F478231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 342 | 671 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0663298|Ga0496126_0663298_201_794 |
| Length | 197 |
| Sequence | MTTIRKALMETVRFTKMAEGTKEEYELLAARGAAFTVRLPDRILAALDELREGGDGYRVTRFEHSVQTATRAHRDGKDEEYVVMALVHDIGDGLAPYTHSEMIGAVLQPFVRPEIVWIARHHGAFQLYYYAHHYGRDRNVREAHRGHQWFDACAEFCEQYDQVSFDPDYDNLPIEHFQPMVRRVFGQPRYARPDGDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 2 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 3 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 4 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 5 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 6 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 7 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 8 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 9 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 10 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 11 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 12 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 13 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 14 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 15 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 16 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 17 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 18 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 19 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 20 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 21 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 22 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 23 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 24 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 25 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 26 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 27 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 28 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 29 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 30 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 31 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 32 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 33 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 34 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 35 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 36 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 37 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 38 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 39 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 40 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 41 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 42 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 43 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 44 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 45 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 46 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 47 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 48 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 49 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 50 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 51 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 52 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 53 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 54 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 55 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 56 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 57 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 58 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 59 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 60 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 152 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 153 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 178 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 179 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 180 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 181 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 182 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 183 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 185 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 186 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 187 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 188 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 189 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 190 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 191 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 192 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 193 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 194 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 195 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 196 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 197 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 198 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 199 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 200 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 201 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 202 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 203 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 204 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 205 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 206 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 207 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 208 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 209 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 280 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 325 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 326 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 329 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 336 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 337 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 338 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 339 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 340 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 341 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 342 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.88 |
| Metatranscriptomes | 0.41 |
| Isolates | 8.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.39 |
| Nodule | 1.5 |
| Rhizoplane | 2.31 |
| Rhizosphere | 83.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10012056 | 3300003322 | Bacteria | 13768 |
| 2 | rootH1_10020558 | 3300003323 | Bacteria | 3467 |
| 3 | rootH1_10114129 | 3300003323 | Bacteria | 1353 |
| 4 | Ga0055536_1000041 | 3300003781 | Bacteria | 127266 |
| 5 | Ga0055536_1000042 | 3300003781 | Bacteria | 125029 |
| 6 | Ga0055536_1004420 | 3300003781 | Bacteria | 7198 |
| 7 | Ga0055536_1007529 | 3300003781 | Bacteria | 4851 |
| 8 | Ga0055530_10000063 | 3300003791 | Bacteria | 94619 |
| 9 | Ga0055530_10000174 | 3300003791 | Bacteria | 58795 |
| 10 | Ga0055530_10000411 | 3300003791 | Bacteria | 38127 |
| 11 | Ga0055530_10002068 | 3300003791 | Bacteria | 13475 |
| 12 | Ga0055530_10035526 | 3300003791 | Bacteria | 1263 |
| 13 | Ga0055540_1000278 | 3300003792 | Bacteria | 45985 |
| 14 | Ga0055540_1000318 | 3300003792 | Bacteria | 42704 |
| 15 | Ga0055531_10000412 | 3300003794 | Bacteria | 41097 |
| 16 | Ga0055531_10001746 | 3300003794 | Bacteria | 15529 |
| 17 | Ga0055531_10014294 | 3300003794 | Bacteria | 3584 |
| 18 | Ga0065165_1000806 | 3300005262 | Bacteria | 41749 |
| 19 | Ga0065714_10067840 | 3300005288 | Bacteria | 5163 |
| 20 | Ga0065714_10077559 | 3300005288 | Bacteria | 2676 |
| 21 | Ga0065714_10091407 | 3300005288 | Bacteria | 1896 |
| 22 | Ga0065704_10016922 | 3300005289 | Bacteria | 2168 |
| 23 | Ga0070683_100080622 | 3300005329 | Bacteria | 3047 |
| 24 | Ga0070683_100226489 | 3300005329 | Bacteria | 1777 |
| 25 | Ga0070670_100341714 | 3300005331 | Bacteria | 1314 |
| 26 | Ga0070689_100029810 | 3300005340 | Bacteria | 4135 |
| 27 | Ga0070669_100045051 | 3300005353 | Bacteria | 3214 |
| 28 | Ga0070669_100136641 | 3300005353 | Bacteria | 1886 |
| 29 | Ga0070659_100052719 | 3300005366 | Bacteria | 3200 |
| 30 | Ga0070713_100283654 | 3300005436 | Bacteria | 1520 |
| 31 | Ga0070711_100280486 | 3300005439 | Bacteria | 1318 |
| 32 | Ga0070694_100134776 | 3300005444 | Bacteria | 1788 |
| 33 | Ga0070708_100194289 | 3300005445 | Bacteria | 1899 |
| 34 | Ga0070678_100175672 | 3300005456 | Bacteria | 1748 |
| 35 | Ga0070662_100781482 | 3300005457 | Bacteria | 811 |
| 36 | Ga0070681_10068669 | 3300005458 | Bacteria | 3511 |
| 37 | Ga0070706_100316838 | 3300005467 | Bacteria | 1455 |
| 38 | Ga0070707_100164803 | 3300005468 | Bacteria | 2160 |
| 39 | Ga0070699_100038092 | 3300005518 | Bacteria | 4164 |
| 40 | Ga0070679_100215314 | 3300005530 | Bacteria | 1883 |
| 41 | Ga0070697_100236948 | 3300005536 | Bacteria | 1558 |
| 42 | Ga0070695_100275938 | 3300005545 | Bacteria | 1233 |
| 43 | Ga0070696_100145438 | 3300005546 | Bacteria | 1736 |
| 44 | Ga0070665_100079480 | 3300005548 | Bacteria | 3285 |
| 45 | Ga0070665_100228216 | 3300005548 | Bacteria | 1862 |
| 46 | Ga0068857_100203152 | 3300005577 | Bacteria | 1806 |
| 47 | Ga0068857_100672582 | 3300005577 | Bacteria | 982 |
| 48 | Ga0068856_100107692 | 3300005614 | Bacteria | 2783 |
| 49 | Ga0068858_100189143 | 3300005842 | Bacteria | 1945 |
| 50 | Ga0068858_100563001 | 3300005842 | Bacteria | 1104 |
| 51 | Ga0075363_100296188 | 3300006048 | Bacteria | 938 |
| 52 | Ga0075364_10143619 | 3300006051 | Bacteria | 1606 |
| 53 | Ga0075364_10177054 | 3300006051 | Bacteria | 1443 |
| 54 | Ga0075432_10008785 | 3300006058 | Bacteria | 3447 |
| 55 | Ga0075432_10180657 | 3300006058 | Bacteria | 825 |
| 56 | Ga0070715_10033756 | 3300006163 | Bacteria | 2094 |
| 57 | Ga0070715_10125265 | 3300006163 | Bacteria | 1230 |
| 58 | Ga0070716_100087497 | 3300006173 | Bacteria | 1877 |
| 59 | Ga0070712_100023860 | 3300006175 | Bacteria | 4045 |
| 60 | Ga0075370_10252695 | 3300006353 | Bacteria | 1045 |
| 61 | Ga0068871_100425571 | 3300006358 | Bacteria | 1186 |
| 62 | Ga0075436_100101982 | 3300006914 | Bacteria | 1999 |
| 63 | Ga0075435_100109957 | 3300007076 | Bacteria | 2292 |
| 64 | Ga0099794_10002724 | 3300007265 | Bacteria | 6587 |
| 65 | Ga0099794_10060371 | 3300007265 | Bacteria | 1841 |
| 66 | Ga0099795_10187977 | 3300007788 | Bacteria | 866 |
| 67 | Ga0105251_10062978 | 3300009011 | Bacteria | 1741 |
| 68 | Ga0105244_10003184 | 3300009036 | Bacteria | 11908 |
| 69 | Ga0105244_10037103 | 3300009036 | Bacteria | 2549 |
| 70 | Ga0105244_10188655 | 3300009036 | Bacteria | 975 |
| 71 | Ga0111539_10115694 | 3300009094 | Bacteria | 3144 |
| 72 | Ga0105243_10000162 | 3300009148 | Bacteria | 75904 |
| 73 | Ga0105239_10951413 | 3300010375 | Bacteria | 987 |
| 74 | Ga0105246_10000155 | 3300011119 | Bacteria | 32536 |
| 75 | Ga0157345_1000143 | 3300012498 | Bacteria | 12901 |
| 76 | Ga0157373_10003502 | 3300013100 | Bacteria | 11872 |
| 77 | Ga0157373_10047355 | 3300013100 | Bacteria | 3067 |
| 78 | Ga0157371_10003729 | 3300013102 | Bacteria | 13654 |
| 79 | Ga0157370_10001776 | 3300013104 | Bacteria | 26607 |
| 80 | Ga0157370_10032589 | 3300013104 | Bacteria | 5087 |
| 81 | Ga0157370_10052312 | 3300013104 | Bacteria | 3899 |
| 82 | Ga0157370_10121765 | 3300013104 | Bacteria | 2436 |
| 83 | Ga0157369_10006367 | 3300013105 | Bacteria | 13695 |
| 84 | Ga0157369_10007063 | 3300013105 | Bacteria | 12952 |
| 85 | Ga0157369_10031677 | 3300013105 | Bacteria | 5819 |
| 86 | Ga0163162_10001228 | 3300013306 | Bacteria | 23952 |
| 87 | Ga0157372_10183550 | 3300013307 | Bacteria | 2422 |
| 88 | Ga0157372_10281290 | 3300013307 | Bacteria | 1934 |
| 89 | Ga0157375_10112993 | 3300013308 | Bacteria | 2817 |
| 90 | Ga0163163_10542602 | 3300014325 | Bacteria | 1225 |
| 91 | Ga0182008_10003253 | 3300014497 | Bacteria | 9911 |
| 92 | Ga0182006_1002922 | 3300015261 | Bacteria | 9062 |
| 93 | Ga0163161_10004436 | 3300017792 | Bacteria | 9780 |
| 94 | Ga0163161_10050043 | 3300017792 | Bacteria | 3022 |
| 95 | Ga0163161_10472340 | 3300017792 | Bacteria | 1017 |
| 96 | Ga0209148_1009265 | 3300025254 | Bacteria | 1927 |
| 97 | Ga0209675_1017541 | 3300025291 | Bacteria | 2042 |
| 98 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 99 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 100 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 101 | Ga0209676_1000084 | 3300025292 | Bacteria | 274330 |
| 102 | Ga0209676_1000259 | 3300025292 | Bacteria | 111746 |
| 103 | Ga0209676_1000678 | 3300025292 | Bacteria | 48300 |
