 Ga0495607_0043439_619_1209 192
467 3300046501 Ga0495607_0072888 Ga0495607_0072888_101_691 192
468 3300046501 Ga0495607_0134096 Ga0495607_0134096_347_937 192
469 3300046501 Ga0495607_0188745 Ga0495607_0188745_377_967 192
470 3300046506 Ga0495583_0001199 Ga0495583_0001199_15786_16385 192
471 3300046506 Ga0495583_0004374 Ga0495583_0004374_8425_9015 192
472 3300046506 Ga0495583_0054324 Ga0495583_0054324_646_1236 192
473 3300046507 Ga0495606_0000027 Ga0495606_0000027_235254_235838 192
474 3300046507 Ga0495606_0000167 Ga0495606_0000167_90555_91154 192
475 3300046507 Ga0495606_0000432 Ga0495606_0000432_29259_29858 192
476 3300046507 Ga0495606_0004330 Ga0495606_0004330_11074_11664 192
477 3300046507 Ga0495606_0004584 Ga0495606_0004584_2366_2956 192
478 3300046507 Ga0495606_0008054 Ga0495606_0008054_1642_2232 192
479 3300046507 Ga0495606_0031869 Ga0495606_0031869_275_865 192
480 3300046507 Ga0495606_0138700 Ga0495606_0138700_147_737 192
481 3300046507 Ga0495606_0169322 Ga0495606_0169322_247_837 192
482 3300046507 Ga0495606_0188470 Ga0495606_0188470_121_711 192
483 3300046507 Ga0495606_0221842 Ga0495606_0221842_110_700 192
484 3300046507 Ga0495606_0234503 Ga0495606_0234503_221_811 192
485 3300046512 Ga0495610_0001754 Ga0495610_0001754_11177_11767 192
486 3300046512 Ga0495610_0004292 Ga0495610_0004292_8130_8720 192
487 3300046512 Ga0495610_0005652 Ga0495610_0005652_1865_2455 192
488 3300046512 Ga0495610_0036818 Ga0495610_0036818_32_622 192
489 3300046512 Ga0495610_0040776 Ga0495610_0040776_1184_1774 192
490 3300046512 Ga0495610_0042341 Ga0495610_0042341_639_1238 192
491 3300046512 Ga0495610_0131779 Ga0495610_0131779_391_981 192
492 3300046512 Ga0495610_0232050 Ga0495610_0232050_110_700 192
493 3300046513 Ga0495616_0002308 Ga0495616_0002308_1164_1754 192
494 3300046513 Ga0495616_0003473 Ga0495616_0003473_7686_8276 192
495 3300046513 Ga0495616_0010604 Ga0495616_0010604_1344_1934 192
496 3300046513 Ga0495616_0012448 Ga0495616_0012448_1979_2569 192
497 3300046513 Ga0495616_0018182 Ga0495616_0018182_1292_1882 192
498 3300046515 Ga0495620_0002095 Ga0495620_0002095_1377_1982 192
499 3300046515 Ga0495620_0003062 Ga0495620_0003062_8892_9482 192
500 3300046515 Ga0495620_0003879 Ga0495620_0003879_6919_7509 192
501 3300046515 Ga0495620_0004015 Ga0495620_0004015_1371_1961 192
502 3300046518 Ga0495631_0000149 Ga0495631_0000149_24483_25073 192
503 3300046518 Ga0495631_0002305 Ga0495631_0002305_8215_8805 192
504 3300046518 Ga0495631_0076998 Ga0495631_0076998_530_1120 192
505 3300046518 Ga0495631_0129927 Ga0495631_0129927_86_676 192
506 3300046519 Ga0495632_0030521 Ga0495632_0030521_486_1076 192
507 3300046519 Ga0495632_0034500 Ga0495632_0034500_882_1481 192
508 3300046519 Ga0495632_0036575 Ga0495632_0036575_128_718 192
509 3300046520 Ga0495637_0000115 Ga0495637_0000115_5987_6586 192
510 3300046520 Ga0495637_0001934 Ga0495637_0001934_1124_1714 192
511 3300046520 Ga0495637_0002446 Ga0495637_0002446_2160_2750 192
512 3300046520 Ga0495637_0004911 Ga0495637_0004911_3056_3646 192
513 3300046520 Ga0495637_0010206 Ga0495637_0010206_3547_4137 192