| 104 | Ga0209676_1032689 | 3300025292 | Bacteria | 1561 |
| 105 | Ga0209676_1044287 | 3300025292 | Bacteria | 1221 |
| 106 | Ga0209025_1010159 | 3300025294 | Bacteria | 6422 |
| 107 | Ga0209025_1097914 | 3300025294 | Bacteria | 938 |
| 108 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 109 | Ga0209050_1000104 | 3300025298 | Bacteria | 228921 |
| 110 | Ga0209050_1000107 | 3300025298 | Bacteria | 223303 |
| 111 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 112 | Ga0209051_1000090 | 3300025303 | Bacteria | 173748 |
| 113 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 114 | Ga0209257_1000120 | 3300025304 | Bacteria | 223025 |
| 115 | Ga0209257_1000174 | 3300025304 | Bacteria | 165255 |
| 116 | Ga0209257_1005689 | 3300025304 | Bacteria | 8578 |
| 117 | Ga0207696_1003232 | 3300025711 | Bacteria | 7518 |
| 118 | Ga0207696_1012217 | 3300025711 | Bacteria | 3045 |
| 119 | Ga0207655_1000297 | 3300025728 | Bacteria | 75120 |
| 120 | Ga0207655_1005351 | 3300025728 | Bacteria | 8757 |
| 121 | Ga0207655_1005951 | 3300025728 | Bacteria | 8173 |
| 122 | Ga0207713_1000904 | 3300025735 | Bacteria | 26862 |
| 123 | Ga0207684_10061541 | 3300025910 | Bacteria | 3188 |
| 124 | Ga0207684_10159060 | 3300025910 | Bacteria | 1945 |
| 125 | Ga0207693_10029957 | 3300025915 | Bacteria | 4295 |
| 126 | Ga0207663_10515519 | 3300025916 | Bacteria | 930 |
| 127 | Ga0207660_10106363 | 3300025917 | Bacteria | 2104 |
| 128 | Ga0207652_10211914 | 3300025921 | Bacteria | 1744 |
| 129 | Ga0207646_10075203 | 3300025922 | Bacteria | 3018 |
| 130 | Ga0207681_10010392 | 3300025923 | Bacteria | 5696 |
| 131 | Ga0207681_10516310 | 3300025923 | Bacteria | 980 |
| 132 | Ga0207690_10013933 | 3300025932 | Bacteria | 4845 |
| 133 | Ga0207706_10128430 | 3300025933 | Bacteria | 2229 |
| 134 | Ga0207706_10422077 | 3300025933 | Bacteria | 1155 |
| 135 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 136 | Ga0207670_10020423 | 3300025936 | Bacteria | 4070 |
| 137 | Ga0207665_10412055 | 3300025939 | Bacteria | 1031 |
| 138 | Ga0207667_10339602 | 3300025949 | Bacteria | 1533 |
| 139 | Ga0207703_10091429 | 3300026035 | Bacteria | 2559 |
| 140 | Ga0207702_10098651 | 3300026078 | Bacteria | 2574 |
| 141 | Ga0207674_10242343 | 3300026116 | Bacteria | 1750 |
| 142 | Ga0207683_10068188 | 3300026121 | Bacteria | 3139 |
| 143 | Ga0209281_1017534 | 3300027111 | Bacteria | 1449 |
| 144 | Ga0209588_1011457 | 3300027671 | Bacteria | 2679 |
| 145 | Ga0207428_10744364 | 3300027907 | Bacteria | 699 |
| 146 | Ga0268266_10040819 | 3300028379 | Bacteria | 3956 |
| 147 | Ga0268264_10645307 | 3300028381 | Bacteria | 1047 |
| 148 | Ga0268264_10743960 | 3300028381 | Bacteria | 976 |
| 149 | Ga0307517_10125729 | 3300028786 | Bacteria | 1872 |
| 150 | Ga0307511_10069438 | 3300030521 | Bacteria | 2590 |
| 151 | Ga0316178_1074314 | 3300030735 | Bacteria | 21620 |
| 152 | Ga0307513_10026909 | 3300031456 | Bacteria | 6616 |
| 153 | Ga0307509_10154927 | 3300031507 | Bacteria | 2199 |
| 154 | Ga0307408_100043286 | 3300031548 | Bacteria | 3203 |
| 155 | Ga0307408_100062538 | 3300031548 | Bacteria | 2720 |
| 156 | Ga0307408_100146097 | 3300031548 | Bacteria | 1861 |
| 157 | Ga0307408_100339421 | 3300031548 | Bacteria | 1271 |
| 158 | Ga0307408_100759601 | 3300031548 | Bacteria | 876 |
| 159 | Ga0307408_100992266 | 3300031548 | Bacteria | 773 |
| 160 | Ga0307516_10652995 | 3300031730 | Bacteria | 707 |
| 161 | Ga0307405_10092853 | 3300031731 | Bacteria | 2003 |
| 162 | Ga0307405_10238874 | 3300031731 | Bacteria | 1344 |
| 163 | Ga0307405_10412334 | 3300031731 | Bacteria | 1061 |
| 164 | Ga0307405_10462843 | 3300031731 | Bacteria | 1008 |
| 165 | Ga0307413_10039463 | 3300031824 | Bacteria | 2746 |
| 166 | Ga0307410_10130051 | 3300031852 | Bacteria | 1848 |
| 167 | Ga0307410_10133193 | 3300031852 | Bacteria | 1828 |
| 168 | Ga0307410_10632905 | 3300031852 | Bacteria | 895 |
| 169 | Ga0307406_10039441 | 3300031901 | Bacteria | 2930 |
| 170 | Ga0307406_10401992 | 3300031901 | Bacteria | 1086 |
| 171 | Ga0307406_10702001 | 3300031901 | Bacteria | 845 |
| 172 | Ga0307407_10042278 | 3300031903 | Bacteria | 2554 |
| 173 | Ga0307412_10055008 | 3300031911 | Bacteria | 2645 |
| 174 | Ga0307412_10072804 | 3300031911 | Bacteria | 2349 |
| 175 | Ga0307412_10079840 | 3300031911 | Bacteria | 2258 |
| 176 | Ga0307412_10114202 | 3300031911 | Bacteria | 1933 |
| 177 | Ga0307412_10223493 | 3300031911 | Bacteria | 1445 |
| 178 | Ga0307412_10435193 | 3300031911 | Bacteria | 1076 |
| 179 | Ga0307412_10541563 | 3300031911 | Bacteria | 976 |
| 180 | Ga0307412_10556179 | 3300031911 | Bacteria | 964 |
| 181 | Ga0307412_11470721 | 3300031911 | Bacteria | 618 |
| 182 | Ga0307409_101208841 | 3300031995 | Bacteria | 779 |
| 183 | Ga0307416_100023954 | 3300032002 | Bacteria | 4443 |
| 184 | Ga0307416_100197817 | 3300032002 | Bacteria | 1903 |
| 185 | Ga0307416_100296603 | 3300032002 | Bacteria | 1604 |
| 186 | Ga0307416_100455895 | 3300032002 | Bacteria | 1332 |
| 187 | Ga0307416_100506890 | 3300032002 | Bacteria | 1272 |
| 188 | Ga0307416_100652117 | 3300032002 | Bacteria | 1137 |
| 189 | Ga0307414_10003389 | 3300032004 | Bacteria | 8514 |
| 190 | Ga0307414_10005872 | 3300032004 | Bacteria | 6791 |
| 191 | Ga0307414_10013889 | 3300032004 | Bacteria | 4809 |
| 192 | Ga0307414_10060347 | 3300032004 | Bacteria | 2681 |
| 193 | Ga0307414_10080013 | 3300032004 | Bacteria | 2388 |
| 194 | Ga0307414_10085351 | 3300032004 | Bacteria | 2325 |
| 195 | Ga0307414_10289001 | 3300032004 | Bacteria | 1381 |
| 196 | Ga0307414_10402495 | 3300032004 | Bacteria | 1189 |
| 197 | Ga0307414_10765296 | 3300032004 | Bacteria | 878 |
| 198 | Ga0307411_10028057 | 3300032005 | Bacteria | 3416 |
| 199 | Ga0307411_10065164 | 3300032005 | Bacteria | 2442 |
| 200 | Ga0307411_10117242 | 3300032005 | Bacteria | 1918 |
| 201 | Ga0307411_10558783 | 3300032005 | Bacteria | 977 |
| 202 | Ga0307411_11069895 | 3300032005 | Bacteria | 725 |
| 203 | Ga0307415_100165558 | 3300032126 | Bacteria | 1718 |
| 204 | Ga0307510_10024905 | 3300033180 | Bacteria | 6908 |
| 205 | Ga0307510_10046980 | 3300033180 | Bacteria | 4633 |
| 206 | Ga0373956_0003525 | 3300035119 | Bacteria | 6302 |
| 207 | Ga0373924_0398543 | 3300035410 | Bacteria | 615 |
| 208 | Ga0373935_0524595 | 3300035692 | Bacteria | 862 |
| 209 | Ga0373933_0031907 | 3300035724 | Bacteria | 3059 |
| 210 | Ga0373937_0034048 | 3300036401 | Bacteria | 4631 |
| 211 | Ga0395900_0135728 | 3300037418 | Bacteria | 2520 |
| 212 | Ga0395905_0001480 | 3300037471 | Bacteria | 28107 |
| 213 | Ga0395905_1103402 | 3300037471 | Bacteria | 697 |
| 214 | Ga0237819_02368 | 3300038705 | Bacteria | 3841 |
| 215 | Ga0400483_223733 | 3300039062 | Bacteria | 1201 |
| 216 | Ga0436361_0763530 | 3300039447 | Bacteria | 2724 |
| 217 | Ga0439438_000923 | 3300041405 | Bacteria | 13115 |
| 218 | Ga0439438_001061 | 3300041405 | Bacteria | 12247 |
| 219 | Ga0439438_010911 | 3300041405 | Bacteria | 2852 |
| 220 | Ga0439447_003511 | 3300041407 | Bacteria | 5564 |
| 221 | Ga0439447_045284 | 3300041407 | Bacteria | 1062 |
| 222 | Ga0439466_0004829 | 3300041411 | Bacteria | 5181 |
| 223 | Ga0439466_0031401 | 3300041411 | Bacteria | 1816 |
| 224 | Ga0439466_0099333 | 3300041411 | Bacteria | 908 |
| 225 | Ga0451789_0899180 | 3300041443 | Bacteria | 627 |
| 226 | Ga0451841_0453392 | 3300041498 | Bacteria | 1455 |
| 227 | Ga0439437_000022 | 3300042000 | Bacteria | 12184 |
| 228 | Ga0439445_0084717 | 3300042004 | Bacteria | 888 |
| 229 | Ga0439432_003835 | 3300042006 | Bacteria | 5543 |
| 230 | Ga0439451_000492 | 3300042009 | Bacteria | 7623 |
| 231 | Ga0439451_003515 | 3300042009 | Bacteria | 3178 |
| 232 | Ga0439452_000228 | 3300042010 | Bacteria | 39646 |
| 233 | Ga0439452_000887 | 3300042010 | Bacteria | 13768 |
| 234 | Ga0439452_005669 | 3300042010 | Bacteria | 3996 |
| 235 | Ga0439452_032686 | 3300042010 | Bacteria | 1269 |
| 236 | Ga0439455_0121919 | 3300042012 | Bacteria | 731 |
| 237 | Ga0439456_000846 | 3300042013 | Bacteria | 6187 |
| 238 | Ga0439456_015178 | 3300042013 | Bacteria | 1608 |
| 239 | Ga0439456_016896 | 3300042013 | Bacteria | 1528 |
| 240 | Ga0439463_061554 | 3300042016 | Bacteria | 959 |
| 241 | Ga0450911_000109 | 3300042115 | Bacteria | 34092 |
| 242 | Ga0450911_000586 | 3300042115 | Bacteria | 11210 |
| 243 | Ga0450911_000664 | 3300042115 | Bacteria | 10293 |
| 244 | Ga0450911_001017 | 3300042115 | Bacteria | 7151 |
| 245 | Ga0450911_018217 | 3300042115 | Bacteria | 922 |
| 246 | Ga0450922_001334 | 3300042124 | Bacteria | 2435 |
| 247 | Ga0450890_002436 | 3300042127 | Bacteria | 2561 |
| 248 | Ga0450900_024871 | 3300042136 | Bacteria | 851 |
| 249 | Ga0450902_002639 | 3300042137 | Bacteria | 2550 |
| 250 | Ga0450902_012270 | 3300042137 | Bacteria | 1369 |
| 251 | Ga0450902_020192 | 3300042137 | Bacteria | 1097 |
| 252 | Ga0450903_002399 | 3300042138 | Bacteria | 3339 |
| 253 | Ga0450904_000351 | 3300042139 | Bacteria | 9603 |
| 254 | Ga0450904_004766 | 3300042139 | Bacteria | 1397 |
| 255 | Ga0450906_000113 | 3300042145 | Bacteria | 14042 |
| 256 | Ga0450906_007555 | 3300042145 | Bacteria | 2142 |
| 257 | Ga0450907_034413 | 3300042146 | Bacteria | 864 |
| 258 | Ga0450910_003593 | 3300042147 | Bacteria | 2064 |
| 259 | Ga0450908_010450 | 3300042184 | Bacteria | 1712 |
| 260 | Ga0450909_000292 | 3300042185 | Bacteria | 6160 |
| 261 | Ga0439434_0034399 | 3300042435 | Bacteria | 1547 |
| 262 | Ga0439464_0020000 | 3300042439 | Bacteria | 1831 |
| 263 | Ga0450916_000745 | 3300042530 | Bacteria | 3003 |
| 264 | Ga0450918_003338 | 3300042531 | Bacteria | 2983 |
| 265 | Ga0450918_028788 | 3300042531 | Bacteria | 978 |
| 266 | Ga0439440_0007444 | 3300042993 | Bacteria | 2224 |
| 267 | Ga0466957_0579549 | 3300044842 | Bacteria | 784 |
| 268 | Ga0451576_0499717 | 3300045051 | Bacteria | 1278 |
| 269 | Ga0451576_1447878 | 3300045051 | Bacteria | 714 |
| 270 | Ga0466967_0626043 | 3300045976 | Bacteria | 1063 |
| 271 | Ga0495617_005747 | 3300046452 | Bacteria | 4380 |
| 272 | Ga0495617_026777 | 3300046452 | Bacteria | 1941 |
| 273 | Ga0495617_048235 | 3300046452 | Bacteria | 1417 |
| 274 | Ga0495617_140815 | 3300046452 | Bacteria | 770 |
| 275 | Ga0495617_141361 | 3300046452 | Bacteria | 768 |
| 276 | Ga0495627_000294 | 3300046453 | Bacteria | 49457 |
| 277 | Ga0495627_001723 | 3300046453 | Bacteria | 11931 |
| 278 | Ga0495627_028962 | 3300046453 | Bacteria | 1765 |
| 279 | Ga0495627_081888 | 3300046453 | Bacteria | 935 |
| 280 | Ga0495592_0183625 | 3300046454 | Bacteria | 1423 |
| 281 | Ga0495590_0001607 | 3300046457 | Bacteria | 9664 |
| 282 | Ga0495590_0004330 | 3300046457 | Bacteria | 5738 |
| 283 | Ga0495590_0064064 | 3300046457 | Bacteria | 1286 |
| 284 | Ga0495590_0095853 | 3300046457 | Bacteria | 1052 |
| 285 | Ga0495591_000264 | 3300046458 | Bacteria | 49787 |
| 286 | Ga0495591_000779 | 3300046458 | Bacteria | 22757 |
| 287 | Ga0495591_001542 | 3300046458 | Bacteria | 14133 |
| 288 | Ga0495591_001583 | 3300046458 | Bacteria | 13825 |
| 289 | Ga0495591_006851 | 3300046458 | Bacteria | 4949 |
| 290 | Ga0495591_007918 | 3300046458 | Bacteria | 4430 |
| 291 | Ga0495591_018875 | 3300046458 | Bacteria | 2326 |
| 292 | Ga0495591_036133 | 3300046458 | Bacteria | 1440 |
| 293 | Ga0495591_042273 | 3300046458 | Bacteria | 1289 |
| 294 | Ga0495591_057609 | 3300046458 | Bacteria | 1041 |
| 295 | Ga0495638_0004020 | 3300046460 | Bacteria | 11286 |
| 296 | Ga0495638_0007343 | 3300046460 | Bacteria | 7910 |
| 297 | Ga0495638_0017011 | 3300046460 | Bacteria | 4859 |
| 298 | Ga0495638_0046463 | 3300046460 | Bacteria | 2727 |
| 299 | Ga0495638_0063009 | 3300046460 | Bacteria | 2287 |
| 300 | Ga0495638_0093210 | 3300046460 | Bacteria | 1811 |
| 301 | Ga0495638_0209299 | 3300046460 | Bacteria | 1096 |
| 302 | Ga0495650_0000252 | 3300046471 | Bacteria | 105475 |
| 303 | Ga0495650_0004225 | 3300046471 | Bacteria | 9946 |
| 304 | Ga0495650_0005746 | 3300046471 | Bacteria | 7922 |
| 305 | Ga0495650_0006190 | 3300046471 | Bacteria | 7513 |
| 306 | Ga0495650_0013627 | 3300046471 | Bacteria | 4287 |
| 307 | Ga0495650_0017220 | 3300046471 | Bacteria | 3628 |
| 308 | Ga0495650_0038328 | 3300046471 | Bacteria | 2077 |
| 309 | Ga0495650_0113758 | 3300046471 | Bacteria | 1002 |
| 310 | Ga0495605_0001812 | 3300046474 | Bacteria | 13680 |
| 311 | Ga0495605_0003840 | 3300046474 | Bacteria | 8913 |
| 312 | Ga0495605_0050564 | 3300046474 | Bacteria | 2027 |
| 313 | Ga0495605_0111437 | 3300046474 | Bacteria | 1248 |
| 314 | Ga0495605_0120391 | 3300046474 | Bacteria | 1190 |
| 315 | Ga0495584_0003081 | 3300046491 | Bacteria | 9267 |
| 316 | Ga0495584_0008042 | 3300046491 | Bacteria | 5482 |
| 317 | Ga0495584_0011758 | 3300046491 | Bacteria | 4475 |
| 318 | Ga0495584_0012361 | 3300046491 | Bacteria | 4357 |
| 319 | Ga0495584_0016505 | 3300046491 | Bacteria | 3765 |
| 320 | Ga0495584_0024704 | 3300046491 | Bacteria | 3047 |
| 321 | Ga0495584_0039118 | 3300046491 | Bacteria | 2396 |
| 322 | Ga0495584_0063013 | 3300046491 | Bacteria | 1863 |
| 323 | Ga0495584_0092976 | 3300046491 | Bacteria | 1521 |
| 324 | Ga0495584_0134190 | 3300046491 | Bacteria | 1256 |
| 325 | Ga0495584_0258107 | 3300046491 | Bacteria | 886 |
| 326 | Ga0495585_0001397 | 3300046492 | Bacteria | 19044 |
| 327 | Ga0495585_0003265 | 3300046492 | Bacteria | 11043 |
| 328 | Ga0495585_0003336 | 3300046492 | Bacteria | 10894 |
| 329 | Ga0495585_0010127 | 3300046492 | Bacteria | 5631 |
| 330 | Ga0495585_0014588 | 3300046492 | Bacteria | 4572 |
| 331 | Ga0495585_0037032 | 3300046492 | Bacteria | 2748 |
| 332 | Ga0495585_0057295 | 3300046492 | Bacteria | 2150 |
| 333 | Ga0495585_0058935 | 3300046492 | Bacteria | 2117 |
| 334 | Ga0495585_0218900 | 3300046492 | Bacteria | 961 |
| 335 | Ga0495596_0000004 | 3300046500 | Bacteria | 163832 |
| 336 | Ga0495596_0049580 | 3300046500 | Bacteria | 1646 |
| 337 | Ga0495596_0114882 | 3300046500 | Bacteria | 1045 |
| 338 | Ga0495607_0000234 | 3300046501 | Bacteria | 59488 |
| 339 | Ga0495607_0002691 | 3300046501 | Bacteria | 14180 |
| 340 | Ga0495607_0013818 | 3300046501 | Bacteria | 5276 |
| 341 | Ga0495607_0017981 | 3300046501 | Bacteria | 4518 |
| 342 | Ga0495607_0028312 | 3300046501 | Bacteria | 3459 |
| 343 | Ga0495607_0032571 | 3300046501 | Bacteria | 3179 |
| 344 | Ga0495607_0043439 | 3300046501 | Bacteria | 2657 |
| 345 | Ga0495607_0072888 | 3300046501 | Bacteria | 1910 |
| 346 | Ga0495607_0134096 | 3300046501 | Bacteria | 1284 |
| 347 | Ga0495607_0188745 | 3300046501 | Bacteria | 1028 |
| 348 | Ga0495607_0294622 | 3300046501 | Bacteria | 765 |
| 349 | Ga0495607_0294634 | 3300046501 | Bacteria | 765 |
| 350 | Ga0495583_0001199 | 3300046506 | Bacteria | 27850 |
| 351 | Ga0495583_0004374 | 3300046506 | Bacteria | 10173 |
| 352 | Ga0495583_0054324 | 3300046506 | Bacteria | 1814 |
| 353 | Ga0495606_0000027 | 3300046507 | Bacteria | 253573 |
| 354 | Ga0495606_0000167 | 3300046507 | Bacteria | 115739 |
| 355 | Ga0495606_0000432 | 3300046507 | Bacteria | 69645 |
| 356 | Ga0495606_0004330 | 3300046507 | Bacteria | 14273 |
| 357 | Ga0495606_0004584 | 3300046507 | Bacteria | 13708 |
| 358 | Ga0495606_0008054 | 3300046507 | Bacteria | 9247 |
| 359 | Ga0495606_0031869 | 3300046507 | Bacteria | 3659 |
| 360 | Ga0495606_0033966 | 3300046507 | Bacteria | 3508 |
| 361 | Ga0495606_0037407 | 3300046507 | Bacteria | 3297 |
| 362 | Ga0495606_0138700 | 3300046507 | Bacteria | 1438 |
| 363 | Ga0495606_0169322 | 3300046507 | Bacteria | 1268 |
| 364 | Ga0495606_0188470 | 3300046507 | Bacteria | 1184 |
| 365 | Ga0495606_0221842 | 3300046507 | Bacteria | 1064 |
| 366 | Ga0495606_0234503 | 3300046507 | Bacteria | 1026 |
| 367 | Ga0495610_0001754 | 3300046512 | Bacteria | 18984 |
| 368 | Ga0495610_0004292 | 3300046512 | Bacteria | 10605 |
| 369 | Ga0495610_0005652 | 3300046512 | Bacteria | 8814 |
| 370 | Ga0495610_0036818 | 3300046512 | Bacteria | 2497 |
| 371 | Ga0495610_0037611 | 3300046512 | Bacteria | 2461 |
| 372 | Ga0495610_0040776 | 3300046512 | Bacteria | 2336 |
| 373 | Ga0495610_0042341 | 3300046512 | Bacteria | 2278 |
| 374 | Ga0495610_0131779 | 3300046512 | Bacteria | 1084 |
| 375 | Ga0495610_0232050 | 3300046512 | Bacteria | 740 |
| 376 | Ga0495616_0002308 | 3300046513 | Bacteria | 12756 |
| 377 | Ga0495616_0003473 | 3300046513 | Bacteria | 10080 |
| 378 | Ga0495616_0010604 | 3300046513 | Bacteria | 5325 |
| 379 | Ga0495616_0012448 | 3300046513 | Bacteria | 4829 |
| 380 | Ga0495616_0018182 | 3300046513 | Bacteria | 3863 |
| 381 | Ga0495620_0002095 | 3300046515 | Bacteria | 11596 |
| 382 | Ga0495620_0003062 | 3300046515 | Bacteria | 9601 |
| 383 | Ga0495620_0003879 | 3300046515 | Bacteria | 8530 |
| 384 | Ga0495620_0004015 | 3300046515 | Bacteria | 8355 |
| 385 | Ga0495620_0004328 | 3300046515 | Bacteria | 8024 |
| 386 | Ga0495620_0062615 | 3300046515 | Bacteria | 1544 |
| 387 | Ga0495631_0000149 | 3300046518 | Bacteria | 47491 |
| 388 | Ga0495631_0002305 | 3300046518 | Bacteria | 10884 |
| 389 | Ga0495631_0004457 | 3300046518 | Bacteria | 7459 |
| 390 | Ga0495631_0076998 | 3300046518 | Bacteria | 1439 |
| 391 | Ga0495631_0129927 | 3300046518 | Bacteria | 1082 |
| 392 | Ga0495632_0030521 | 3300046519 | Bacteria | 2796 |
| 393 | Ga0495632_0034500 | 3300046519 | Bacteria | 2588 |
| 394 | Ga0495632_0036575 | 3300046519 | Bacteria | 2496 |
| 395 | Ga0495632_0056595 | 3300046519 | Bacteria | 1916 |
| 396 | Ga0495637_0000115 | 3300046520 | Bacteria | 58484 |
| 397 | Ga0495637_0000654 | 3300046520 | Bacteria | 24163 |
| 398 | Ga0495637_0001934 | 3300046520 | Bacteria | 11745 |
| 399 | Ga0495637_0002446 | 3300046520 | Bacteria | 10261 |
| 400 | Ga0495637_0004911 | 3300046520 | Bacteria | 6885 |
| 401 | Ga0495637_0010206 | 3300046520 | Bacteria | 4551 |
| 402 | Ga0495637_0010283 | 3300046520 | Bacteria | 4533 |
| 403 | Ga0495637_0015761 | 3300046520 | Bacteria | 3541 |
| 404 | Ga0495637_0021681 | 3300046520 | Bacteria | 2942 |
| 405 | Ga0495637_0038394 | 3300046520 | Bacteria | 2073 |
| 406 | Ga0495637_0055376 | 3300046520 | Bacteria | 1644 |
| 407 | Ga0495637_0119874 | 3300046520 | Bacteria | 1013 |
| 408 | Ga0495643_0000017 | 3300046522 | Bacteria | 313381 |
| 409 | Ga0495643_0002097 | 3300046522 | Bacteria | 16505 |
| 410 | Ga0495643_0002834 | 3300046522 | Bacteria | 13196 |
| 411 | Ga0495643_0008137 | 3300046522 | Bacteria | 6675 |
| 412 | Ga0495643_0012757 | 3300046522 | Bacteria | 5056 |
| 413 | Ga0495643_0095018 | 3300046522 | Bacteria | 1534 |
| 414 | Ga0495643_0210009 | 3300046522 | Bacteria | 929 |
| 415 | Ga0495643_0210615 | 3300046522 | Bacteria | 928 |
| 416 | Ga0495643_0212589 | 3300046522 | Bacteria | 922 |
| 417 | Ga0495644_0005006 | 3300046523 | Bacteria | 5186 |
| 418 | Ga0495644_0014553 | 3300046523 | Bacteria | 3012 |
| 419 | Ga0495644_0042611 | 3300046523 | Bacteria | 1709 |
| 420 | Ga0495648_0000984 | 3300046524 | Bacteria | 29405 |
| 421 | Ga0495648_0002891 | 3300046524 | Bacteria | 15445 |
| 422 | Ga0495648_0005805 | 3300046524 | Bacteria | 10172 |
| 423 | Ga0495648_0007492 | 3300046524 | Bacteria | 8730 |
| 424 | Ga0495648_0026103 | 3300046524 | Bacteria | 3938 |
| 425 | Ga0495648_0045096 | 3300046524 | Bacteria | 2745 |
| 426 | Ga0495648_0069100 | 3300046524 | Bacteria | 2057 |
| 427 | Ga0495648_0076627 | 3300046524 | Bacteria | 1919 |
| 428 | Ga0495648_0116778 | 3300046524 | Bacteria | 1441 |
| 429 | Ga0495648_0169728 | 3300046524 | Bacteria | 1119 |
| 430 | Ga0495642_0002441 | 3300046528 | Bacteria | 7567 |
| 431 | Ga0495642_0236055 | 3300046528 | Bacteria | 799 |
| 432 | Ga0495652_0659055 | 3300046529 | Bacteria | 708 |
| 433 | Ga0495654_0000562 | 3300046530 | Bacteria | 29977 |
| 434 | Ga0495654_0002377 | 3300046530 | Bacteria | 12142 |
| 435 | Ga0495654_0003492 | 3300046530 | Bacteria | 9597 |
| 436 | Ga0495654_0006522 | 3300046530 | Bacteria | 6617 |
| 437 | Ga0495654_0007462 | 3300046530 | Bacteria | 6106 |
| 438 | Ga0495654_0041327 | 3300046530 | Bacteria | 2293 |
| 439 | Ga0495654_0098420 | 3300046530 | Bacteria | 1349 |
| 440 | Ga0495654_0112840 | 3300046530 | Bacteria | 1238 |
| 441 | Ga0495654_0119617 | 3300046530 | Bacteria | 1193 |
| 442 | Ga0495654_0140797 | 3300046530 | Bacteria | 1075 |
| 443 | Ga0495654_0183025 | 3300046530 | Bacteria | 906 |
| 444 | Ga0495609_0000167 | 3300046538 | Bacteria | 68911 |
| 445 | Ga0495609_0007889 | 3300046538 | Bacteria | 5261 |
| 446 | Ga0495609_0010937 | 3300046538 | Bacteria | 4334 |
| 447 | Ga0495609_0128818 | 3300046538 | Bacteria | 1084 |
| 448 | Ga0495597_0003183 | 3300046542 | Bacteria | 9806 |
| 449 | Ga0495597_0015167 | 3300046542 | Bacteria | 3650 |
| 450 | Ga0495597_0076975 | 3300046542 | Bacteria | 1430 |
| 451 | Ga0495622_0001087 | 3300046557 | Bacteria | 14206 |
| 452 | Ga0495622_0005194 | 3300046557 | Bacteria | 6035 |
| 453 | Ga0495622_0150388 | 3300046557 | Bacteria | 1054 |
| 454 | Ga0495633_0001003 | 3300046558 | Bacteria | 23142 |
| 455 | Ga0495633_0002568 | 3300046558 | Bacteria | 12719 |
| 456 | Ga0495633_0333178 | 3300046558 | Bacteria | 688 |
| 457 | Ga0495656_0359253 | 3300046615 | Bacteria | 756 |
| 458 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 459 | Ga0495668_0000940 | 3300046616 | Bacteria | 32529 |
| 460 | Ga0495668_0003395 | 3300046616 | Bacteria | 11971 |
| 461 | Ga0495668_0023851 | 3300046616 | Bacteria | 3483 |
| 462 | Ga0495668_0066858 | 3300046616 | Bacteria | 1977 |
| 463 | Ga0495611_0000389 | 3300046648 | Bacteria | 27902 |
| 464 | Ga0495611_0002128 | 3300046648 | Bacteria | 9264 |
| 465 | Ga0495611_0100941 | 3300046648 | Bacteria | 1340 |
| 466 | Ga0495611_0115178 | 3300046648 | Bacteria | 1252 |
| 467 | Ga0495625_0000134 | 3300046660 | Bacteria | 115073 |
| 468 | Ga0495625_0001920 | 3300046660 | Bacteria | 23504 |
| 469 | Ga0495625_0011342 | 3300046660 | Bacteria | 7277 |
| 470 | Ga0495625_0023743 | 3300046660 | Bacteria | 4680 |
| 471 | Ga0495625_0041046 | 3300046660 | Bacteria | 3369 |
| 472 | Ga0495625_0043260 | 3300046660 | Bacteria | 3267 |
| 473 | Ga0495625_0093804 | 3300046660 | Bacteria | 2071 |
| 474 | Ga0495625_0146097 | 3300046660 | Bacteria | 1592 |
| 475 | Ga0495625_0174420 | 3300046660 | Bacteria | 1433 |
| 476 | Ga0495625_0205310 | 3300046660 | Bacteria | 1298 |
| 477 | Ga0495659_0022129 | 3300046664 | Bacteria | 2147 |
| 478 | Ga0495661_0000088 | 3300046665 | Bacteria | 111782 |
| 479 | Ga0495661_0008979 | 3300046665 | Bacteria | 6879 |
| 480 | Ga0495661_0066139 | 3300046665 | Bacteria | 2128 |
| 481 | Ga0495661_0071483 | 3300046665 | Bacteria | 2027 |
| 482 | Ga0495661_0107480 | 3300046665 | Bacteria | 1560 |
| 483 | Ga0495661_0149759 | 3300046665 | Bacteria | 1261 |
| 484 | Ga0495661_0161533 | 3300046665 | Bacteria | 1202 |
| 485 | Ga0495661_0187417 | 3300046665 | Bacteria | 1092 |
| 486 | Ga0495661_0216117 | 3300046665 | Bacteria | 995 |
| 487 | Ga0495661_0267606 | 3300046665 | Bacteria | 866 |
| 488 | Ga0495588_0174771 | 3300046674 | Bacteria | 1135 |
| 489 | Ga0495658_0070719 | 3300046683 | Bacteria | 2026 |
| 490 | Ga0495658_0113516 | 3300046683 | Bacteria | 1631 |
| 491 | Ga0495613_0149140 | 3300046689 | Bacteria | 1669 |
| 492 | Ga0495670_0001008 | 3300046691 | Bacteria | 13684 |
| 493 | Ga0495670_0001827 | 3300046691 | Bacteria | 10464 |
| 494 | Ga0495670_0034921 | 3300046691 | Bacteria | 2505 |
| 495 | Ga0495670_0125963 | 3300046691 | Bacteria | 1333 |
| 496 | Ga0495671_0000415 | 3300046692 | Bacteria | 34078 |
| 497 | Ga0495671_0008110 | 3300046692 | Bacteria | 5928 |
| 498 | Ga0495671_0032798 | 3300046692 | Bacteria | 2649 |
| 499 | Ga0495671_0038716 | 3300046692 | Bacteria | 2409 |
| 500 | Ga0495671_0058186 | 3300046692 | Bacteria | 1912 |
| 501 | Ga0495671_0101086 | 3300046692 | Bacteria | 1409 |
| 502 | Ga0495671_0216479 | 3300046692 | Bacteria | 927 |
| 503 | Ga0495649_0002749 | 3300046694 | Bacteria | 12244 |
| 504 | Ga0495649_0003541 | 3300046694 | Bacteria | 10493 |
| 505 | Ga0495649_0015332 | 3300046694 | Bacteria | 4363 |
| 506 | Ga0495649_0024472 | 3300046694 | Bacteria | 3366 |
| 507 | Ga0495649_0051679 | 3300046694 | Bacteria | 2228 |
| 508 | Ga0495649_0073950 | 3300046694 | Bacteria | 1825 |
| 509 | Ga0495649_0076099 | 3300046694 | Bacteria | 1797 |
| 510 | Ga0495649_0091165 | 3300046694 | Bacteria | 1625 |
| 511 | Ga0495649_0101904 | 3300046694 | Bacteria | 1525 |
| 512 | Ga0495589_0001040 | 3300046794 | Bacteria | 16709 |
| 513 | Ga0495589_0027780 | 3300046794 | Bacteria | 2859 |
| 514 | Ga0495589_0039648 | 3300046794 | Bacteria | 2353 |
| 515 | Ga0495589_0089435 | 3300046794 | Bacteria | 1495 |
| 516 | Ga0495589_0140742 | 3300046794 | Bacteria | 1155 |
| 517 | Ga0495589_0347368 | 3300046794 | Bacteria | 684 |
| 518 | Ga0495660_0002844 | 3300046810 | Bacteria | 10874 |
| 519 | Ga0495660_0031049 | 3300046810 | Bacteria | 3006 |
| 520 | Ga0495660_0038328 | 3300046810 | Bacteria | 2664 |
| 521 | Ga0495660_0042187 | 3300046810 | Bacteria | 2521 |
| 522 | Ga0495660_0059247 | 3300046810 | Bacteria | 2060 |
| 523 | Ga0495660_0067709 | 3300046810 | Bacteria | 1901 |
| 524 | Ga0495660_0071356 | 3300046810 | Bacteria | 1841 |
| 525 | Ga0495660_0078911 | 3300046810 | Bacteria | 1729 |
| 526 | Ga0495660_0106128 | 3300046810 | Bacteria | 1439 |
| 527 | Ga0495660_0126678 | 3300046810 | Bacteria | 1285 |
| 528 | Ga0495660_0145568 | 3300046810 | Bacteria | 1174 |
| 529 | Ga0495660_0146266 | 3300046810 | Bacteria | 1171 |
| 530 | Ga0495660_0155903 | 3300046810 | Bacteria | 1124 |