514 3300046520 Ga0495637_0010283 Ga0495637_0010283_3496_4086 192
515 3300046520 Ga0495637_0015761 Ga0495637_0015761_845_1435 192
516 3300046520 Ga0495637_0021681 Ga0495637_0021681_1039_1629 192
517 3300046520 Ga0495637_0038394 Ga0495637_0038394_131_721 192
518 3300046520 Ga0495637_0055376 Ga0495637_0055376_468_1058 192
519 3300046520 Ga0495637_0119874 Ga0495637_0119874_349_939 192
520 3300046522 Ga0495643_0000017 Ga0495643_0000017_179859_180443 192
521 3300046522 Ga0495643_0002097 Ga0495643_0002097_1463_2095 192
522 3300046522 Ga0495643_0002834 Ga0495643_0002834_11214_11804 192
523 3300046522 Ga0495643_0008137 Ga0495643_0008137_3173_3772 192
524 3300046522 Ga0495643_0095018 Ga0495643_0095018_394_984 192
525 3300046522 Ga0495643_0210615 Ga0495643_0210615_26_616 192
526 3300046522 Ga0495643_0212589 Ga0495643_0212589_101_691 192
527 3300046523 Ga0495644_0014553 Ga0495644_0014553_847_1446 192
528 3300046523 Ga0495644_0042611 Ga0495644_0042611_31_621 192
529 3300046524 Ga0495648_0000984 Ga0495648_0000984_26845_27435 192
530 3300046524 Ga0495648_0002891 Ga0495648_0002891_13965_14564 192
531 3300046524 Ga0495648_0005805 Ga0495648_0005805_1670_2260 192
532 3300046524 Ga0495648_0007492 Ga0495648_0007492_8025_8615 192
533 3300046524 Ga0495648_0026103 Ga0495648_0026103_2889_3479 192
534 3300046524 Ga0495648_0045096 Ga0495648_0045096_407_997 192
535 3300046524 Ga0495648_0069100 Ga0495648_0069100_102_692 192
536 3300046524 Ga0495648_0116778 Ga0495648_0116778_471_1061 192
537 3300046524 Ga0495648_0169728 Ga0495648_0169728_499_1089 192
538 3300046529 Ga0495652_0659055 Ga0495652_0659055_61_648 192
539 3300046530 Ga0495654_0000562 Ga0495654_0000562_27212_27802 192
540 3300046530 Ga0495654_0002377 Ga0495654_0002377_3068_3658 192
541 3300046530 Ga0495654_0006522 Ga0495654_0006522_5808_6398 192
542 3300046530 Ga0495654_0007462 Ga0495654_0007462_1074_1673 192
543 3300046530 Ga0495654_0041327 Ga0495654_0041327_1366_1956 192
544 3300046530 Ga0495654_0098420 Ga0495654_0098420_646_1236 192
545 3300046530 Ga0495654_0112840 Ga0495654_0112840_507_1097 192
546 3300046530 Ga0495654_0119617 Ga0495654_0119617_361_951 192
547 3300046530 Ga0495654_0140797 Ga0495654_0140797_229_819 192
548 3300046530 Ga0495654_0183025 Ga0495654_0183025_111_701 192
549 3300046538 Ga0495609_0000167 Ga0495609_0000167_52875_53474 192
550 3300046538 Ga0495609_0007889 Ga0495609_0007889_432_1022 192
551 3300046538 Ga0495609_0010937 Ga0495609_0010937_407_997 192
552 3300046538 Ga0495609_0128818 Ga0495609_0128818_407_997 192
553 3300046542 Ga0495597_0003183 Ga0495597_0003183_1809_2399 192
554 3300046542 Ga0495597_0076975 Ga0495597_0076975_481_1071 192
555 3300046557 Ga0495622_0001087 Ga0495622_0001087_2115_2705 192
556 3300046557 Ga0495622_0005194 Ga0495622_0005194_32_631 192
557 3300046557 Ga0495622_0150388 Ga0495622_0150388_369_959 192
558 3300046558 Ga0495633_0001003 Ga0495633_0001003_2074_2664 192
559 3300046558 Ga0495633_0002568 Ga0495633_0002568_10357_10947 192
560 3300046558 Ga0495633_0333178 Ga0495633_0333178_83_673 192
561 3300046616 Ga0495668_0000001 Ga0495668_0000001_68179_68781 192