| 531 | Ga0495660_0176292 | 3300046810 | Bacteria | 1038 |
| 532 | Ga0495581_0342779 | 3300047315 | Bacteria | 872 |
| 533 | Ga0495604_0089291 | 3300047317 | Bacteria | 2291 |
| 534 | Ga0495672_0003397 | 3300047320 | Bacteria | 13683 |
| 535 | Ga0495672_0005137 | 3300047320 | Bacteria | 10445 |
| 536 | Ga0495672_0110212 | 3300047320 | Bacteria | 1478 |
| 537 | Ga0495672_0135188 | 3300047320 | Bacteria | 1293 |
| 538 | Ga0495672_0195550 | 3300047320 | Bacteria | 1014 |
| 539 | Ga0495672_0196093 | 3300047320 | Bacteria | 1012 |
| 540 | Ga0495672_0222008 | 3300047320 | Bacteria | 932 |
| 541 | Ga0495676_0000018 | 3300047321 | Bacteria | 178380 |
| 542 | Ga0495676_0005024 | 3300047321 | Bacteria | 12131 |
| 543 | Ga0495680_0061105 | 3300047322 | Bacteria | 2900 |
| 544 | Ga0495683_0000217 | 3300047323 | Bacteria | 54243 |
| 545 | Ga0495683_0045859 | 3300047323 | Bacteria | 2195 |
| 546 | Ga0495683_0066167 | 3300047323 | Bacteria | 1781 |
| 547 | Ga0495683_0242211 | 3300047323 | Bacteria | 795 |
| 548 | Ga0495683_0244836 | 3300047323 | Bacteria | 789 |
| 549 | Ga0495679_001426 | 3300047446 | Bacteria | 13611 |
| 550 | Ga0495679_002236 | 3300047446 | Bacteria | 10052 |
| 551 | Ga0495679_008371 | 3300047446 | Bacteria | 4211 |
| 552 | Ga0495679_031744 | 3300047446 | Bacteria | 1701 |
| 553 | Ga0495685_010530 | 3300047447 | Bacteria | 3103 |
| 554 | Ga0495673_0001075 | 3300047469 | Bacteria | 23963 |
| 555 | Ga0495673_0002192 | 3300047469 | Bacteria | 14155 |
| 556 | Ga0495673_0003526 | 3300047469 | Bacteria | 10297 |
| 557 | Ga0495673_0004319 | 3300047469 | Bacteria | 8948 |
| 558 | Ga0495673_0007446 | 3300047469 | Bacteria | 6292 |
| 559 | Ga0495673_0033062 | 3300047469 | Bacteria | 2404 |
| 560 | Ga0495673_0056910 | 3300047469 | Bacteria | 1689 |
| 561 | Ga0495673_0077146 | 3300047469 | Bacteria | 1388 |
| 562 | Ga0495673_0212344 | 3300047469 | Bacteria | 719 |
| 563 | Ga0495681_0003361 | 3300047470 | Bacteria | 11135 |
| 564 | Ga0495681_0008798 | 3300047470 | Bacteria | 6286 |
| 565 | Ga0495681_0009250 | 3300047470 | Bacteria | 6091 |
| 566 | Ga0495681_0015123 | 3300047470 | Bacteria | 4379 |
| 567 | Ga0495681_0018432 | 3300047470 | Bacteria | 3846 |
| 568 | Ga0495681_0024628 | 3300047470 | Bacteria | 3163 |
| 569 | Ga0495681_0033755 | 3300047470 | Bacteria | 2557 |
| 570 | Ga0495681_0034021 | 3300047470 | Bacteria | 2543 |
| 571 | Ga0495681_0055225 | 3300047470 | Bacteria | 1852 |
| 572 | Ga0495681_0093808 | 3300047470 | Bacteria | 1321 |
| 573 | Ga0495681_0099802 | 3300047470 | Bacteria | 1270 |
| 574 | Ga0495686_0003379 | 3300047472 | Bacteria | 13896 |
| 575 | Ga0495686_0007931 | 3300047472 | Bacteria | 7881 |
| 576 | Ga0495686_0008555 | 3300047472 | Bacteria | 7497 |
| 577 | Ga0495686_0266678 | 3300047472 | Bacteria | 956 |
| 578 | Ga0495602_0008372 | 3300048088 | Bacteria | 10809 |
| 579 | Ga0495626_0000172 | 3300048091 | Bacteria | 79971 |
| 580 | Ga0495626_0000216 | 3300048091 | Bacteria | 68946 |
| 581 | Ga0495626_0001853 | 3300048091 | Bacteria | 15869 |
| 582 | Ga0495626_0007749 | 3300048091 | Bacteria | 5949 |
| 583 | Ga0495626_0011815 | 3300048091 | Bacteria | 4599 |
| 584 | Ga0495626_0064937 | 3300048091 | Bacteria | 1652 |
| 585 | Ga0495626_0069190 | 3300048091 | Bacteria | 1590 |
| 586 | Ga0495626_0075810 | 3300048091 | Bacteria | 1502 |
| 587 | Ga0495626_0103034 | 3300048091 | Bacteria | 1242 |
| 588 | Ga0496102_0020736 | 3300048905 | Bacteria | 5808 |
| 589 | Ga0496102_0090487 | 3300048905 | Bacteria | 2832 |
| 590 | Ga0496103_0337393 | 3300048906 | Bacteria | 969 |
| 591 | Ga0496104_0306694 | 3300048907 | Bacteria | 1500 |
| 592 | Ga0496106_0171427 | 3300048909 | Bacteria | 1720 |
| 593 | Ga0496107_0282353 | 3300048910 | Bacteria | 1236 |
| 594 | Ga0496108_0404994 | 3300048911 | Bacteria | 1191 |
| 595 | Ga0496109_0023680 | 3300048912 | Bacteria | 5451 |
| 596 | Ga0496109_0085340 | 3300048912 | Bacteria | 2914 |
| 597 | Ga0496110_0016404 | 3300048913 | Bacteria | 6183 |
| 598 | Ga0496112_0232886 | 3300048915 | Bacteria | 1796 |
| 599 | Ga0496116_0000936 | 3300048919 | Bacteria | 35925 |
| 600 | Ga0496116_0003902 | 3300048919 | Bacteria | 14533 |
| 601 | Ga0496116_0193619 | 3300048919 | Bacteria | 1073 |
| 602 | Ga0496118_0202442 | 3300048921 | Bacteria | 1174 |
| 603 | Ga0496121_0008363 | 3300048924 | Bacteria | 12211 |
| 604 | Ga0496121_0071244 | 3300048924 | Bacteria | 2796 |
| 605 | Ga0496122_0034067 | 3300048925 | Bacteria | 4175 |
| 606 | Ga0496123_0093014 | 3300048926 | Bacteria | 1782 |
| 607 | Ga0496124_0020565 | 3300048927 | Bacteria | 6093 |
| 608 | Ga0496124_0402695 | 3300048927 | Bacteria | 949 |
| 609 | Ga0496125_0094321 | 3300048928 | Bacteria | 2230 |
| 610 | Ga0496126_0568843 | 3300048929 | Bacteria | 897 |
| 611 | Ga0496126_0663298 | 3300048929 | Bacteria | 815 |
| 612 | Ga0495678_002211 | 3300049459 | Bacteria | 13640 |
| 613 | Ga0495678_002245 | 3300049459 | Bacteria | 13452 |
| 614 | Ga0495678_002671 | 3300049459 | Bacteria | 11803 |
| 615 | Ga0495678_010990 | 3300049459 | Bacteria | 4357 |
| 616 | Ga0495678_020457 | 3300049459 | Bacteria | 2929 |
| 617 | Ga0495678_031180 | 3300049459 | Bacteria | 2225 |
| 618 | Ga0495678_067754 | 3300049459 | Bacteria | 1317 |
| 619 | Ga0495678_092940 | 3300049459 | Bacteria | 1058 |
| 620 | Ga0495678_115754 | 3300049459 | Bacteria | 907 |
| 621 | Ga0495682_0047811 | 3300049460 | Bacteria | 1560 |
| 622 | Ga0501031_0108655 | 3300049568 | Bacteria | 1811 |
| 623 | Ga0501032_0025564 | 3300049569 | Bacteria | 4069 |
| 624 | Ga0501034_0108480 | 3300049571 | Bacteria | 2767 |
| 625 | Ga0501036_0009156 | 3300049572 | Bacteria | 8141 |
| 626 | Ga0501038_0017779 | 3300049574 | Bacteria | 6425 |
| 627 | Ga0501039_0043147 | 3300049575 | Bacteria | 3484 |
| 628 | Ga0501039_0158740 | 3300049575 | Bacteria | 1777 |
| 629 | Ga0501043_0021833 | 3300049579 | Bacteria | 5020 |
| 630 | Ga0501043_0099213 | 3300049579 | Bacteria | 2289 |
| 631 | Ga0501046_0231046 | 3300049580 | Bacteria | 1367 |
| 632 | Ga0501047_0000598 | 3300049581 | Bacteria | 38369 |
| 633 | Ga0501048_0288221 | 3300049582 | Bacteria | 1168 |
| 634 | Ga0501067_0009501 | 3300049583 | Bacteria | 5386 |
| 635 | Ga0501068_0000042 | 3300049584 | Bacteria | 48007 |
| 636 | Ga0501069_0005495 | 3300049585 | Bacteria | 6596 |
| 637 | Ga0501070_0130393 | 3300049586 | Bacteria | 2077 |
| 638 | Ga0501072_0000004 | 3300049588 | Bacteria | 282897 |
| 639 | Ga0501073_0462574 | 3300049589 | Bacteria | 877 |
| 640 | Ga0501074_0003700 | 3300049590 | Bacteria | 10839 |
| 641 | Ga0501075_0572193 | 3300049591 | Bacteria | 862 |
| 642 | Ga0501076_0005826 | 3300049592 | Bacteria | 8889 |
| 643 | Ga0501077_0004746 | 3300049593 | Bacteria | 8264 |
| 644 | Ga0501240_003085 | 3300049673 | Bacteria | 1827 |
| 645 | Ga0501079_0011435 | 3300049741 | Bacteria | 6774 |
| 646 | Ga0501080_0024373 | 3300049742 | Bacteria | 5608 |
| 647 | Ga0501083_0004101 | 3300049744 | Bacteria | 10256 |
| 648 | Ga0501241_004867 | 3300049758 | Bacteria | 2508 |
| 649 | Ga0501262_017184 | 3300049759 | Bacteria | 963 |
| 650 | Ga0501269_002261 | 3300049766 | Bacteria | 2390 |
| 651 | Ga0501280_007577 | 3300049776 | Bacteria | 1517 |
| 652 | Ga0501035_0127922 | 3300049822 | Bacteria | 2216 |
| 653 | Ga0501035_0162760 | 3300049822 | Bacteria | 1931 |
| 654 | Ga0501035_0807838 | 3300049822 | Bacteria | 749 |
| 655 | Ga0501044_0032096 | 3300049823 | Bacteria | 5521 |
| 656 | Ga0501226_000006 | 3300049853 | Bacteria | 259153 |
| 657 | nmdc:mga00v17_441996_c1 | 3300050491 | Bacteria | 844 |
| 658 | nmdc:mga0rr50_77931_c1 | 3300050513 | Bacteria | 2548 |
| 659 | nmdc:mga08x19_509867_c1 | 3300050514 | Bacteria | 850 |
| 660 | Ga0500572_001081 | 3300053111 | Bacteria | 8023 |
| 661 | Ga0500592_005174 | 3300053116 | Bacteria | 2072 |
| 662 | Ga0500595_026562 | 3300053119 | Bacteria | 1994 |
| 663 | Ga0500568_0016977 | 3300053139 | Bacteria | 3222 |
| 664 | Ga0500627_0000149 | 3300053158 | Bacteria | 20586 |
| 665 | Ga0500649_155733 | 3300053722 | Bacteria | 812 |
| 666 | Ga0501084_0000552 | 3300054114 | Bacteria | 28547 |
| 667 | Ga0587083_0002115 | 3300059505 | Bacteria | 2408 |
| 668 | Ga0587088_015475 | 3300059508 | Bacteria | 1202 |
| 669 | Ga0587067_025154 | 3300059640 | Bacteria | 1057 |
| 670 | Ga0501082_0015460 | 3300060353 | Bacteria | 6568 |
| 671 | Ga0530510_0015841 | 3300061734 | Bacteria | 5330 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041443 | Ga0451789_0899180 | Ga0451789_0899180_18_581 | 183 |
| 2 | 3300042016 | Ga0439463_061554 | Ga0439463_061554_372_944 | 183 |
| 3 | 3300046492 | Ga0495585_0037032 | Ga0495585_0037032_1527_2111 | 183 |
| 4 | 3300046501 | Ga0495607_0028312 | Ga0495607_0028312_2863_3438 | 183 |
| 5 | 3300046507 | Ga0495606_0037407 | Ga0495606_0037407_1607_2191 | 183 |
| 6 | 3300046515 | Ga0495620_0062615 | Ga0495620_0062615_26_592 | 183 |
| 7 | 3300046528 | Ga0495642_0002441 | Ga0495642_0002441_2830_3414 | 183 |
| 8 | 3300046615 | Ga0495656_0359253 | Ga0495656_0359253_141_725 | 183 |
| 9 | 3300046794 | Ga0495589_0347368 | Ga0495589_0347368_80_664 | 183 |
| 10 | 3300046810 | Ga0495660_0059247 | Ga0495660_0059247_1087_1671 | 183 |
| 11 | 3300046810 | Ga0495660_0146266 | Ga0495660_0146266_594_1157 | 183 |
| 12 | 3300047320 | Ga0495672_0222008 | Ga0495672_0222008_351_917 | 183 |
| 13 | 3300047323 | Ga0495683_0242211 | Ga0495683_0242211_132_716 | 183 |
| 14 | 3300049758 | Ga0501241_004867 | Ga0501241_004867_583_1146 | 183 |
| 15 | 3300049766 | Ga0501269_002261 | Ga0501269_002261_704_1267 | 183 |
| 16 | 3300005439 | Ga0070711_100280486 | Ga0070711_1002804862 | 184 |
| 17 | 3300006163 | Ga0070715_10125265 | Ga0070715_101252652 | 184 |
| 18 | 3300006173 | Ga0070716_100087497 | Ga0070716_1000874972 | 184 |
| 19 | 3300025916 | Ga0207663_10515519 | Ga0207663_105155192 | 184 |
| 20 | 3300025939 | Ga0207665_10412055 | Ga0207665_104120552 | 184 |
| 21 | 3300041498 | Ga0451841_0453392 | Ga0451841_0453392_64_645 | 184 |
| 22 | 3300046683 | Ga0495658_0113516 | Ga0495658_0113516_816_1385 | 184 |
| 23 | 3300049822 | Ga0501035_0162760 | Ga0501035_0162760_571_1143 | 185 |
| 24 | 3300045976 | Ga0466967_0626043 | Ga0466967_0626043_335_910 | 186 |
| 25 | 3300005445 | Ga0070708_100194289 | Ga0070708_1001942893 | 188 |
| 26 | 3300005467 | Ga0070706_100316838 | Ga0070706_1003168382 | 188 |
| 27 | 3300005518 | Ga0070699_100038092 | Ga0070699_1000380923 | 188 |
| 28 | 3300006914 | Ga0075436_100101982 | Ga0075436_1001019823 | 188 |
| 29 | 3300025910 | Ga0207684_10159060 | Ga0207684_101590602 | 188 |
| 30 | 3300044842 | Ga0466957_0579549 | Ga0466957_0579549_175_759 | 188 |
| 31 | 3300049759 | Ga0501262_017184 | Ga0501262_017184_47_625 | 188 |
| 32 | iso_pu_bacteria | 2511231004 | 2511252775 | 188 |
| 33 | iso_pu_bacteria | 2511231006 | 2511267592 | 188 |
| 34 | iso_pu_bacteria | 2511231007 | 2511271990 | 188 |
| 35 | iso_pu_bacteria | 2511231008 | 2511280220 | 188 |
| 36 | iso_pu_bacteria | 2511231010 | 2511292092 | 188 |
| 37 | iso_pu_bacteria | 2511231016 | 2511327117 | 188 |
| 38 | iso_pu_bacteria | 2511231021 | 2511354311 | 188 |
| 39 | iso_pu_bacteria | 2511231022 | 2511365247 | 188 |
| 40 | iso_pu_bacteria | 2511231023 | 2511371940 | 188 |
| 41 | iso_pu_bacteria | 2511231031 | 2511416178 | 188 |
| 42 | iso_pu_bacteria | 2512047018 | 2512324996 | 188 |
| 43 | iso_pu_bacteria | 2582580891 | 2583791120 | 188 |
| 44 | iso_pu_bacteria | 2597489887 | 2597856735 | 188 |
| 45 | iso_pu_bacteria | 2599185185 | 2599483758 | 188 |
| 46 | iso_pu_bacteria | 2600254931 | 2600365705 | 188 |
| 47 | iso_pu_bacteria | 2600255318 | 2601801138 | 188 |
| 48 | iso_pu_bacteria | 2603880185 | 2606073232 | 188 |
| 49 | iso_pu_bacteria | 2603880199 | 2606126107 | 188 |
| 50 | iso_pu_bacteria | 2623620443 | 2624479319 | 188 |
| 51 | iso_pu_bacteria | 2643221565 | 2643841853 | 188 |
| 52 | iso_pu_bacteria | 2643221585 | 2643934037 | 188 |
| 53 | iso_pu_bacteria | 2643221639 | 2644220106 | 188 |
| 54 | iso_pu_bacteria | 2643221646 | 2644261120 | 188 |
| 55 | iso_pu_bacteria | 2643221656 | 2644315524 | 188 |
| 56 | iso_pu_bacteria | 2713897148 | 2715751842 | 188 |
| 57 | iso_pu_bacteria | 2713897149 | 2715754890 | 188 |
| 58 | iso_pu_bacteria | 2718217725 | 2718633166 | 188 |
| 59 | iso_pu_bacteria | 2738541337 | 2739053277 | 188 |
| 60 | iso_pu_bacteria | 2738543020 | 2739285503 | 188 |
| 61 | iso_pu_bacteria | 2738543021 | 2739290816 | 188 |
| 62 | iso_pu_bacteria | 2738543025 | 2739314222 | 188 |
| 63 | iso_pu_bacteria | 2842805378 | 2842806915 | 188 |
| 64 | iso_pu_bacteria | 2842832357 | 2842832809 | 188 |
| 65 | iso_pu_bacteria | 2842843487 | 2842848105 | 188 |
| 66 | iso_pu_bacteria | 2878029506 | 2878031328 | 188 |
| 67 | iso_pu_bacteria | 2919063839 | 2919064203 | 188 |
| 68 | iso_pu_bacteria | 2919385768 | 2919386287 | 188 |
| 69 | iso_pu_bacteria | 2919456309 | 2919457225 | 188 |
| 70 | iso_pu_bacteria | 2919487758 | 2919491436 | 188 |
| 71 | iso_pu_bacteria | 2969304461 | 2969306096 | 188 |
| 72 | iso_pu_bacteria | 2974289157 | 2974292244 | 188 |
| 73 | iso_pu_bacteria | 2984286254 | 2984290861 | 188 |
| 74 | iso_pu_bacteria | 2998139840 | 2998141497 | 188 |
| 75 | iso_pu_bacteria | 3007395558 | 3007400718 | 188 |
| 76 | iso_pu_bacteria | 3007511990 | 3007512899 | 188 |
| 77 | iso_pu_bacteria | 3007614139 | 3007618925 | 188 |
| 78 | iso_pu_bacteria | 3007619802 | 3007620302 | 188 |
| 79 | iso_pu_bacteria | 3007718800 | 3007723176 | 188 |
| 80 | iso_pu_bacteria | 3007855910 | 3007856094 | 188 |
| 81 | iso_pu_bacteria | 3007861166 | 3007863263 | 188 |
| 82 | iso_pu_bacteria | 8011350971 | 8011352473 | 188 |
| 83 | iso_pu_bacteria | 8015687852 | 8015689396 | 188 |
| 84 | iso_pu_bacteria | 8029995093 | 8029999251 | 188 |
| 85 | iso_pu_bacteria | 8055770955 | 8055772532 | 188 |
| 86 | iso_pu_bacteria | 8056155041 | 8056156752 | 188 |
| 87 | iso_pu_bacteria | 8056166840 | 8056169489 | 188 |
| 88 | iso_pu_bacteria | 8056177738 | 8056181039 | 188 |
| 89 | 3300005536 | Ga0070697_100236948 | Ga0070697_1002369482 | 189 |
| 90 | 3300006048 | Ga0075363_100296188 | Ga0075363_1002961882 | 189 |
| 91 | 3300006353 | Ga0075370_10252695 | Ga0075370_102526952 | 189 |
| 92 | 3300006358 | Ga0068871_100425571 | Ga0068871_1004255712 | 189 |
| 93 | 3300010375 | Ga0105239_10951413 | Ga0105239_109514132 | 189 |
| 94 | 3300025254 | Ga0209148_1009265 | Ga0209148_10092652 | 189 |
| 95 | 3300042012 | Ga0439455_0121919 | Ga0439455_0121919_43_636 | 189 |
| 96 | 3300047315 | Ga0495581_0342779 | Ga0495581_0342779_242_826 | 189 |
| 97 | 3300047322 | Ga0495680_0061105 | Ga0495680_0061105_2122_2706 | 189 |
| 98 | 3300048929 | Ga0496126_0663298 | Ga0496126_0663298_201_794 | 189 |
| 99 | 3300053119 | Ga0500595_026562 | Ga0500595_026562_31_645 | 189 |
| 100 | iso_pu_bacteria | 2643221560 | 2643822856 | 189 |
| 101 | iso_pu_bacteria | 2643221563 | 2643832523 | 189 |
| 102 | iso_pu_bacteria | 2643221608 | 2644053682 | 189 |
| 103 | iso_pu_bacteria | 2852653556 | 2852654880 | 189 |
| 104 | iso_pu_bacteria | 2852680915 | 2852681418 | 189 |
| 105 | iso_pu_bacteria | 8056120720 | 8056122245 | 189 |
| 106 | 3300005444 | Ga0070694_100134776 | Ga0070694_1001347762 | 190 |
| 107 | 3300005545 | Ga0070695_100275938 | Ga0070695_1002759382 | 190 |
| 108 | 3300005546 | Ga0070696_100145438 | Ga0070696_1001454382 | 190 |
| 109 | 3300042137 | Ga0450902_012270 | Ga0450902_012270_610_1182 | 190 |
| 110 | 3300046453 | Ga0495627_081888 | Ga0495627_081888_338_910 | 190 |
| 111 | 3300046457 | Ga0495590_0004330 | Ga0495590_0004330_360_932 | 190 |
| 112 | 3300046458 | Ga0495591_000264 | Ga0495591_000264_36125_36697 | 190 |
| 113 | 3300046460 | Ga0495638_0046463 | Ga0495638_0046463_378_950 | 190 |
| 114 | 3300046471 | Ga0495650_0005746 | Ga0495650_0005746_6480_7052 | 190 |
| 115 | 3300046474 | Ga0495605_0050564 | Ga0495605_0050564_232_804 | 190 |
| 116 | 3300046491 | Ga0495584_0012361 | Ga0495584_0012361_3481_4053 | 190 |
| 117 | 3300046500 | Ga0495596_0000004 | Ga0495596_0000004_149466_150038 | 190 |
| 118 | 3300046501 | Ga0495607_0294622 | Ga0495607_0294622_104_676 | 190 |
| 119 | 3300046501 | Ga0495607_0294634 | Ga0495607_0294634_104_676 | 190 |
| 120 | 3300046507 | Ga0495606_0033966 | Ga0495606_0033966_1456_2028 | 190 |
| 121 | 3300046512 | Ga0495610_0037611 | Ga0495610_0037611_1224_1796 | 190 |
| 122 | 3300046515 | Ga0495620_0004328 | Ga0495620_0004328_6319_6891 | 190 |
| 123 | 3300046518 | Ga0495631_0004457 | Ga0495631_0004457_422_994 | 190 |
| 124 | 3300046519 | Ga0495632_0056595 | Ga0495632_0056595_128_700 | 190 |
| 125 | 3300046520 | Ga0495637_0000654 | Ga0495637_0000654_8091_8663 | 190 |
| 126 | 3300046522 | Ga0495643_0012757 | Ga0495643_0012757_1177_1749 | 190 |
| 127 | 3300046522 | Ga0495643_0210009 | Ga0495643_0210009_143_715 | 190 |
| 128 | 3300046523 | Ga0495644_0005006 | Ga0495644_0005006_3391_3963 | 190 |
| 129 | 3300046524 | Ga0495648_0076627 | Ga0495648_0076627_506_1078 | 190 |
| 130 | 3300046530 | Ga0495654_0003492 | Ga0495654_0003492_5292_5864 | 190 |
| 131 | 3300046542 | Ga0495597_0015167 | Ga0495597_0015167_1602_2174 | 190 |
| 132 | 3300046616 | Ga0495668_0000940 | Ga0495668_0000940_29973_30545 | 190 |
| 133 | 3300046660 | Ga0495625_0011342 | Ga0495625_0011342_1505_2077 | 190 |
| 134 | 3300046665 | Ga0495661_0187417 | Ga0495661_0187417_90_662 | 190 |
| 135 | 3300046692 | Ga0495671_0216479 | Ga0495671_0216479_124_696 | 190 |
| 136 | 3300046694 | Ga0495649_0073950 | Ga0495649_0073950_1217_1789 | 190 |
| 137 | 3300046794 | Ga0495589_0089435 | Ga0495589_0089435_232_804 | 190 |
| 138 | 3300046810 | Ga0495660_0038328 | Ga0495660_0038328_356_928 | 190 |
| 139 | 3300047320 | Ga0495672_0196093 | Ga0495672_0196093_206_778 | 190 |
| 140 | 3300047469 | Ga0495673_0033062 | Ga0495673_0033062_1709_2281 | 190 |
| 141 | 3300047470 | Ga0495681_0024628 | Ga0495681_0024628_2468_3040 | 190 |
| 142 | 3300048091 | Ga0495626_0001853 | Ga0495626_0001853_8558_9130 | 190 |
| 143 | 3300049459 | Ga0495678_020457 | Ga0495678_020457_2268_2840 | 190 |
| 144 | 3300049459 | Ga0495678_115754 | Ga0495678_115754_104_676 | 190 |
| 145 | 3300005329 | Ga0070683_100226489 | Ga0070683_1002264893 | 191 |
| 146 | 3300005331 | Ga0070670_100341714 | Ga0070670_1003417142 | 191 |
| 147 | 3300005436 | Ga0070713_100283654 | Ga0070713_1002836543 | 191 |
| 148 | 3300005468 | Ga0070707_100164803 | Ga0070707_1001648031 | 191 |
| 149 | 3300005530 | Ga0070679_100215314 | Ga0070679_1002153142 | 191 |
| 150 | 3300006163 | Ga0070715_10033756 | Ga0070715_100337562 | 191 |
| 151 | 3300007076 | Ga0075435_100109957 | Ga0075435_1001099573 | 191 |
| 152 | 3300007265 | Ga0099794_10060371 | Ga0099794_100603712 | 191 |
| 153 | 3300013307 | Ga0157372_10183550 | Ga0157372_101835501 | 191 |
| 154 | 3300025910 | Ga0207684_10061541 | Ga0207684_100615413 | 191 |
| 155 | 3300025921 | Ga0207652_10211914 | Ga0207652_102119143 | 191 |
| 156 | 3300025922 | Ga0207646_10075203 | Ga0207646_100752033 | 191 |
| 157 | 3300035119 | Ga0373956_0003525 | Ga0373956_0003525_2837_3424 | 191 |
| 158 | 3300035410 | Ga0373924_0398543 | Ga0373924_0398543_17_604 | 191 |
| 159 | 3300035692 | Ga0373935_0524595 | Ga0373935_0524595_244_831 | 191 |
| 160 | 3300035724 | Ga0373933_0031907 | Ga0373933_0031907_2437_3024 | 191 |
| 161 | 3300036401 | Ga0373937_0034048 | Ga0373937_0034048_1896_2483 | 191 |
| 162 | 3300037471 | Ga0395905_1103402 | Ga0395905_1103402_112_687 | 191 |
| 163 | 3300046528 | Ga0495642_0236055 | Ga0495642_0236055_41_637 | 191 |
| 164 | 3300046683 | Ga0495658_0070719 | Ga0495658_0070719_1106_1699 | 191 |
| 165 | 3300047447 | Ga0495685_010530 | Ga0495685_010530_786_1367 | 191 |
| 166 | 3300048905 | Ga0496102_0020736 | Ga0496102_0020736_3476_4081 | 191 |
| 167 | 3300048907 | Ga0496104_0306694 | Ga0496104_0306694_431_1036 | 191 |
| 168 | 3300048909 | Ga0496106_0171427 | Ga0496106_0171427_170_775 | 191 |
| 169 | 3300048910 | Ga0496107_0282353 | Ga0496107_0282353_601_1206 | 191 |
| 170 | 3300048911 | Ga0496108_0404994 | Ga0496108_0404994_294_899 | 191 |
| 171 | 3300048912 | Ga0496109_0023680 | Ga0496109_0023680_4552_5157 | 191 |
| 172 | 3300048912 | Ga0496109_0085340 | Ga0496109_0085340_213_818 | 191 |
| 173 | 3300048913 | Ga0496110_0016404 | Ga0496110_0016404_2223_2828 | 191 |
| 174 | 3300050513 | nmdc:mga0rr50_77931_c1 | nmdc:mga0rr50_77931_c1_450_1037 | 191 |
| 175 | 3300050514 | nmdc:mga08x19_509867_c1 | nmdc:mga08x19_509867_c1_257_835 | 191 |
| 176 | iso_pu_bacteria | 2643221603 | 2644026505 | 191 |
| 177 | 3300003322 | rootL2_10012056 | rootL2_1001205614 | 192 |
| 178 | 3300003323 | rootH1_10020558 | rootH1_100205585 | 192 |
| 179 | 3300003323 | rootH1_10114129 | rootH1_101141292 | 192 |
| 180 | 3300003781 | Ga0055536_1000041 | Ga0055536_100004148 | 192 |
| 181 | 3300003781 | Ga0055536_1000042 | Ga0055536_100004288 | 192 |
| 182 | 3300003781 | Ga0055536_1004420 | Ga0055536_10044202 | 192 |
| 183 | 3300003781 | Ga0055536_1007529 | Ga0055536_10075293 | 192 |
| 184 | 3300003791 | Ga0055530_10000063 | Ga0055530_1000006332 | 192 |
| 185 | 3300003791 | Ga0055530_10000174 | Ga0055530_1000017420 | 192 |
| 186 | 3300003791 | Ga0055530_10000411 | Ga0055530_1000041128 | 192 |
| 187 | 3300003791 | Ga0055530_10002068 | Ga0055530_100020689 | 192 |
| 188 | 3300003791 | Ga0055530_10035526 | Ga0055530_100355262 | 192 |
| 189 | 3300003792 | Ga0055540_1000278 | Ga0055540_100027831 | 192 |
| 190 | 3300003792 | Ga0055540_1000318 | Ga0055540_100031823 | 192 |
| 191 | 3300003794 | Ga0055531_10000412 | Ga0055531_1000041214 | 192 |
| 192 | 3300003794 | Ga0055531_10001746 | Ga0055531_1000174611 | 192 |
| 193 | 3300003794 | Ga0055531_10014294 | Ga0055531_100142944 | 192 |
| 194 | 3300005262 | Ga0065165_1000806 | Ga0065165_100080616 | 192 |
| 195 | 3300005288 | Ga0065714_10067840 | Ga0065714_100678404 | 192 |
| 196 | 3300005288 | Ga0065714_10077559 | Ga0065714_100775592 | 192 |
| 197 | 3300005288 | Ga0065714_10091407 | Ga0065714_100914073 | 192 |
| 198 | 3300005289 | Ga0065704_10016922 | Ga0065704_100169221 | 192 |
| 199 | 3300005329 | Ga0070683_100080622 | Ga0070683_1000806223 | 192 |
| 200 | 3300005340 | Ga0070689_100029810 | Ga0070689_1000298102 | 192 |
| 201 | 3300005353 | Ga0070669_100045051 | Ga0070669_1000450512 | 192 |
| 202 | 3300005353 | Ga0070669_100136641 | Ga0070669_1001366413 | 192 |
| 203 | 3300005366 | Ga0070659_100052719 | Ga0070659_1000527194 | 192 |
| 204 | 3300005456 | Ga0070678_100175672 | Ga0070678_1001756722 | 192 |
| 205 | 3300005457 | Ga0070662_100781482 | Ga0070662_1007814821 | 192 |
| 206 | 3300005458 | Ga0070681_10068669 | Ga0070681_100686692 | 192 |
| 207 | 3300005548 | Ga0070665_100079480 | Ga0070665_1000794801 | 192 |
| 208 | 3300005548 | Ga0070665_100228216 | Ga0070665_1002282162 | 192 |
| 209 | 3300005577 | Ga0068857_100203152 | Ga0068857_1002031522 | 192 |
| 210 | 3300005577 | Ga0068857_100672582 | Ga0068857_1006725822 | 192 |
| 211 | 3300005614 | Ga0068856_100107692 | Ga0068856_1001076922 | 192 |
| 212 | 3300005842 | Ga0068858_100189143 | Ga0068858_1001891432 | 192 |
| 213 | 3300005842 | Ga0068858_100563001 | Ga0068858_1005630012 | 192 |
| 214 | 3300006051 | Ga0075364_10143619 | Ga0075364_101436192 | 192 |
| 215 | 3300006051 | Ga0075364_10177054 | Ga0075364_101770543 | 192 |
| 216 | 3300006058 | Ga0075432_10008785 | Ga0075432_100087853 | 192 |
| 217 | 3300006058 | Ga0075432_10180657 | Ga0075432_101806572 | 192 |
| 218 | 3300006175 | Ga0070712_100023860 | Ga0070712_1000238602 | 192 |
| 219 | 3300007265 | Ga0099794_10002724 | Ga0099794_100027245 | 192 |
| 220 | 3300007788 | Ga0099795_10187977 | Ga0099795_101879771 | 192 |
| 221 | 3300009011 | Ga0105251_10062978 | Ga0105251_100629782 | 192 |
| 222 | 3300009036 | Ga0105244_10003184 | Ga0105244_100031845 | 192 |
| 223 | 3300009036 | Ga0105244_10037103 | Ga0105244_100371033 | 192 |
| 224 | 3300009036 | Ga0105244_10188655 | Ga0105244_101886552 | 192 |
| 225 | 3300009094 | Ga0111539_10115694 | Ga0111539_101156943 | 192 |
| 226 | 3300009148 | Ga0105243_10000162 | Ga0105243_1000016215 | 192 |
| 227 | 3300011119 | Ga0105246_10000155 | Ga0105246_1000015531 | 192 |
| 228 | 3300012498 | Ga0157345_1000143 | Ga0157345_10001438 | 192 |
| 229 | 3300013100 | Ga0157373_10003502 | Ga0157373_100035025 | 192 |
| 230 | 3300013100 | Ga0157373_10047355 | Ga0157373_100473552 | 192 |
| 231 | 3300013102 | Ga0157371_10003729 | Ga0157371_100037299 | 192 |
| 232 | 3300013104 | Ga0157370_10001776 | Ga0157370_100017769 | 192 |
| 233 | 3300013104 | Ga0157370_10032589 | Ga0157370_100325894 | 192 |
| 234 | 3300013104 | Ga0157370_10052312 | Ga0157370_100523124 | 192 |
| 235 | 3300013104 | Ga0157370_10121765 | Ga0157370_101217654 | 192 |
| 236 | 3300013105 | Ga0157369_10006367 | Ga0157369_100063677 | 192 |
| 237 | 3300013105 | Ga0157369_10007063 | Ga0157369_100070634 | 192 |
| 238 | 3300013105 | Ga0157369_10031677 | Ga0157369_100316773 | 192 |
| 239 | 3300013306 | Ga0163162_10001228 | Ga0163162_1000122815 | 192 |
| 240 | 3300013307 | Ga0157372_10281290 | Ga0157372_102812903 | 192 |
| 241 | 3300013308 | Ga0157375_10112993 | Ga0157375_101129932 | 192 |
| 242 | 3300014325 | Ga0163163_10542602 | Ga0163163_105426022 | 192 |
| 243 | 3300014497 | Ga0182008_10003253 | Ga0182008_100032538 | 192 |
| 244 | 3300015261 | Ga0182006_1002922 | Ga0182006_10029227 | 192 |
| 245 | 3300017792 | Ga0163161_10004436 | Ga0163161_100044368 | 192 |
| 246 | 3300017792 | Ga0163161_10050043 | Ga0163161_100500434 | 192 |
| 247 | 3300017792 | Ga0163161_10472340 | Ga0163161_104723402 | 192 |