562 3300046616 Ga0495668_0003395 Ga0495668_0003395_8825_9415 192
563 3300046616 Ga0495668_0023851 Ga0495668_0023851_1805_2395 192
564 3300046616 Ga0495668_0066858 Ga0495668_0066858_959_1549 192
565 3300046648 Ga0495611_0000389 Ga0495611_0000389_11408_11998 192
566 3300046648 Ga0495611_0002128 Ga0495611_0002128_2675_3274 192
567 3300046648 Ga0495611_0100941 Ga0495611_0100941_256_846 192
568 3300046648 Ga0495611_0115178 Ga0495611_0115178_545_1135 192
569 3300046660 Ga0495625_0000134 Ga0495625_0000134_46189_46788 192
570 3300046660 Ga0495625_0001920 Ga0495625_0001920_16051_16653 192
571 3300046660 Ga0495625_0023743 Ga0495625_0023743_2086_2676 192
572 3300046660 Ga0495625_0041046 Ga0495625_0041046_2149_2739 192
573 3300046660 Ga0495625_0043260 Ga0495625_0043260_2238_2828 192
574 3300046660 Ga0495625_0093804 Ga0495625_0093804_274_864 192
575 3300046660 Ga0495625_0146097 Ga0495625_0146097_566_1156 192
576 3300046660 Ga0495625_0174420 Ga0495625_0174420_572_1162 192
577 3300046660 Ga0495625_0205310 Ga0495625_0205310_212_796 192
578 3300046664 Ga0495659_0022129 Ga0495659_0022129_1519_2109 192
579 3300046665 Ga0495661_0000088 Ga0495661_0000088_5991_6590 192
580 3300046665 Ga0495661_0008979 Ga0495661_0008979_2167_2757 192
581 3300046665 Ga0495661_0066139 Ga0495661_0066139_328_918 192
582 3300046665 Ga0495661_0071483 Ga0495661_0071483_166_756 192
583 3300046665 Ga0495661_0107480 Ga0495661_0107480_795_1385 192
584 3300046665 Ga0495661_0149759 Ga0495661_0149759_320_910 192
585 3300046665 Ga0495661_0161533 Ga0495661_0161533_81_671 192
586 3300046665 Ga0495661_0216117 Ga0495661_0216117_85_675 192
587 3300046665 Ga0495661_0267606 Ga0495661_0267606_243_833 192
588 3300046674 Ga0495588_0174771 Ga0495588_0174771_167_757 192
589 3300046689 Ga0495613_0149140 Ga0495613_0149140_539_1126 192
590 3300046691 Ga0495670_0001008 Ga0495670_0001008_11327_11917 192
591 3300046691 Ga0495670_0001827 Ga0495670_0001827_7271_7861 192
592 3300046691 Ga0495670_0034921 Ga0495670_0034921_76_666 192
593 3300046691 Ga0495670_0125963 Ga0495670_0125963_355_945 192
594 3300046692 Ga0495671_0000415 Ga0495671_0000415_24978_25568 192
595 3300046692 Ga0495671_0008110 Ga0495671_0008110_3773_4357 192
596 3300046692 Ga0495671_0032798 Ga0495671_0032798_81_671 192
597 3300046692 Ga0495671_0038716 Ga0495671_0038716_1718_2308 192
598 3300046692 Ga0495671_0058186 Ga0495671_0058186_911_1501 192
599 3300046692 Ga0495671_0101086 Ga0495671_0101086_78_668 192
600 3300046694 Ga0495649_0002749 Ga0495649_0002749_423_1013 192
601 3300046694 Ga0495649_0003541 Ga0495649_0003541_3092_3676 192
602 3300046694 Ga0495649_0015332 Ga0495649_0015332_432_1022 192
603 3300046694 Ga0495649_0024472 Ga0495649_0024472_922_1512 192
604 3300046694 Ga0495649_0051679 Ga0495649_0051679_429_1028 192
605 3300046694 Ga0495649_0076099 Ga0495649_0076099_919_1503 192
606 3300046694 Ga0495649_0091165 Ga0495649_0091165_302_892 192
607 3300046694 Ga0495649_0101904 Ga0495649_0101904_275_865 192
608 3300046794 Ga0495589_0001040 Ga0495589_0001040_11047_11637 192
609 3300046794 Ga0495589_0027780 Ga0495589_0027780_884_1474 192