| 248 | 3300025291 | Ga0209675_1017541 | Ga0209675_10175413 | 192 |
| 249 | 3300025292 | Ga0209676_1000016 | Ga0209676_1000016425 | 192 |
| 250 | 3300025292 | Ga0209676_1000021 | Ga0209676_1000021122 | 192 |
| 251 | 3300025292 | Ga0209676_1000033 | Ga0209676_1000033246 | 192 |
| 252 | 3300025292 | Ga0209676_1000084 | Ga0209676_1000084267 | 192 |
| 253 | 3300025292 | Ga0209676_1000259 | Ga0209676_100025983 | 192 |
| 254 | 3300025292 | Ga0209676_1000678 | Ga0209676_100067810 | 192 |
| 255 | 3300025292 | Ga0209676_1032689 | Ga0209676_10326892 | 192 |
| 256 | 3300025292 | Ga0209676_1044287 | Ga0209676_10442872 | 192 |
| 257 | 3300025294 | Ga0209025_1010159 | Ga0209025_10101598 | 192 |
| 258 | 3300025294 | Ga0209025_1097914 | Ga0209025_10979142 | 192 |
| 259 | 3300025298 | Ga0209050_1000036 | Ga0209050_1000036133 | 192 |
| 260 | 3300025298 | Ga0209050_1000104 | Ga0209050_1000104109 | 192 |
| 261 | 3300025298 | Ga0209050_1000107 | Ga0209050_1000107121 | 192 |
| 262 | 3300025303 | Ga0209051_1000043 | Ga0209051_1000043205 | 192 |
| 263 | 3300025303 | Ga0209051_1000090 | Ga0209051_100009035 | 192 |
| 264 | 3300025304 | Ga0209257_1000098 | Ga0209257_1000098108 | 192 |
| 265 | 3300025304 | Ga0209257_1000120 | Ga0209257_100012089 | 192 |
| 266 | 3300025304 | Ga0209257_1000174 | Ga0209257_1000174148 | 192 |
| 267 | 3300025304 | Ga0209257_1005689 | Ga0209257_10056893 | 192 |
| 268 | 3300025711 | Ga0207696_1003232 | Ga0207696_10032326 | 192 |
| 269 | 3300025711 | Ga0207696_1012217 | Ga0207696_10122173 | 192 |
| 270 | 3300025728 | Ga0207655_1000297 | Ga0207655_100029726 | 192 |
| 271 | 3300025728 | Ga0207655_1005351 | Ga0207655_10053517 | 192 |
| 272 | 3300025728 | Ga0207655_1005951 | Ga0207655_10059516 | 192 |
| 273 | 3300025735 | Ga0207713_1000904 | Ga0207713_100090414 | 192 |
| 274 | 3300025915 | Ga0207693_10029957 | Ga0207693_100299572 | 192 |
| 275 | 3300025917 | Ga0207660_10106363 | Ga0207660_101063632 | 192 |
| 276 | 3300025923 | Ga0207681_10010392 | Ga0207681_100103924 | 192 |
| 277 | 3300025923 | Ga0207681_10516310 | Ga0207681_105163102 | 192 |
| 278 | 3300025932 | Ga0207690_10013933 | Ga0207690_100139333 | 192 |
| 279 | 3300025933 | Ga0207706_10128430 | Ga0207706_101284302 | 192 |
| 280 | 3300025933 | Ga0207706_10422077 | Ga0207706_104220772 | 192 |
| 281 | 3300025935 | Ga0207709_10000053 | Ga0207709_1000005315 | 192 |
| 282 | 3300025936 | Ga0207670_10020423 | Ga0207670_100204232 | 192 |
| 283 | 3300025949 | Ga0207667_10339602 | Ga0207667_103396022 | 192 |
| 284 | 3300026035 | Ga0207703_10091429 | Ga0207703_100914292 | 192 |
| 285 | 3300026078 | Ga0207702_10098651 | Ga0207702_100986514 | 192 |
| 286 | 3300026116 | Ga0207674_10242343 | Ga0207674_102423433 | 192 |
| 287 | 3300026121 | Ga0207683_10068188 | Ga0207683_100681885 | 192 |
| 288 | 3300027111 | Ga0209281_1017534 | Ga0209281_10175343 | 192 |
| 289 | 3300027671 | Ga0209588_1011457 | Ga0209588_10114571 | 192 |
| 290 | 3300027907 | Ga0207428_10744364 | Ga0207428_107443641 | 192 |
| 291 | 3300028379 | Ga0268266_10040819 | Ga0268266_100408193 | 192 |
| 292 | 3300028381 | Ga0268264_10645307 | Ga0268264_106453072 | 192 |
| 293 | 3300028381 | Ga0268264_10743960 | Ga0268264_107439601 | 192 |
| 294 | 3300028786 | Ga0307517_10125729 | Ga0307517_101257292 | 192 |
| 295 | 3300030521 | Ga0307511_10069438 | Ga0307511_100694382 | 192 |
| 296 | 3300030735 | Ga0316178_1074314 | Ga0316178_107431413 | 192 |
| 297 | 3300031456 | Ga0307513_10026909 | Ga0307513_100269095 | 192 |
| 298 | 3300031507 | Ga0307509_10154927 | Ga0307509_101549273 | 192 |
| 299 | 3300031548 | Ga0307408_100043286 | Ga0307408_1000432864 | 192 |
| 300 | 3300031548 | Ga0307408_100062538 | Ga0307408_1000625384 | 192 |
| 301 | 3300031548 | Ga0307408_100146097 | Ga0307408_1001460973 | 192 |
| 302 | 3300031548 | Ga0307408_100339421 | Ga0307408_1003394211 | 192 |
| 303 | 3300031548 | Ga0307408_100759601 | Ga0307408_1007596012 | 192 |
| 304 | 3300031548 | Ga0307408_100992266 | Ga0307408_1009922661 | 192 |
| 305 | 3300031730 | Ga0307516_10652995 | Ga0307516_106529951 | 192 |
| 306 | 3300031731 | Ga0307405_10092853 | Ga0307405_100928533 | 192 |
| 307 | 3300031731 | Ga0307405_10238874 | Ga0307405_102388743 | 192 |
| 308 | 3300031731 | Ga0307405_10412334 | Ga0307405_104123342 | 192 |
| 309 | 3300031731 | Ga0307405_10462843 | Ga0307405_104628432 | 192 |
| 310 | 3300031824 | Ga0307413_10039463 | Ga0307413_100394632 | 192 |
| 311 | 3300031852 | Ga0307410_10130051 | Ga0307410_101300513 | 192 |
| 312 | 3300031852 | Ga0307410_10133193 | Ga0307410_101331932 | 192 |
| 313 | 3300031852 | Ga0307410_10632905 | Ga0307410_106329052 | 192 |
| 314 | 3300031901 | Ga0307406_10039441 | Ga0307406_100394412 | 192 |
| 315 | 3300031901 | Ga0307406_10401992 | Ga0307406_104019921 | 192 |
| 316 | 3300031901 | Ga0307406_10702001 | Ga0307406_107020012 | 192 |
| 317 | 3300031903 | Ga0307407_10042278 | Ga0307407_100422782 | 192 |
| 318 | 3300031911 | Ga0307412_10055008 | Ga0307412_100550082 | 192 |
| 319 | 3300031911 | Ga0307412_10072804 | Ga0307412_100728043 | 192 |
| 320 | 3300031911 | Ga0307412_10079840 | Ga0307412_100798402 | 192 |
| 321 | 3300031911 | Ga0307412_10114202 | Ga0307412_101142024 | 192 |
| 322 | 3300031911 | Ga0307412_10223493 | Ga0307412_102234932 | 192 |
| 323 | 3300031911 | Ga0307412_10435193 | Ga0307412_104351931 | 192 |
| 324 | 3300031911 | Ga0307412_10541563 | Ga0307412_105415631 | 192 |
| 325 | 3300031911 | Ga0307412_10556179 | Ga0307412_105561792 | 192 |
| 326 | 3300031911 | Ga0307412_11470721 | Ga0307412_114707211 | 192 |
| 327 | 3300031995 | Ga0307409_101208841 | Ga0307409_1012088411 | 192 |
| 328 | 3300032002 | Ga0307416_100023954 | Ga0307416_1000239543 | 192 |
| 329 | 3300032002 | Ga0307416_100197817 | Ga0307416_1001978172 | 192 |
| 330 | 3300032002 | Ga0307416_100296603 | Ga0307416_1002966032 | 192 |
| 331 | 3300032002 | Ga0307416_100455895 | Ga0307416_1004558951 | 192 |
| 332 | 3300032002 | Ga0307416_100506890 | Ga0307416_1005068902 | 192 |
| 333 | 3300032002 | Ga0307416_100652117 | Ga0307416_1006521172 | 192 |
| 334 | 3300032004 | Ga0307414_10003389 | Ga0307414_100033892 | 192 |
| 335 | 3300032004 | Ga0307414_10005872 | Ga0307414_1000587211 | 192 |
| 336 | 3300032004 | Ga0307414_10013889 | Ga0307414_100138894 | 192 |
| 337 | 3300032004 | Ga0307414_10060347 | Ga0307414_100603472 | 192 |
| 338 | 3300032004 | Ga0307414_10080013 | Ga0307414_100800132 | 192 |
| 339 | 3300032004 | Ga0307414_10085351 | Ga0307414_100853512 | 192 |
| 340 | 3300032004 | Ga0307414_10289001 | Ga0307414_102890013 | 192 |
| 341 | 3300032004 | Ga0307414_10402495 | Ga0307414_104024952 | 192 |
| 342 | 3300032004 | Ga0307414_10765296 | Ga0307414_107652962 | 192 |
| 343 | 3300032005 | Ga0307411_10028057 | Ga0307411_100280571 | 192 |
| 344 | 3300032005 | Ga0307411_10065164 | Ga0307411_100651642 | 192 |
| 345 | 3300032005 | Ga0307411_10117242 | Ga0307411_101172422 | 192 |
| 346 | 3300032005 | Ga0307411_10558783 | Ga0307411_105587832 | 192 |
| 347 | 3300032005 | Ga0307411_11069895 | Ga0307411_110698951 | 192 |
| 348 | 3300032126 | Ga0307415_100165558 | Ga0307415_1001655582 | 192 |
| 349 | 3300033180 | Ga0307510_10024905 | Ga0307510_100249057 | 192 |
| 350 | 3300033180 | Ga0307510_10046980 | Ga0307510_100469805 | 192 |
| 351 | 3300037418 | Ga0395900_0135728 | Ga0395900_0135728_673_1272 | 192 |
| 352 | 3300037471 | Ga0395905_0001480 | Ga0395905_0001480_7790_8368 | 192 |
| 353 | 3300038705 | Ga0237819_02368 | Ga0237819_02368_3181_3771 | 192 |
| 354 | 3300039062 | Ga0400483_223733 | Ga0400483_223733_93_689 | 192 |
| 355 | 3300039447 | Ga0436361_0763530 | Ga0436361_0763530_2083_2670 | 192 |
| 356 | 3300041405 | Ga0439438_000923 | Ga0439438_000923_11037_11627 | 192 |
| 357 | 3300041405 | Ga0439438_001061 | Ga0439438_001061_1489_2079 | 192 |
| 358 | 3300041405 | Ga0439438_010911 | Ga0439438_010911_715_1305 | 192 |
| 359 | 3300041407 | Ga0439447_003511 | Ga0439447_003511_4170_4760 | 192 |
| 360 | 3300041407 | Ga0439447_045284 | Ga0439447_045284_294_884 | 192 |
| 361 | 3300041411 | Ga0439466_0004829 | Ga0439466_0004829_4462_5052 | 192 |
| 362 | 3300041411 | Ga0439466_0031401 | Ga0439466_0031401_381_971 | 192 |
| 363 | 3300041411 | Ga0439466_0099333 | Ga0439466_0099333_192_782 | 192 |
| 364 | 3300042000 | Ga0439437_000022 | Ga0439437_000022_1697_2284 | 192 |
| 365 | 3300042004 | Ga0439445_0084717 | Ga0439445_0084717_103_693 | 192 |
| 366 | 3300042006 | Ga0439432_003835 | Ga0439432_003835_2797_3387 | 192 |
| 367 | 3300042009 | Ga0439451_000492 | Ga0439451_000492_6005_6595 | 192 |
| 368 | 3300042009 | Ga0439451_003515 | Ga0439451_003515_709_1299 | 192 |
| 369 | 3300042010 | Ga0439452_000228 | Ga0439452_000228_30945_31535 | 192 |
| 370 | 3300042010 | Ga0439452_000887 | Ga0439452_000887_10904_11494 | 192 |
| 371 | 3300042010 | Ga0439452_005669 | Ga0439452_005669_72_662 | 192 |
| 372 | 3300042010 | Ga0439452_032686 | Ga0439452_032686_542_1132 | 192 |
| 373 | 3300042013 | Ga0439456_000846 | Ga0439456_000846_1308_1898 | 192 |
| 374 | 3300042013 | Ga0439456_015178 | Ga0439456_015178_87_677 | 192 |
| 375 | 3300042013 | Ga0439456_016896 | Ga0439456_016896_510_1097 | 192 |
| 376 | 3300042115 | Ga0450911_000109 | Ga0450911_000109_29439_30026 | 192 |
| 377 | 3300042115 | Ga0450911_000586 | Ga0450911_000586_9040_9630 | 192 |
| 378 | 3300042115 | Ga0450911_000664 | Ga0450911_000664_2717_3307 | 192 |
| 379 | 3300042115 | Ga0450911_001017 | Ga0450911_001017_1403_1993 | 192 |
| 380 | 3300042115 | Ga0450911_018217 | Ga0450911_018217_127_717 | 192 |
| 381 | 3300042124 | Ga0450922_001334 | Ga0450922_001334_13_603 | 192 |
| 382 | 3300042127 | Ga0450890_002436 | Ga0450890_002436_1755_2345 | 192 |
| 383 | 3300042136 | Ga0450900_024871 | Ga0450900_024871_77_667 | 192 |
| 384 | 3300042137 | Ga0450902_002639 | Ga0450902_002639_1044_1634 | 192 |
| 385 | 3300042137 | Ga0450902_020192 | Ga0450902_020192_415_1005 | 192 |
| 386 | 3300042138 | Ga0450903_002399 | Ga0450903_002399_576_1166 | 192 |
| 387 | 3300042139 | Ga0450904_000351 | Ga0450904_000351_8039_8626 | 192 |
| 388 | 3300042139 | Ga0450904_004766 | Ga0450904_004766_692_1282 | 192 |
| 389 | 3300042145 | Ga0450906_000113 | Ga0450906_000113_12612_13202 | 192 |
| 390 | 3300042145 | Ga0450906_007555 | Ga0450906_007555_1152_1742 | 192 |
| 391 | 3300042146 | Ga0450907_034413 | Ga0450907_034413_75_665 | 192 |
| 392 | 3300042147 | Ga0450910_003593 | Ga0450910_003593_957_1547 | 192 |
| 393 | 3300042184 | Ga0450908_010450 | Ga0450908_010450_424_1014 | 192 |
| 394 | 3300042185 | Ga0450909_000292 | Ga0450909_000292_1210_1800 | 192 |
| 395 | 3300042435 | Ga0439434_0034399 | Ga0439434_0034399_782_1372 | 192 |
| 396 | 3300042439 | Ga0439464_0020000 | Ga0439464_0020000_264_854 | 192 |
| 397 | 3300042530 | Ga0450916_000745 | Ga0450916_000745_1136_1723 | 192 |
| 398 | 3300042531 | Ga0450918_003338 | Ga0450918_003338_851_1441 | 192 |
| 399 | 3300042531 | Ga0450918_028788 | Ga0450918_028788_60_650 | 192 |
| 400 | 3300042993 | Ga0439440_0007444 | Ga0439440_0007444_1469_2059 | 192 |
| 401 | 3300045051 | Ga0451576_0499717 | Ga0451576_0499717_73_663 | 192 |
| 402 | 3300045051 | Ga0451576_1447878 | Ga0451576_1447878_60_668 | 192 |
| 403 | 3300046452 | Ga0495617_005747 | Ga0495617_005747_1979_2569 | 192 |
| 404 | 3300046452 | Ga0495617_026777 | Ga0495617_026777_1157_1747 | 192 |
| 405 | 3300046452 | Ga0495617_048235 | Ga0495617_048235_647_1237 | 192 |
| 406 | 3300046452 | Ga0495617_140815 | Ga0495617_140815_101_691 | 192 |
| 407 | 3300046452 | Ga0495617_141361 | Ga0495617_141361_123_713 | 192 |
| 408 | 3300046453 | Ga0495627_000294 | Ga0495627_000294_37446_38036 | 192 |
| 409 | 3300046453 | Ga0495627_001723 | Ga0495627_001723_9394_9984 | 192 |
| 410 | 3300046453 | Ga0495627_028962 | Ga0495627_028962_58_648 | 192 |
| 411 | 3300046454 | Ga0495592_0183625 | Ga0495592_0183625_721_1308 | 192 |
| 412 | 3300046457 | Ga0495590_0001607 | Ga0495590_0001607_8269_8859 | 192 |
| 413 | 3300046457 | Ga0495590_0064064 | Ga0495590_0064064_84_674 | 192 |
| 414 | 3300046457 | Ga0495590_0095853 | Ga0495590_0095853_305_895 | 192 |
| 415 | 3300046458 | Ga0495591_000779 | Ga0495591_000779_9164_9763 | 192 |
| 416 | 3300046458 | Ga0495591_001542 | Ga0495591_001542_2187_2777 | 192 |
| 417 | 3300046458 | Ga0495591_001583 | Ga0495591_001583_1946_2536 | 192 |
| 418 | 3300046458 | Ga0495591_006851 | Ga0495591_006851_3761_4351 | 192 |
| 419 | 3300046458 | Ga0495591_007918 | Ga0495591_007918_3250_3840 | 192 |
| 420 | 3300046458 | Ga0495591_018875 | Ga0495591_018875_1388_1978 | 192 |
| 421 | 3300046458 | Ga0495591_036133 | Ga0495591_036133_762_1352 | 192 |
| 422 | 3300046458 | Ga0495591_042273 | Ga0495591_042273_369_959 | 192 |
| 423 | 3300046458 | Ga0495591_057609 | Ga0495591_057609_392_982 | 192 |
| 424 | 3300046460 | Ga0495638_0004020 | Ga0495638_0004020_9029_9619 | 192 |
| 425 | 3300046460 | Ga0495638_0007343 | Ga0495638_0007343_416_1006 | 192 |
| 426 | 3300046460 | Ga0495638_0017011 | Ga0495638_0017011_2269_2859 | 192 |
| 427 | 3300046460 | Ga0495638_0063009 | Ga0495638_0063009_1604_2194 | 192 |
| 428 | 3300046460 | Ga0495638_0093210 | Ga0495638_0093210_184_774 | 192 |
| 429 | 3300046460 | Ga0495638_0209299 | Ga0495638_0209299_209_799 | 192 |
| 430 | 3300046471 | Ga0495650_0000252 | Ga0495650_0000252_8716_9315 | 192 |
| 431 | 3300046471 | Ga0495650_0004225 | Ga0495650_0004225_986_1576 | 192 |
| 432 | 3300046471 | Ga0495650_0006190 | Ga0495650_0006190_993_1583 | 192 |
| 433 | 3300046471 | Ga0495650_0013627 | Ga0495650_0013627_365_955 | 192 |
| 434 | 3300046471 | Ga0495650_0017220 | Ga0495650_0017220_1910_2500 | 192 |
| 435 | 3300046471 | Ga0495650_0038328 | Ga0495650_0038328_682_1272 | 192 |
| 436 | 3300046471 | Ga0495650_0113758 | Ga0495650_0113758_73_663 | 192 |
| 437 | 3300046474 | Ga0495605_0001812 | Ga0495605_0001812_1783_2373 | 192 |
| 438 | 3300046474 | Ga0495605_0003840 | Ga0495605_0003840_3761_4360 | 192 |
| 439 | 3300046474 | Ga0495605_0111437 | Ga0495605_0111437_397_987 | 192 |
| 440 | 3300046474 | Ga0495605_0120391 | Ga0495605_0120391_368_958 | 192 |
| 441 | 3300046491 | Ga0495584_0003081 | Ga0495584_0003081_6844_7434 | 192 |
| 442 | 3300046491 | Ga0495584_0008042 | Ga0495584_0008042_1213_1803 | 192 |
| 443 | 3300046491 | Ga0495584_0011758 | Ga0495584_0011758_2068_2658 | 192 |
| 444 | 3300046491 | Ga0495584_0016505 | Ga0495584_0016505_69_659 | 192 |
| 445 | 3300046491 | Ga0495584_0024704 | Ga0495584_0024704_1910_2500 | 192 |
| 446 | 3300046491 | Ga0495584_0039118 | Ga0495584_0039118_199_789 | 192 |
| 447 | 3300046491 | Ga0495584_0063013 | Ga0495584_0063013_25_624 | 192 |
| 448 | 3300046491 | Ga0495584_0092976 | Ga0495584_0092976_345_935 | 192 |
| 449 | 3300046491 | Ga0495584_0134190 | Ga0495584_0134190_137_727 | 192 |
| 450 | 3300046491 | Ga0495584_0258107 | Ga0495584_0258107_124_729 | 192 |
| 451 | 3300046492 | Ga0495585_0001397 | Ga0495585_0001397_10804_11394 | 192 |
| 452 | 3300046492 | Ga0495585_0003265 | Ga0495585_0003265_2416_3006 | 192 |
| 453 | 3300046492 | Ga0495585_0003336 | Ga0495585_0003336_1105_1704 | 192 |
| 454 | 3300046492 | Ga0495585_0010127 | Ga0495585_0010127_3494_4084 | 192 |
| 455 | 3300046492 | Ga0495585_0014588 | Ga0495585_0014588_578_1168 | 192 |
| 456 | 3300046492 | Ga0495585_0057295 | Ga0495585_0057295_1182_1772 | 192 |
| 457 | 3300046492 | Ga0495585_0058935 | Ga0495585_0058935_71_661 | 192 |
| 458 | 3300046492 | Ga0495585_0218900 | Ga0495585_0218900_293_883 | 192 |
| 459 | 3300046500 | Ga0495596_0049580 | Ga0495596_0049580_692_1294 | 192 |
| 460 | 3300046500 | Ga0495596_0114882 | Ga0495596_0114882_334_924 | 192 |
| 461 | 3300046501 | Ga0495607_0000234 | Ga0495607_0000234_1716_2321 | 192 |
| 462 | 3300046501 | Ga0495607_0002691 | Ga0495607_0002691_1786_2376 | 192 |
| 463 | 3300046501 | Ga0495607_0013818 | Ga0495607_0013818_1852_2442 | 192 |
| 464 | 3300046501 | Ga0495607_0017981 | Ga0495607_0017981_2764_3354 | 192 |
| 465 | 3300046501 | Ga0495607_0032571 | Ga0495607_0032571_245_844 | 192 |
| 466 | 3300046501 | Ga0495607_0043439 | Ga0495607_0043439_619_1209 | 192 |
| 467 | 3300046501 | Ga0495607_0072888 | Ga0495607_0072888_101_691 | 192 |
| 468 | 3300046501 | Ga0495607_0134096 | Ga0495607_0134096_347_937 | 192 |
| 469 | 3300046501 | Ga0495607_0188745 | Ga0495607_0188745_377_967 | 192 |
| 470 | 3300046506 | Ga0495583_0001199 | Ga0495583_0001199_15786_16385 | 192 |
| 471 | 3300046506 | Ga0495583_0004374 | Ga0495583_0004374_8425_9015 | 192 |
| 472 | 3300046506 | Ga0495583_0054324 | Ga0495583_0054324_646_1236 | 192 |
| 473 | 3300046507 | Ga0495606_0000027 | Ga0495606_0000027_235254_235838 | 192 |
| 474 | 3300046507 | Ga0495606_0000167 | Ga0495606_0000167_90555_91154 | 192 |
| 475 | 3300046507 | Ga0495606_0000432 | Ga0495606_0000432_29259_29858 | 192 |
| 476 | 3300046507 | Ga0495606_0004330 | Ga0495606_0004330_11074_11664 | 192 |
| 477 | 3300046507 | Ga0495606_0004584 | Ga0495606_0004584_2366_2956 | 192 |
| 478 | 3300046507 | Ga0495606_0008054 | Ga0495606_0008054_1642_2232 | 192 |
| 479 | 3300046507 | Ga0495606_0031869 | Ga0495606_0031869_275_865 | 192 |
| 480 | 3300046507 | Ga0495606_0138700 | Ga0495606_0138700_147_737 | 192 |
| 481 | 3300046507 | Ga0495606_0169322 | Ga0495606_0169322_247_837 | 192 |
| 482 | 3300046507 | Ga0495606_0188470 | Ga0495606_0188470_121_711 | 192 |
| 483 | 3300046507 | Ga0495606_0221842 | Ga0495606_0221842_110_700 | 192 |
| 484 | 3300046507 | Ga0495606_0234503 | Ga0495606_0234503_221_811 | 192 |
| 485 | 3300046512 | Ga0495610_0001754 | Ga0495610_0001754_11177_11767 | 192 |
| 486 | 3300046512 | Ga0495610_0004292 | Ga0495610_0004292_8130_8720 | 192 |
| 487 | 3300046512 | Ga0495610_0005652 | Ga0495610_0005652_1865_2455 | 192 |
| 488 | 3300046512 | Ga0495610_0036818 | Ga0495610_0036818_32_622 | 192 |
| 489 | 3300046512 | Ga0495610_0040776 | Ga0495610_0040776_1184_1774 | 192 |
| 490 | 3300046512 | Ga0495610_0042341 | Ga0495610_0042341_639_1238 | 192 |
| 491 | 3300046512 | Ga0495610_0131779 | Ga0495610_0131779_391_981 | 192 |
| 492 | 3300046512 | Ga0495610_0232050 | Ga0495610_0232050_110_700 | 192 |
| 493 | 3300046513 | Ga0495616_0002308 | Ga0495616_0002308_1164_1754 | 192 |
| 494 | 3300046513 | Ga0495616_0003473 | Ga0495616_0003473_7686_8276 | 192 |
| 495 | 3300046513 | Ga0495616_0010604 | Ga0495616_0010604_1344_1934 | 192 |
| 496 | 3300046513 | Ga0495616_0012448 | Ga0495616_0012448_1979_2569 | 192 |
| 497 | 3300046513 | Ga0495616_0018182 | Ga0495616_0018182_1292_1882 | 192 |
| 498 | 3300046515 | Ga0495620_0002095 | Ga0495620_0002095_1377_1982 | 192 |
| 499 | 3300046515 | Ga0495620_0003062 | Ga0495620_0003062_8892_9482 | 192 |
| 500 | 3300046515 | Ga0495620_0003879 | Ga0495620_0003879_6919_7509 | 192 |
| 501 | 3300046515 | Ga0495620_0004015 | Ga0495620_0004015_1371_1961 | 192 |
| 502 | 3300046518 | Ga0495631_0000149 | Ga0495631_0000149_24483_25073 | 192 |
| 503 | 3300046518 | Ga0495631_0002305 | Ga0495631_0002305_8215_8805 | 192 |
| 504 | 3300046518 | Ga0495631_0076998 | Ga0495631_0076998_530_1120 | 192 |
| 505 | 3300046518 | Ga0495631_0129927 | Ga0495631_0129927_86_676 | 192 |
| 506 | 3300046519 | Ga0495632_0030521 | Ga0495632_0030521_486_1076 | 192 |
| 507 | 3300046519 | Ga0495632_0034500 | Ga0495632_0034500_882_1481 | 192 |
| 508 | 3300046519 | Ga0495632_0036575 | Ga0495632_0036575_128_718 | 192 |
| 509 | 3300046520 | Ga0495637_0000115 | Ga0495637_0000115_5987_6586 | 192 |
| 510 | 3300046520 | Ga0495637_0001934 | Ga0495637_0001934_1124_1714 | 192 |
| 511 | 3300046520 | Ga0495637_0002446 | Ga0495637_0002446_2160_2750 | 192 |
| 512 | 3300046520 | Ga0495637_0004911 | Ga0495637_0004911_3056_3646 | 192 |
| 513 | 3300046520 | Ga0495637_0010206 | Ga0495637_0010206_3547_4137 | 192 |
| 514 | 3300046520 | Ga0495637_0010283 | Ga0495637_0010283_3496_4086 | 192 |
| 515 | 3300046520 | Ga0495637_0015761 | Ga0495637_0015761_845_1435 | 192 |
| 516 | 3300046520 | Ga0495637_0021681 | Ga0495637_0021681_1039_1629 | 192 |
| 517 | 3300046520 | Ga0495637_0038394 | Ga0495637_0038394_131_721 | 192 |
| 518 | 3300046520 | Ga0495637_0055376 | Ga0495637_0055376_468_1058 | 192 |
| 519 | 3300046520 | Ga0495637_0119874 | Ga0495637_0119874_349_939 | 192 |
| 520 | 3300046522 | Ga0495643_0000017 | Ga0495643_0000017_179859_180443 | 192 |
| 521 | 3300046522 | Ga0495643_0002097 | Ga0495643_0002097_1463_2095 | 192 |
| 522 | 3300046522 | Ga0495643_0002834 | Ga0495643_0002834_11214_11804 | 192 |
| 523 | 3300046522 | Ga0495643_0008137 | Ga0495643_0008137_3173_3772 | 192 |
| 524 | 3300046522 | Ga0495643_0095018 | Ga0495643_0095018_394_984 | 192 |
| 525 | 3300046522 | Ga0495643_0210615 | Ga0495643_0210615_26_616 | 192 |
| 526 | 3300046522 | Ga0495643_0212589 | Ga0495643_0212589_101_691 | 192 |
| 527 | 3300046523 | Ga0495644_0014553 | Ga0495644_0014553_847_1446 | 192 |
| 528 | 3300046523 | Ga0495644_0042611 | Ga0495644_0042611_31_621 | 192 |
| 529 | 3300046524 | Ga0495648_0000984 | Ga0495648_0000984_26845_27435 | 192 |
| 530 | 3300046524 | Ga0495648_0002891 | Ga0495648_0002891_13965_14564 | 192 |
| 531 | 3300046524 | Ga0495648_0005805 | Ga0495648_0005805_1670_2260 | 192 |
| 532 | 3300046524 | Ga0495648_0007492 | Ga0495648_0007492_8025_8615 | 192 |
| 533 | 3300046524 | Ga0495648_0026103 | Ga0495648_0026103_2889_3479 | 192 |
| 534 | 3300046524 | Ga0495648_0045096 | Ga0495648_0045096_407_997 | 192 |
| 535 | 3300046524 | Ga0495648_0069100 | Ga0495648_0069100_102_692 | 192 |
| 536 | 3300046524 | Ga0495648_0116778 | Ga0495648_0116778_471_1061 | 192 |
| 537 | 3300046524 | Ga0495648_0169728 | Ga0495648_0169728_499_1089 | 192 |
| 538 | 3300046529 | Ga0495652_0659055 | Ga0495652_0659055_61_648 | 192 |
| 539 | 3300046530 | Ga0495654_0000562 | Ga0495654_0000562_27212_27802 | 192 |
| 540 | 3300046530 | Ga0495654_0002377 | Ga0495654_0002377_3068_3658 | 192 |
| 541 | 3300046530 | Ga0495654_0006522 | Ga0495654_0006522_5808_6398 | 192 |
| 542 | 3300046530 | Ga0495654_0007462 | Ga0495654_0007462_1074_1673 | 192 |
| 543 | 3300046530 | Ga0495654_0041327 | Ga0495654_0041327_1366_1956 | 192 |
| 544 | 3300046530 | Ga0495654_0098420 | Ga0495654_0098420_646_1236 | 192 |
| 545 | 3300046530 | Ga0495654_0112840 | Ga0495654_0112840_507_1097 | 192 |
| 546 | 3300046530 | Ga0495654_0119617 | Ga0495654_0119617_361_951 | 192 |
| 547 | 3300046530 | Ga0495654_0140797 | Ga0495654_0140797_229_819 | 192 |
| 548 | 3300046530 | Ga0495654_0183025 | Ga0495654_0183025_111_701 | 192 |
| 549 | 3300046538 | Ga0495609_0000167 | Ga0495609_0000167_52875_53474 | 192 |
| 550 | 3300046538 | Ga0495609_0007889 | Ga0495609_0007889_432_1022 | 192 |
| 551 | 3300046538 | Ga0495609_0010937 | Ga0495609_0010937_407_997 | 192 |
| 552 | 3300046538 | Ga0495609_0128818 | Ga0495609_0128818_407_997 | 192 |
| 553 | 3300046542 | Ga0495597_0003183 | Ga0495597_0003183_1809_2399 | 192 |
| 554 | 3300046542 | Ga0495597_0076975 | Ga0495597_0076975_481_1071 | 192 |
| 555 | 3300046557 | Ga0495622_0001087 | Ga0495622_0001087_2115_2705 | 192 |
| 556 | 3300046557 | Ga0495622_0005194 | Ga0495622_0005194_32_631 | 192 |
| 557 | 3300046557 | Ga0495622_0150388 | Ga0495622_0150388_369_959 | 192 |
| 558 | 3300046558 | Ga0495633_0001003 | Ga0495633_0001003_2074_2664 | 192 |
| 559 | 3300046558 | Ga0495633_0002568 | Ga0495633_0002568_10357_10947 | 192 |
| 560 | 3300046558 | Ga0495633_0333178 | Ga0495633_0333178_83_673 | 192 |
| 561 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_68179_68781 | 192 |
| 562 | 3300046616 | Ga0495668_0003395 | Ga0495668_0003395_8825_9415 | 192 |
| 563 | 3300046616 | Ga0495668_0023851 | Ga0495668_0023851_1805_2395 | 192 |
| 564 | 3300046616 | Ga0495668_0066858 | Ga0495668_0066858_959_1549 | 192 |
| 565 | 3300046648 | Ga0495611_0000389 | Ga0495611_0000389_11408_11998 | 192 |
| 566 | 3300046648 | Ga0495611_0002128 | Ga0495611_0002128_2675_3274 | 192 |
| 567 | 3300046648 | Ga0495611_0100941 | Ga0495611_0100941_256_846 | 192 |
| 568 | 3300046648 | Ga0495611_0115178 | Ga0495611_0115178_545_1135 | 192 |
| 569 | 3300046660 | Ga0495625_0000134 | Ga0495625_0000134_46189_46788 | 192 |
| 570 | 3300046660 | Ga0495625_0001920 | Ga0495625_0001920_16051_16653 | 192 |
| 571 | 3300046660 | Ga0495625_0023743 | Ga0495625_0023743_2086_2676 | 192 |
| 572 | 3300046660 | Ga0495625_0041046 | Ga0495625_0041046_2149_2739 | 192 |
| 573 | 3300046660 | Ga0495625_0043260 | Ga0495625_0043260_2238_2828 | 192 |
| 574 | 3300046660 | Ga0495625_0093804 | Ga0495625_0093804_274_864 | 192 |
| 575 | 3300046660 | Ga0495625_0146097 | Ga0495625_0146097_566_1156 | 192 |
| 576 | 3300046660 | Ga0495625_0174420 | Ga0495625_0174420_572_1162 | 192 |
| 577 | 3300046660 | Ga0495625_0205310 | Ga0495625_0205310_212_796 | 192 |
| 578 | 3300046664 | Ga0495659_0022129 | Ga0495659_0022129_1519_2109 | 192 |
| 579 | 3300046665 | Ga0495661_0000088 | Ga0495661_0000088_5991_6590 | 192 |
| 580 | 3300046665 | Ga0495661_0008979 | Ga0495661_0008979_2167_2757 | 192 |
| 581 | 3300046665 | Ga0495661_0066139 | Ga0495661_0066139_328_918 | 192 |
| 582 | 3300046665 | Ga0495661_0071483 | Ga0495661_0071483_166_756 | 192 |
| 583 | 3300046665 | Ga0495661_0107480 | Ga0495661_0107480_795_1385 | 192 |
| 584 | 3300046665 | Ga0495661_0149759 | Ga0495661_0149759_320_910 | 192 |
| 585 | 3300046665 | Ga0495661_0161533 | Ga0495661_0161533_81_671 | 192 |
| 586 | 3300046665 | Ga0495661_0216117 | Ga0495661_0216117_85_675 | 192 |
| 587 | 3300046665 | Ga0495661_0267606 | Ga0495661_0267606_243_833 | 192 |
| 588 | 3300046674 | Ga0495588_0174771 | Ga0495588_0174771_167_757 | 192 |
| 589 | 3300046689 | Ga0495613_0149140 | Ga0495613_0149140_539_1126 | 192 |