610 3300046794 Ga0495589_0039648 Ga0495589_0039648_1252_1842 192
611 3300046794 Ga0495589_0140742 Ga0495589_0140742_64_654 192
612 3300046810 Ga0495660_0002844 Ga0495660_0002844_2315_2905 192
613 3300046810 Ga0495660_0031049 Ga0495660_0031049_1976_2566 192
614 3300046810 Ga0495660_0042187 Ga0495660_0042187_1623_2213 192
615 3300046810 Ga0495660_0067709 Ga0495660_0067709_659_1249 192
616 3300046810 Ga0495660_0071356 Ga0495660_0071356_444_1043 192
617 3300046810 Ga0495660_0078911 Ga0495660_0078911_420_1010 192
618 3300046810 Ga0495660_0106128 Ga0495660_0106128_776_1366 192
619 3300046810 Ga0495660_0126678 Ga0495660_0126678_609_1199 192
620 3300046810 Ga0495660_0145568 Ga0495660_0145568_370_960 192
621 3300046810 Ga0495660_0155903 Ga0495660_0155903_144_728 192
622 3300046810 Ga0495660_0176292 Ga0495660_0176292_103_693 192
623 3300047317 Ga0495604_0089291 Ga0495604_0089291_1301_1888 192
624 3300047320 Ga0495672_0003397 Ga0495672_0003397_8045_8635 192
625 3300047320 Ga0495672_0005137 Ga0495672_0005137_7653_8243 192
626 3300047320 Ga0495672_0110212 Ga0495672_0110212_489_1079 192
627 3300047320 Ga0495672_0135188 Ga0495672_0135188_406_996 192
628 3300047320 Ga0495672_0195550 Ga0495672_0195550_386_976 192
629 3300047321 Ga0495676_0000018 Ga0495676_0000018_69232_69831 192
630 3300047321 Ga0495676_0005024 Ga0495676_0005024_10133_10723 192
631 3300047323 Ga0495683_0000217 Ga0495683_0000217_16035_16625 192
632 3300047323 Ga0495683_0045859 Ga0495683_0045859_556_1146 192
633 3300047323 Ga0495683_0066167 Ga0495683_0066167_536_1126 192
634 3300047323 Ga0495683_0244836 Ga0495683_0244836_68_658 192
635 3300047446 Ga0495679_001426 Ga0495679_001426_11154_11744 192
636 3300047446 Ga0495679_002236 Ga0495679_002236_9357_9947 192
637 3300047446 Ga0495679_008371 Ga0495679_008371_1883_2473 192
638 3300047446 Ga0495679_031744 Ga0495679_031744_590_1180 192
639 3300047469 Ga0495673_0001075 Ga0495673_0001075_11662_12252 192
640 3300047469 Ga0495673_0002192 Ga0495673_0002192_11270_11860 192
641 3300047469 Ga0495673_0003526 Ga0495673_0003526_1817_2407 192
642 3300047469 Ga0495673_0004319 Ga0495673_0004319_93_683 192
643 3300047469 Ga0495673_0007446 Ga0495673_0007446_1033_1623 192
644 3300047469 Ga0495673_0056910 Ga0495673_0056910_530_1129 192
645 3300047469 Ga0495673_0077146 Ga0495673_0077146_384_974 192
646 3300047469 Ga0495673_0212344 Ga0495673_0212344_52_642 192
647 3300047470 Ga0495681_0003361 Ga0495681_0003361_8723_9313 192
648 3300047470 Ga0495681_0008798 Ga0495681_0008798_3720_4310 192
649 3300047470 Ga0495681_0009250 Ga0495681_0009250_2141_2731 192
650 3300047470 Ga0495681_0015123 Ga0495681_0015123_3561_4151 192
651 3300047470 Ga0495681_0018432 Ga0495681_0018432_2791_3390 192
652 3300047470 Ga0495681_0033755 Ga0495681_0033755_1865_2455 192
653 3300047470 Ga0495681_0034021 Ga0495681_0034021_639_1229 192
654 3300047470 Ga0495681_0055225 Ga0495681_0055225_546_1136 192
655 3300047470 Ga0495681_0093808 Ga0495681_0093808_339_929 192
656 3300047470 Ga0495681_0099802 Ga0495681_0099802_216_806 192
657 3300047472 Ga0495686_0003379 Ga0495686_0003379_11363_11953 192
658 3300047472 Ga0495686_0007931 Ga0495686_0007931_6424_7014 192
659 3300047472 Ga0495686_0008555 Ga0495686_0008555_2677_3276 192
660 3300047472 Ga0495686_0266678 Ga0495686_0266678_315_905 192
661 3300048088 Ga0495602_0008372 Ga0495602_0008372_1063_1653 192
662 3300048091 Ga0495626_0000172 Ga0495626_0000172_71118_71708 192
663 3300048091 Ga0495626_0000216 Ga0495626_0000216_15438_16037 192
664 3300048091 Ga0495626_0007749 Ga0495626_0007749_1966_2556 192
665 3300048091 Ga0495626_0011815 Ga0495626_0011815_1607_2197 192
666 3300048091 Ga0495626_0064937 Ga0495626_0064937_899_1489 192
667 3300048091 Ga0495626_0069190 Ga0495626_0069190_561_1151 192
668 3300048091 Ga0495626_0075810 Ga0495626_0075810_404_994 192
669 3300048091 Ga0495626_0103034 Ga0495626_0103034_489_1079 192
670 3300048905 Ga0496102_0090487 Ga0496102_0090487_794_1399 192
671 3300048906 Ga0496103_0337393 Ga0496103_0337393_131_736 192
672 3300048915 Ga0496112_0232886 Ga0496112_0232886_1185_1781 192
673 3300048919 Ga0496116_0000936 Ga0496116_0000936_1948_2538 192
674 3300048919 Ga0496116_0003902 Ga0496116_0003902_54_644 192
675 3300048919 Ga0496116_0193619 Ga0496116_0193619_186_791 192
676 3300048921 Ga0496118_0202442 Ga0496118_0202442_135_740 192
677 3300048924 Ga0496121_0008363 Ga0496121_0008363_5439_6044 192
678 3300048924 Ga0496121_0071244 Ga0496121_0071244_562_1152 192
679 3300048925 Ga0496122_0034067 Ga0496122_0034067_491_1096 192
680 3300048926 Ga0496123_0093014 Ga0496123_0093014_486_1091 192
681 3300048927 Ga0496124_0020565 Ga0496124_0020565_3524_4108 192
682 3300048927 Ga0496124_0402695 Ga0496124_0402695_301_891 192
683 3300048928 Ga0496125_0094321 Ga0496125_0094321_524_1114 192
684 3300048929 Ga0496126_0568843 Ga0496126_0568843_251_853 192
685 3300049459 Ga0495678_002211 Ga0495678_002211_1836_2426 192
686 3300049459 Ga0495678_002245 Ga0495678_002245_2215_2805 192
687 3300049459 Ga0495678_002671 Ga0495678_002671_2234_2824 192
688 3300049459 Ga0495678_010990 Ga0495678_010990_3181_3771 192
689 3300049459 Ga0495678_031180 Ga0495678_031180_1582_2172 192
690 3300049459 Ga0495678_067754 Ga0495678_067754_425_1015 192
691 3300049459 Ga0495678_092940 Ga0495678_092940_109_699 192
692 3300049460 Ga0495682_0047811 Ga0495682_0047811_907_1497 192
693 3300049568 Ga0501031_0108655 Ga0501031_0108655_765_1364 192
694 3300049569 Ga0501032_0025564 Ga0501032_0025564_599_1198 192
695 3300049571 Ga0501034_0108480 Ga0501034_0108480_1159_1758 192
696 3300049572 Ga0501036_0009156 Ga0501036_0009156_6339_6938 192
697 3300049574 Ga0501038_0017779 Ga0501038_0017779_748_1347 192
698 3300049575 Ga0501039_0043147 Ga0501039_0043147_981_1580 192
699 3300049575 Ga0501039_0158740 Ga0501039_0158740_638_1246 192
700 3300049579 Ga0501043_0021833 Ga0501043_0021833_3815_4423 192
701 3300049579 Ga0501043_0099213 Ga0501043_0099213_541_1140 192
702 3300049580 Ga0501046_0231046 Ga0501046_0231046_305_904 192
703 3300049581 Ga0501047_0000598 Ga0501047_0000598_30983_31591 192
704 3300049582 Ga0501048_0288221 Ga0501048_0288221_374_973 192
705 3300049583 Ga0501067_0009501 Ga0501067_0009501_44_652 192
706 3300049584 Ga0501068_0000042 Ga0501068_0000042_36757_37365 192
707 3300049585 Ga0501069_0005495 Ga0501069_0005495_4123_4731 192
708 3300049586 Ga0501070_0130393 Ga0501070_0130393_1317_1925 192
709 3300049588 Ga0501072_0000004 Ga0501072_0000004_138062_138670 192
710 3300049589 Ga0501073_0462574 Ga0501073_0462574_249_842 192
711 3300049590 Ga0501074_0003700 Ga0501074_0003700_9072_9680 192
712 3300049591 Ga0501075_0572193 Ga0501075_0572193_168_776 192
713 3300049592 Ga0501076_0005826 Ga0501076_0005826_4674_5282 192
714 3300049593 Ga0501077_0004746 Ga0501077_0004746_3700_4308 192
715 3300049673 Ga0501240_003085 Ga0501240_003085_1027_1617 192
716 3300049741 Ga0501079_0011435 Ga0501079_0011435_5276_5884 192
717 3300049742 Ga0501080_0024373 Ga0501080_0024373_4120_4728 192
718 3300049744 Ga0501083_0004101 Ga0501083_0004101_5925_6533 192
719 3300049776 Ga0501280_007577 Ga0501280_007577_150_752 192
720 3300049822 Ga0501035_0127922 Ga0501035_0127922_1345_1944 192
721 3300049822 Ga0501035_0807838 Ga0501035_0807838_103_693 192
722 3300049823 Ga0501044_0032096 Ga0501044_0032096_4385_4993 192
723 3300049853 Ga0501226_000006 Ga0501226_000006_168574_169161 192
724 3300050491 nmdc:mga00v17_441996_c1 nmdc:mga00v17_441996_c1_40_630 192
725 3300053111 Ga0500572_001081 Ga0500572_001081_5548_6138 192
726 3300053116 Ga0500592_005174 Ga0500592_005174_118_720 192
727 3300053139 Ga0500568_0016977 Ga0500568_0016977_1249_1851 192
728 3300053158 Ga0500627_0000149 Ga0500627_0000149_6724_7326 192
729 3300053722 Ga0500649_155733 Ga0500649_155733_102_692 192
730 3300054114 Ga0501084_0000552 Ga0501084_0000552_8683_9291 192
731 3300059505 Ga0587083_0002115 Ga0587083_0002115_988_1587 192
732 3300059508 Ga0587088_015475 Ga0587088_015475_201_800 192
733 3300059640 Ga0587067_025154 Ga0587067_025154_321_920 192
734 3300060353 Ga0501082_0015460 Ga0501082_0015460_3238_3846 192
735 3300061734 Ga0530510_0015841 Ga0530510_0015841_4343_4951 192

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly3.cif.gz_D x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8268 29 179
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.8191 29 180
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.819 29 179
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.8124 29 180
4mln-assembly2.cif.gz_B crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.7958 29 180
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7958 29 180 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6741 29 180 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5964 14 179 1.10.3210.10
af_P9WN29_336_562_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.5741 57 174 1.10.3090.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5737 22 184 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2E5TDX1-F1-model_v4 deleted 0.994 2 190
AF-A0A848QJA5-F1-model_v4 HD domain-containing protein 0.9938 1 186
AF-A0A2U0VKN6-F1-model_v4 deleted 0.9932 2 188
AF-A0A0K6HUR8-F1-model_v4 deleted 0.9921 1 191
AF-A0A7Y1TB96-F1-model_v4 HD domain-containing protein 0.9914 10 176

Feature Viewer

pLDDT pTM Quality
94.95 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map