| 590 | 3300046691 | Ga0495670_0001008 | Ga0495670_0001008_11327_11917 | 192 |
| 591 | 3300046691 | Ga0495670_0001827 | Ga0495670_0001827_7271_7861 | 192 |
| 592 | 3300046691 | Ga0495670_0034921 | Ga0495670_0034921_76_666 | 192 |
| 593 | 3300046691 | Ga0495670_0125963 | Ga0495670_0125963_355_945 | 192 |
| 594 | 3300046692 | Ga0495671_0000415 | Ga0495671_0000415_24978_25568 | 192 |
| 595 | 3300046692 | Ga0495671_0008110 | Ga0495671_0008110_3773_4357 | 192 |
| 596 | 3300046692 | Ga0495671_0032798 | Ga0495671_0032798_81_671 | 192 |
| 597 | 3300046692 | Ga0495671_0038716 | Ga0495671_0038716_1718_2308 | 192 |
| 598 | 3300046692 | Ga0495671_0058186 | Ga0495671_0058186_911_1501 | 192 |
| 599 | 3300046692 | Ga0495671_0101086 | Ga0495671_0101086_78_668 | 192 |
| 600 | 3300046694 | Ga0495649_0002749 | Ga0495649_0002749_423_1013 | 192 |
| 601 | 3300046694 | Ga0495649_0003541 | Ga0495649_0003541_3092_3676 | 192 |
| 602 | 3300046694 | Ga0495649_0015332 | Ga0495649_0015332_432_1022 | 192 |
| 603 | 3300046694 | Ga0495649_0024472 | Ga0495649_0024472_922_1512 | 192 |
| 604 | 3300046694 | Ga0495649_0051679 | Ga0495649_0051679_429_1028 | 192 |
| 605 | 3300046694 | Ga0495649_0076099 | Ga0495649_0076099_919_1503 | 192 |
| 606 | 3300046694 | Ga0495649_0091165 | Ga0495649_0091165_302_892 | 192 |
| 607 | 3300046694 | Ga0495649_0101904 | Ga0495649_0101904_275_865 | 192 |
| 608 | 3300046794 | Ga0495589_0001040 | Ga0495589_0001040_11047_11637 | 192 |
| 609 | 3300046794 | Ga0495589_0027780 | Ga0495589_0027780_884_1474 | 192 |
| 610 | 3300046794 | Ga0495589_0039648 | Ga0495589_0039648_1252_1842 | 192 |
| 611 | 3300046794 | Ga0495589_0140742 | Ga0495589_0140742_64_654 | 192 |
| 612 | 3300046810 | Ga0495660_0002844 | Ga0495660_0002844_2315_2905 | 192 |
| 613 | 3300046810 | Ga0495660_0031049 | Ga0495660_0031049_1976_2566 | 192 |
| 614 | 3300046810 | Ga0495660_0042187 | Ga0495660_0042187_1623_2213 | 192 |
| 615 | 3300046810 | Ga0495660_0067709 | Ga0495660_0067709_659_1249 | 192 |
| 616 | 3300046810 | Ga0495660_0071356 | Ga0495660_0071356_444_1043 | 192 |
| 617 | 3300046810 | Ga0495660_0078911 | Ga0495660_0078911_420_1010 | 192 |
| 618 | 3300046810 | Ga0495660_0106128 | Ga0495660_0106128_776_1366 | 192 |
| 619 | 3300046810 | Ga0495660_0126678 | Ga0495660_0126678_609_1199 | 192 |
| 620 | 3300046810 | Ga0495660_0145568 | Ga0495660_0145568_370_960 | 192 |
| 621 | 3300046810 | Ga0495660_0155903 | Ga0495660_0155903_144_728 | 192 |
| 622 | 3300046810 | Ga0495660_0176292 | Ga0495660_0176292_103_693 | 192 |
| 623 | 3300047317 | Ga0495604_0089291 | Ga0495604_0089291_1301_1888 | 192 |
| 624 | 3300047320 | Ga0495672_0003397 | Ga0495672_0003397_8045_8635 | 192 |
| 625 | 3300047320 | Ga0495672_0005137 | Ga0495672_0005137_7653_8243 | 192 |
| 626 | 3300047320 | Ga0495672_0110212 | Ga0495672_0110212_489_1079 | 192 |
| 627 | 3300047320 | Ga0495672_0135188 | Ga0495672_0135188_406_996 | 192 |
| 628 | 3300047320 | Ga0495672_0195550 | Ga0495672_0195550_386_976 | 192 |
| 629 | 3300047321 | Ga0495676_0000018 | Ga0495676_0000018_69232_69831 | 192 |
| 630 | 3300047321 | Ga0495676_0005024 | Ga0495676_0005024_10133_10723 | 192 |
| 631 | 3300047323 | Ga0495683_0000217 | Ga0495683_0000217_16035_16625 | 192 |
| 632 | 3300047323 | Ga0495683_0045859 | Ga0495683_0045859_556_1146 | 192 |
| 633 | 3300047323 | Ga0495683_0066167 | Ga0495683_0066167_536_1126 | 192 |
| 634 | 3300047323 | Ga0495683_0244836 | Ga0495683_0244836_68_658 | 192 |
| 635 | 3300047446 | Ga0495679_001426 | Ga0495679_001426_11154_11744 | 192 |
| 636 | 3300047446 | Ga0495679_002236 | Ga0495679_002236_9357_9947 | 192 |
| 637 | 3300047446 | Ga0495679_008371 | Ga0495679_008371_1883_2473 | 192 |
| 638 | 3300047446 | Ga0495679_031744 | Ga0495679_031744_590_1180 | 192 |
| 639 | 3300047469 | Ga0495673_0001075 | Ga0495673_0001075_11662_12252 | 192 |
| 640 | 3300047469 | Ga0495673_0002192 | Ga0495673_0002192_11270_11860 | 192 |
| 641 | 3300047469 | Ga0495673_0003526 | Ga0495673_0003526_1817_2407 | 192 |
| 642 | 3300047469 | Ga0495673_0004319 | Ga0495673_0004319_93_683 | 192 |
| 643 | 3300047469 | Ga0495673_0007446 | Ga0495673_0007446_1033_1623 | 192 |
| 644 | 3300047469 | Ga0495673_0056910 | Ga0495673_0056910_530_1129 | 192 |
| 645 | 3300047469 | Ga0495673_0077146 | Ga0495673_0077146_384_974 | 192 |
| 646 | 3300047469 | Ga0495673_0212344 | Ga0495673_0212344_52_642 | 192 |
| 647 | 3300047470 | Ga0495681_0003361 | Ga0495681_0003361_8723_9313 | 192 |
| 648 | 3300047470 | Ga0495681_0008798 | Ga0495681_0008798_3720_4310 | 192 |
| 649 | 3300047470 | Ga0495681_0009250 | Ga0495681_0009250_2141_2731 | 192 |
| 650 | 3300047470 | Ga0495681_0015123 | Ga0495681_0015123_3561_4151 | 192 |
| 651 | 3300047470 | Ga0495681_0018432 | Ga0495681_0018432_2791_3390 | 192 |
| 652 | 3300047470 | Ga0495681_0033755 | Ga0495681_0033755_1865_2455 | 192 |
| 653 | 3300047470 | Ga0495681_0034021 | Ga0495681_0034021_639_1229 | 192 |
| 654 | 3300047470 | Ga0495681_0055225 | Ga0495681_0055225_546_1136 | 192 |
| 655 | 3300047470 | Ga0495681_0093808 | Ga0495681_0093808_339_929 | 192 |
| 656 | 3300047470 | Ga0495681_0099802 | Ga0495681_0099802_216_806 | 192 |
| 657 | 3300047472 | Ga0495686_0003379 | Ga0495686_0003379_11363_11953 | 192 |
| 658 | 3300047472 | Ga0495686_0007931 | Ga0495686_0007931_6424_7014 | 192 |
| 659 | 3300047472 | Ga0495686_0008555 | Ga0495686_0008555_2677_3276 | 192 |
| 660 | 3300047472 | Ga0495686_0266678 | Ga0495686_0266678_315_905 | 192 |
| 661 | 3300048088 | Ga0495602_0008372 | Ga0495602_0008372_1063_1653 | 192 |
| 662 | 3300048091 | Ga0495626_0000172 | Ga0495626_0000172_71118_71708 | 192 |
| 663 | 3300048091 | Ga0495626_0000216 | Ga0495626_0000216_15438_16037 | 192 |
| 664 | 3300048091 | Ga0495626_0007749 | Ga0495626_0007749_1966_2556 | 192 |
| 665 | 3300048091 | Ga0495626_0011815 | Ga0495626_0011815_1607_2197 | 192 |
| 666 | 3300048091 | Ga0495626_0064937 | Ga0495626_0064937_899_1489 | 192 |
| 667 | 3300048091 | Ga0495626_0069190 | Ga0495626_0069190_561_1151 | 192 |
| 668 | 3300048091 | Ga0495626_0075810 | Ga0495626_0075810_404_994 | 192 |
| 669 | 3300048091 | Ga0495626_0103034 | Ga0495626_0103034_489_1079 | 192 |
| 670 | 3300048905 | Ga0496102_0090487 | Ga0496102_0090487_794_1399 | 192 |
| 671 | 3300048906 | Ga0496103_0337393 | Ga0496103_0337393_131_736 | 192 |
| 672 | 3300048915 | Ga0496112_0232886 | Ga0496112_0232886_1185_1781 | 192 |
| 673 | 3300048919 | Ga0496116_0000936 | Ga0496116_0000936_1948_2538 | 192 |
| 674 | 3300048919 | Ga0496116_0003902 | Ga0496116_0003902_54_644 | 192 |
| 675 | 3300048919 | Ga0496116_0193619 | Ga0496116_0193619_186_791 | 192 |
| 676 | 3300048921 | Ga0496118_0202442 | Ga0496118_0202442_135_740 | 192 |
| 677 | 3300048924 | Ga0496121_0008363 | Ga0496121_0008363_5439_6044 | 192 |
| 678 | 3300048924 | Ga0496121_0071244 | Ga0496121_0071244_562_1152 | 192 |
| 679 | 3300048925 | Ga0496122_0034067 | Ga0496122_0034067_491_1096 | 192 |
| 680 | 3300048926 | Ga0496123_0093014 | Ga0496123_0093014_486_1091 | 192 |
| 681 | 3300048927 | Ga0496124_0020565 | Ga0496124_0020565_3524_4108 | 192 |
| 682 | 3300048927 | Ga0496124_0402695 | Ga0496124_0402695_301_891 | 192 |
| 683 | 3300048928 | Ga0496125_0094321 | Ga0496125_0094321_524_1114 | 192 |
| 684 | 3300048929 | Ga0496126_0568843 | Ga0496126_0568843_251_853 | 192 |
| 685 | 3300049459 | Ga0495678_002211 | Ga0495678_002211_1836_2426 | 192 |
| 686 | 3300049459 | Ga0495678_002245 | Ga0495678_002245_2215_2805 | 192 |
| 687 | 3300049459 | Ga0495678_002671 | Ga0495678_002671_2234_2824 | 192 |
| 688 | 3300049459 | Ga0495678_010990 | Ga0495678_010990_3181_3771 | 192 |
| 689 | 3300049459 | Ga0495678_031180 | Ga0495678_031180_1582_2172 | 192 |
| 690 | 3300049459 | Ga0495678_067754 | Ga0495678_067754_425_1015 | 192 |
| 691 | 3300049459 | Ga0495678_092940 | Ga0495678_092940_109_699 | 192 |
| 692 | 3300049460 | Ga0495682_0047811 | Ga0495682_0047811_907_1497 | 192 |
| 693 | 3300049568 | Ga0501031_0108655 | Ga0501031_0108655_765_1364 | 192 |
| 694 | 3300049569 | Ga0501032_0025564 | Ga0501032_0025564_599_1198 | 192 |
| 695 | 3300049571 | Ga0501034_0108480 | Ga0501034_0108480_1159_1758 | 192 |
| 696 | 3300049572 | Ga0501036_0009156 | Ga0501036_0009156_6339_6938 | 192 |
| 697 | 3300049574 | Ga0501038_0017779 | Ga0501038_0017779_748_1347 | 192 |
| 698 | 3300049575 | Ga0501039_0043147 | Ga0501039_0043147_981_1580 | 192 |
| 699 | 3300049575 | Ga0501039_0158740 | Ga0501039_0158740_638_1246 | 192 |
| 700 | 3300049579 | Ga0501043_0021833 | Ga0501043_0021833_3815_4423 | 192 |
| 701 | 3300049579 | Ga0501043_0099213 | Ga0501043_0099213_541_1140 | 192 |
| 702 | 3300049580 | Ga0501046_0231046 | Ga0501046_0231046_305_904 | 192 |
| 703 | 3300049581 | Ga0501047_0000598 | Ga0501047_0000598_30983_31591 | 192 |
| 704 | 3300049582 | Ga0501048_0288221 | Ga0501048_0288221_374_973 | 192 |
| 705 | 3300049583 | Ga0501067_0009501 | Ga0501067_0009501_44_652 | 192 |
| 706 | 3300049584 | Ga0501068_0000042 | Ga0501068_0000042_36757_37365 | 192 |
| 707 | 3300049585 | Ga0501069_0005495 | Ga0501069_0005495_4123_4731 | 192 |
| 708 | 3300049586 | Ga0501070_0130393 | Ga0501070_0130393_1317_1925 | 192 |
| 709 | 3300049588 | Ga0501072_0000004 | Ga0501072_0000004_138062_138670 | 192 |
| 710 | 3300049589 | Ga0501073_0462574 | Ga0501073_0462574_249_842 | 192 |
| 711 | 3300049590 | Ga0501074_0003700 | Ga0501074_0003700_9072_9680 | 192 |
| 712 | 3300049591 | Ga0501075_0572193 | Ga0501075_0572193_168_776 | 192 |
| 713 | 3300049592 | Ga0501076_0005826 | Ga0501076_0005826_4674_5282 | 192 |
| 714 | 3300049593 | Ga0501077_0004746 | Ga0501077_0004746_3700_4308 | 192 |
| 715 | 3300049673 | Ga0501240_003085 | Ga0501240_003085_1027_1617 | 192 |
| 716 | 3300049741 | Ga0501079_0011435 | Ga0501079_0011435_5276_5884 | 192 |
| 717 | 3300049742 | Ga0501080_0024373 | Ga0501080_0024373_4120_4728 | 192 |
| 718 | 3300049744 | Ga0501083_0004101 | Ga0501083_0004101_5925_6533 | 192 |
| 719 | 3300049776 | Ga0501280_007577 | Ga0501280_007577_150_752 | 192 |
| 720 | 3300049822 | Ga0501035_0127922 | Ga0501035_0127922_1345_1944 | 192 |
| 721 | 3300049822 | Ga0501035_0807838 | Ga0501035_0807838_103_693 | 192 |
| 722 | 3300049823 | Ga0501044_0032096 | Ga0501044_0032096_4385_4993 | 192 |
| 723 | 3300049853 | Ga0501226_000006 | Ga0501226_000006_168574_169161 | 192 |
| 724 | 3300050491 | nmdc:mga00v17_441996_c1 | nmdc:mga00v17_441996_c1_40_630 | 192 |
| 725 | 3300053111 | Ga0500572_001081 | Ga0500572_001081_5548_6138 | 192 |
| 726 | 3300053116 | Ga0500592_005174 | Ga0500592_005174_118_720 | 192 |
| 727 | 3300053139 | Ga0500568_0016977 | Ga0500568_0016977_1249_1851 | 192 |
| 728 | 3300053158 | Ga0500627_0000149 | Ga0500627_0000149_6724_7326 | 192 |
| 729 | 3300053722 | Ga0500649_155733 | Ga0500649_155733_102_692 | 192 |
| 730 | 3300054114 | Ga0501084_0000552 | Ga0501084_0000552_8683_9291 | 192 |
| 731 | 3300059505 | Ga0587083_0002115 | Ga0587083_0002115_988_1587 | 192 |
| 732 | 3300059508 | Ga0587088_015475 | Ga0587088_015475_201_800 | 192 |
| 733 | 3300059640 | Ga0587067_025154 | Ga0587067_025154_321_920 | 192 |
| 734 | 3300060353 | Ga0501082_0015460 | Ga0501082_0015460_3238_3846 | 192 |
| 735 | 3300061734 | Ga0530510_0015841 | Ga0530510_0015841_4343_4951 | 192 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n71-assembly3.cif.gz_D | x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz | 0.8268 | 29 | 179 |
| 4mln-assembly1.cif.gz_A | crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid | 0.8191 | 29 | 180 |
| 4n71-assembly4.cif.gz_E | x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz | 0.819 | 29 | 179 |
| 4n6w-assembly1.cif.gz_A | x-ray crystal structure of citrate-bound phnz | 0.8124 | 29 | 180 |
| 4mln-assembly2.cif.gz_B | crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid | 0.7958 | 29 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7958 | 29 | 180 | 1.10.3210.10 |
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6741 | 29 | 180 | 1.10.3210.10 |
| af_A0A1D6P1M6_55_306_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5964 | 14 | 179 | 1.10.3210.10 |
| af_P9WN29_336_562_1.10.3090.10 | Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 | 0.5741 | 57 | 174 | 1.10.3090.10 |
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5737 | 22 | 184 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5TDX1-F1-model_v4 | deleted | 0.994 | 2 | 190 |
|
| AF-A0A848QJA5-F1-model_v4 | HD domain-containing protein | 0.9938 | 1 | 186 |
|
| AF-A0A2U0VKN6-F1-model_v4 | deleted | 0.9932 | 2 | 188 |
|
| AF-A0A0K6HUR8-F1-model_v4 | deleted | 0.9921 | 1 | 191 |
|
| AF-A0A7Y1TB96-F1-model_v4 | HD domain-containing protein | 0.9914 | 10 | 176 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar