F478158

General Info

Members Datasets Scaffolds Average Seq Length
734 332 1468 250

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0016643|Ga0395901_0016643_1081_1836
Length 251
Sequence MKILVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEIVAVSCGVTQCQETLRTAMAIGADRAILVETPADLELQPLAVAKLLKAVVDKEQPQLVILGKQAIDDDCNQTGQMLAALLDWPQATFASKLTVADGKASVTREVDGGLETLSLTLPAIVTTDLRLNEPRYVTLPNIMKAKKKPLDTVQPADLGVDVAPRLKTLKVAEPPKRSAGIKVPDVATLVDKLKNEAKVI

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
198 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
301 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
302 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
308 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
314 2534681786 Brucella suis 92/29 Isolate Unclassified
315 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
316 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
317 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
318 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
319 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
320 2751185800 Brucella pituitosa AA2 Isolate Unclassified
321 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
322 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
323 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
324 2842711865 Duganella sp. R-73148 Isolate Unclassified
325 2854911287 Brucella lupini LUP21 Isolate Unclassified
326 2855730933 Achromobacter sp. HZ28 Isolate Nodule
327 2855767633 Achromobacter sp. HZ34 Isolate Nodule
328 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
329 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
330 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
331 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
332 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0.14
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 0.41
Rhizoplane 2.32
Rhizosphere 89.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0016643 3300038443 Bacteria 7491
2 JGI24740J21852_10078825 3300001979 Bacteria 867
3 Ga0070658_10007411 3300005327 Bacteria 8859
4 Ga0070676_10010301 3300005328 Bacteria 5069
5 Ga0070676_10169957 3300005328 Bacteria 1409
6 Ga0070676_10239067 3300005328 Bacteria 1207
7 Ga0070683_100008427 3300005329 Bacteria 8756
8 Ga0070690_100056989 3300005330 Bacteria 2507
9 Ga0070670_100192158 3300005331 Bacteria 1773
10 Ga0070670_100257209 3300005331 Bacteria 1522
11 Ga0070677_10000303 3300005333 Bacteria 17204
12 Ga0070677_10020974 3300005333 Bacteria 2390
13 Ga0068869_100066857 3300005334 Bacteria 2650
14 Ga0070666_10007495 3300005335 Bacteria 6726
15 Ga0070666_10010571 3300005335 Bacteria 5776
16 Ga0070666_10371291 3300005335 Bacteria 1026
17 Ga0070680_100073271 3300005336 Bacteria 2816
18 Ga0068868_100000202 3300005338 Bacteria 40069
19 Ga0068868_100426788 3300005338 Bacteria 1149
20 Ga0068868_100551771 3300005338 Bacteria 1016
21 Ga0070660_100004342 3300005339 Bacteria 9795
22 Ga0070660_100012151 3300005339 Bacteria 6148
23 Ga0070660_100054219 3300005339 Bacteria 3095
24 Ga0070660_100063163 3300005339 Bacteria 2878
25 Ga0070660_100166387 3300005339 Bacteria 1779
26 Ga0070689_100068704 3300005340 Bacteria 2764
27 Ga0070689_100084918 3300005340 Bacteria 2489
28 Ga0070689_100517755 3300005340 Bacteria 1024
29 Ga0070661_100002674 3300005344 Bacteria 12199
30 Ga0070661_100005346 3300005344 Bacteria 8859
31 Ga0070661_100053473 3300005344 Bacteria 2956
32 Ga0070661_100189793 3300005344 Bacteria 1567
33 Ga0070661_100234980 3300005344 Bacteria 1410
34 Ga0070692_10012611 3300005345 Bacteria 3918
35 Ga0070668_100001226 3300005347 Bacteria 18239
36 Ga0070668_100013228 3300005347 Bacteria 6155
37 Ga0070668_100021611 3300005347 Bacteria 4861
38 Ga0070668_100030266 3300005347 Bacteria 4116
39 Ga0070668_100321385 3300005347 Bacteria 1303
40 Ga0070669_100011290 3300005353 Bacteria 6342
41 Ga0070669_100135950 3300005353 Bacteria 1891
42 Ga0070675_100004894 3300005354 Bacteria 10218
43 Ga0070675_100018428 3300005354 Bacteria 5555
44 Ga0070675_100020120 3300005354 Bacteria 5325
45 Ga0070675_100028350 3300005354 Bacteria 4507
46 Ga0070675_100189929 3300005354 Bacteria 1779
47 Ga0070671_100005030 3300005355 Bacteria 10541
48 Ga0070671_100007991 3300005355 Bacteria 8466
49 Ga0070671_100083526 3300005355 Bacteria 2670
50 Ga0070674_100000310 3300005356 Bacteria 23996
51 Ga0070674_100040277 3300005356 Bacteria 3160
52 Ga0070674_100091895 3300005356 Bacteria 2193
53 Ga0070674_100138643 3300005356 Bacteria 1823
54 Ga0070673_100000377 3300005364 Bacteria 23358
55 Ga0070673_100015977 3300005364 Bacteria 5291
56 Ga0070673_100024384 3300005364 Bacteria 4435
57 Ga0070673_100035279 3300005364 Bacteria 3791
58 Ga0070673_100045407 3300005364 Bacteria 3407
59 Ga0070673_100171359 3300005364 Bacteria 1853
60 Ga0070659_100002822 3300005366 Bacteria 12364
61 Ga0070659_100039163 3300005366 Bacteria 3699
62 Ga0070659_100171595 3300005366 Bacteria 1777
63 Ga0070667_100009129 3300005367 Bacteria 8205
64 Ga0070667_100021029 3300005367 Bacteria 5421
65 Ga0070667_100126024 3300005367 Bacteria 2231
66 Ga0070667_100322824 3300005367 Bacteria 1393
67 Ga0070709_10032614 3300005434 Bacteria 3142
68 Ga0070709_10503515 3300005434 Bacteria 920
69 Ga0070714_100001888 3300005435 Bacteria 15291
70 Ga0070714_100112229 3300005435 Bacteria 2415
71 Ga0070714_100143716 3300005435 Bacteria 2144
72 Ga0070714_100448063 3300005435 Bacteria 1226
73 Ga0070713_100051580 3300005436 Bacteria 3402
74 Ga0070710_10013243 3300005437 Bacteria 4124
75 Ga0070705_100107555 3300005440 Bacteria 1775
76 Ga0070700_100000389 3300005441 Bacteria 22607
77 Ga0070694_100123770 3300005444 Bacteria 1859
78 Ga0070708_100052118 3300005445 Bacteria 3627
79 Ga0070663_100000590 3300005455 Bacteria 19317
80 Ga0070663_100141421 3300005455 Bacteria 1838
81 Ga0070663_100163345 3300005455 Bacteria 1716
82 Ga0070663_100498446 3300005455 Bacteria 1011
83 Ga0070678_100002811 3300005456 Bacteria 9619
84 Ga0070678_100091988 3300005456 Bacteria 2329
85 Ga0070662_100055724 3300005457 Bacteria 2869
86 Ga0070662_100121970 3300005457 Bacteria 1999
87 Ga0070681_10012100 3300005458 Bacteria 8556
88 Ga0070681_10042339 3300005458 Bacteria 4564
89 Ga0070681_10113222 3300005458 Bacteria 2653
90 Ga0068867_100004591 3300005459 Bacteria 9712
91 Ga0068867_100017430 3300005459 Bacteria 5103
92 Ga0068867_100024393 3300005459 Bacteria 4333
93 Ga0068867_100030016 3300005459 Bacteria 3920
94 Ga0068867_100096522 3300005459 Bacteria 2251
95 Ga0068867_100374839 3300005459 Bacteria 1194
96 Ga0068867_100383796 3300005459 Bacteria 1181
97 Ga0070685_10014848 3300005466 Bacteria 4130
98 Ga0070706_100144128 3300005467 Bacteria 2224
99 Ga0070706_100167220 3300005467 Bacteria 2053
100 Ga0070706_100241043 3300005467 Bacteria 1688
101 Ga0070698_100003313 3300005471 Bacteria 17719
102 Ga0070698_100366248 3300005471 Bacteria 1373
103 Ga0070699_100001885 3300005518 Bacteria 18942
104 Ga0070699_100024597 3300005518 Bacteria 5191
105 Ga0070679_100005852 3300005530 Bacteria 11410
106 Ga0070679_100007564 3300005530 Bacteria 10161
107 Ga0070679_100021550 3300005530 Bacteria 6293
108 Ga0070679_100221193 3300005530 Bacteria 1854
109 Ga0070679_100819547 3300005530 Bacteria 874
110 Ga0070679_100887894 3300005530 Bacteria 835
111 Ga0070684_100001171 3300005535 Bacteria 18817
112 Ga0070684_100005136 3300005535 Bacteria 10008
113 Ga0070697_100104285 3300005536 Bacteria 2358
114 Ga0068853_100001630 3300005539 Bacteria 16404
115 Ga0068853_100053634 3300005539 Bacteria 3472
116 Ga0068853_100082326 3300005539 Bacteria 2819
117 Ga0068853_100119321 3300005539 Bacteria 2351
118 Ga0068853_100207744 3300005539 Bacteria 1784
119 Ga0068853_100255155 3300005539 Bacteria 1611
120 Ga0068853_100349604 3300005539 Bacteria 1375
121 Ga0068853_100582658 3300005539 Bacteria 1062
122 Ga0070672_100000154 3300005543 Bacteria 37910
123 Ga0070672_100012524 3300005543 Bacteria 5959
124 Ga0070672_100028014 3300005543 Bacteria 4210
125 Ga0070672_100030677 3300005543 Bacteria 4041
126 Ga0070672_100036976 3300005543 Bacteria 3723
127 Ga0070672_100055143 3300005543 Bacteria 3113
128 Ga0070672_100118285 3300005543 Bacteria 2167
129 Ga0070672_100169363 3300005543 Bacteria 1816
130 Ga0070695_100095318 3300005545 Bacteria 1994
131 Ga0070696_100068958 3300005546 Bacteria 2484
132 Ga0070696_100075437 3300005546 Bacteria 2379
133 Ga0070696_100144725 3300005546 Bacteria 1740
134 Ga0070693_100000664 3300005547 Bacteria 15219
135 Ga0070693_100029155 3300005547 Bacteria 3008
136 Ga0070665_100001485 3300005548 Bacteria 27386
137 Ga0070665_100002599 3300005548 Bacteria 19719
138 Ga0070665_100016813 3300005548 Bacteria 7334
139 Ga0070665_100113299 3300005548 Bacteria 2715
140 Ga0070665_100453913 3300005548 Bacteria 1291
141 Ga0068855_100000453 3300005563 Bacteria 50677
142 Ga0068855_100021038 3300005563 Bacteria 7823
143 Ga0068855_100023304 3300005563 Bacteria 7414
144 Ga0068855_100032340 3300005563 Bacteria 6247
145 Ga0068855_100040480 3300005563 Bacteria 5531
146 Ga0068855_100071949 3300005563 Bacteria 4019
147 Ga0068855_100202606 3300005563 Bacteria 2233
148 Ga0070664_100007881 3300005564 Bacteria 8603
149 Ga0070664_100022623 3300005564 Bacteria 5183
150 Ga0070664_100055758 3300005564 Bacteria 3357
151 Ga0070664_100135705 3300005564 Bacteria 2163
152 Ga0070664_100269620 3300005564 Bacteria 1533
153 Ga0068857_100009699 3300005577 Bacteria 8366
154 Ga0068857_100011559 3300005577 Bacteria 7680
155 Ga0068854_100327529 3300005578 Bacteria 1247
156 Ga0068856_100079751 3300005614 Bacteria 3246
157 Ga0068856_100095318 3300005614 Bacteria 2964
158 Ga0068856_100130033 3300005614 Bacteria 2522
159 Ga0068856_100272361 3300005614 Bacteria 1709
160 Ga0068856_100526687 3300005614 Bacteria 1203
161 Ga0070702_100090588 3300005615 Bacteria 1854
162 Ga0068852_100006808 3300005616 Bacteria 8298
163 Ga0068852_100014848 3300005616 Bacteria 6018
164 Ga0068852_100039716 3300005616 Bacteria 3964
165 Ga0068852_100112109 3300005616 Bacteria 2481
166 Ga0068852_100172530 3300005616 Bacteria 2028
167 Ga0068852_100226062 3300005616 Bacteria 1782
168 Ga0068852_100425308 3300005616 Bacteria 1311
169 Ga0068852_100510253 3300005616 Bacteria 1198
170 Ga0068859_100442671 3300005617 Bacteria 1396
171 Ga0068859_100784661 3300005617 Bacteria 1041
172 Ga0068864_100000871 3300005618 Bacteria 25420
173 Ga0068864_100031930 3300005618 Bacteria 4471
174 Ga0068864_100147230 3300005618 Bacteria 2130
175 Ga0068866_10003537 3300005718 Bacteria 6399
176 Ga0068866_10056517 3300005718 Bacteria 2018
177 Ga0068866_10131774 3300005718 Bacteria 1423
178 Ga0068861_100000316 3300005719 Bacteria 27077
179 Ga0068861_100004991 3300005719 Bacteria 8943
180 Ga0068851_10000162 3300005834 Bacteria 34956
181 Ga0068851_10004370 3300005834 Bacteria 6363
182 Ga0068851_10017787 3300005834 Bacteria 3419
183 Ga0068870_10039511 3300005840 Bacteria 2442
184 Ga0068870_10123732 3300005840 Bacteria 1493
185 Ga0068870_10306147 3300005840 Bacteria 1005
186 Ga0068863_100006936 3300005841 Bacteria 11104
187 Ga0068863_100010991 3300005841 Bacteria 8779
188 Ga0068863_100108141 3300005841 Bacteria 2647
189 Ga0068863_100223289 3300005841 Bacteria 1815
190 Ga0068858_100072757 3300005842 Bacteria 3189
191 Ga0068858_100150752 3300005842 Bacteria 2186
192 Ga0068860_100074217 3300005843 Bacteria 3234
193 Ga0068860_100243430 3300005843 Bacteria 1750
194 Ga0068862_100057288 3300005844 Bacteria 3341
195 Ga0068862_100123419 3300005844 Bacteria 2285
196 Ga0075364_10209920 3300006051 Bacteria 1320
197 Ga0075432_10007467 3300006058 Bacteria 3724
198 Ga0075362_10043316 3300006177 Bacteria 1993
199 Ga0075366_10063992 3300006195 Bacteria 2187
200 Ga0097621_100009127 3300006237 Bacteria 7186
201 Ga0097621_100030201 3300006237 Bacteria 4287
202 Ga0068871_100010900 3300006358 Bacteria 6655
203 Ga0068871_100075325 3300006358 Bacteria 2786
204 Ga0075434_100609147 3300006871 Bacteria 1111
205 Ga0075429_100069086 3300006880 Bacteria 3076
206 Ga0068865_100003157 3300006881 Bacteria 9864
207 Ga0068865_100012280 3300006881 Bacteria 5387
208 Ga0075436_100018225 3300006914 Bacteria 4808
209 Ga0075436_100227664 3300006914 Bacteria 1324
210 Ga0097620_100010242 3300006931 Bacteria 9436
211 Ga0097620_100442683 3300006931 Bacteria 1396
212 Ga0097620_100784535 3300006931 Bacteria 1041
213 Ga0105240_10005452 3300009093 Bacteria 18958
214 Ga0105240_10005556 3300009093 Bacteria 18767
215 Ga0105240_10009189 3300009093 Bacteria 14018
216 Ga0105240_10071585 3300009093 Bacteria 4287
217 Ga0105240_10121999 3300009093 Bacteria 3137
218 Ga0105240_10696894 3300009093 Bacteria 1109
219 Ga0111539_10004114 3300009094 Bacteria 19083
220 Ga0111539_10158467 3300009094 Bacteria 2648
221 Ga0111539_10207054 3300009094 Bacteria 2286
222 Ga0111539_11125707 3300009094 Bacteria 912
223 Ga0111539_11176176 3300009094 Bacteria 891
224 Ga0105245_10108460 3300009098 Bacteria 2579
225 Ga0105245_10202208 3300009098 Bacteria 1908
226 Ga0105243_10038652 3300009148 Bacteria 3717
227 Ga0105241_10001153 3300009174 Bacteria 20106
228 Ga0105241_10286296 3300009174 Bacteria 1409
229 Ga0105242_10002660 3300009176 Bacteria 14000
230 Ga0105248_10015640 3300009177 Bacteria 8364
231 Ga0105248_10096242 3300009177 Bacteria 3334
232 Ga0105248_10237679 3300009177 Bacteria 2051
233 Ga0105237_10006464 3300009545 Bacteria 12995
234 Ga0105237_10261443 3300009545 Bacteria 1733
235 Ga0105237_10299783 3300009545 Bacteria 1610
236 Ga0105237_10423989 3300009545 Bacteria 1336
237 Ga0105238_10002904 3300009551 Bacteria 17122
238 Ga0105238_10014966 3300009551 Bacteria 7854
239 Ga0105238_10070887 3300009551 Bacteria 3483
240 Ga0105238_10085095 3300009551 Bacteria 3151
241 Ga0105249_10050559 3300009553 Bacteria 3789
242 Ga0105249_10714541 3300009553 Bacteria 1063
243 Ga0099796_10143091 3300010159 Bacteria 936
244 Ga0105239_10021891 3300010375 Bacteria 7048
245 Ga0105239_10037066 3300010375 Bacteria 5349
246 Ga0105239_10449320 3300010375 Bacteria 1462
247 Ga0105239_10674763 3300010375 Bacteria 1181
248 Ga0157373_10001625 3300013100 Bacteria 17155
249 Ga0157373_10002315 3300013100 Bacteria 14434
250 Ga0157373_10131286 3300013100 Bacteria 1762
251 Ga0157371_10006118 3300013102 Bacteria 10004
252 Ga0157371_10198392 3300013102 Bacteria 1438
253 Ga0157370_10010719 3300013104 Bacteria 9640
254 Ga0157370_10013088 3300013104 Bacteria 8563
255 Ga0157370_10039789 3300013104 Bacteria 4542
256 Ga0157370_10041188 3300013104 Bacteria 4459
257 Ga0157370_10047695 3300013104 Bacteria 4105
258 Ga0157370_10066646 3300013104 Bacteria 3404
259 Ga0157370_10092245 3300013104 Bacteria 2843
260 Ga0157370_10349031 3300013104 Bacteria 1364
261 Ga0157370_10515518 3300013104 Bacteria 1098
262 Ga0157369_10018507 3300013105 Bacteria 7809
263 Ga0157369_10068397 3300013105 Bacteria 3816
264 Ga0157369_10086410 3300013105 Bacteria 3350
265 Ga0157369_10419440 3300013105 Bacteria 1387
266 Ga0157374_10002469 3300013296 Bacteria 15618
267 Ga0157374_10024112 3300013296 Bacteria 5450
268 Ga0157374_10310029 3300013296 Bacteria 1562
269 Ga0157374_10494809 3300013296 Bacteria 1227
270 Ga0157374_10523599 3300013296 Bacteria 1192
271 Ga0157378_10045990 3300013297 Bacteria 3880
272 Ga0157378_10198283 3300013297 Bacteria 1897
273 Ga0157378_10254941 3300013297 Bacteria 1681
274 Ga0157378_10739708 3300013297 Bacteria 1006
275 Ga0157378_10751920 3300013297 Bacteria 998
276 Ga0163162_10014407 3300013306 Bacteria 7727
277 Ga0163162_10133422 3300013306 Bacteria 2593
278 Ga0163162_10142267 3300013306 Bacteria 2513
279 Ga0163162_10242048 3300013306 Bacteria 1935
280 Ga0157372_10008916 3300013307 Bacteria 10656
281 Ga0157372_10028729 3300013307 Bacteria 6071
282 Ga0157372_10048489 3300013307 Bacteria 4721
283 Ga0157372_10106261 3300013307 Bacteria 3211
284 Ga0157372_10175351 3300013307 Bacteria 2481
285 Ga0157375_10001062 3300013308 Bacteria 23741
286 Ga0157375_10008634 3300013308 Bacteria 8923
287 Ga0157375_10672425 3300013308 Bacteria 1190
288 Ga0163163_11008069 3300014325 Bacteria 896
289 Ga0182008_10088059 3300014497 Bacteria 1530
290 Ga0182008_10094444 3300014497 Bacteria 1475
291 Ga0157377_10006333 3300014745 Bacteria 5637
292 Ga0157379_10111123 3300014968 Bacteria 2461
293 Ga0157376_10032804 3300014969 Bacteria 4173
294 Ga0157376_10198234 3300014969 Bacteria 1845
295 Ga0163161_10012661 3300017792 Bacteria 5859
296 Ga0163161_10189905 3300017792 Bacteria 1579
297 Ga0163161_10509870 3300017792 Bacteria 981
298 Ga0206351_10961181 3300020077 Eukaryota 831
299 Ga0213872_10000191 3300021361 Bacteria 54643
300 Ga0213872_10134565 3300021361 Bacteria 1087
301 Ga0213874_10019065 3300021377 Bacteria 1863
302 Ga0213876_10010100 3300021384 Bacteria 5073
303 Ga0213876_10128763 3300021384 Bacteria 1345
304 Ga0213871_10005091 3300021441 Bacteria 2686
305 Ga0213871_10020431 3300021441 Bacteria 1640
306 Ga0209025_1000040 3300025294 Bacteria 376228
307 Ga0207697_10005684 3300025315 Bacteria 5754
308 Ga0207697_10199249 3300025315 Bacteria 880
309 Ga0207656_10000949 3300025321 Bacteria 9470
310 Ga0207656_10001351 3300025321 Bacteria 8089
311 Ga0207656_10023192 3300025321 Bacteria 2496
312 Ga0207656_10115911 3300025321 Bacteria 1243
313 Ga0207682_10000069 3300025893 Bacteria 45399
314 Ga0207682_10044012 3300025893 Bacteria 1829
315 Ga0207642_10057581 3300025899 Bacteria 1789
316 Ga0207688_10059946 3300025901 Bacteria 2143
317 Ga0207680_10013991 3300025903 Bacteria 4137
318 Ga0207680_10168905 3300025903 Bacteria 1472
319 Ga0207699_10025473 3300025906 Bacteria 3248
320 Ga0207645_10001232 3300025907 Bacteria 21068
321 Ga0207645_10002497 3300025907 Bacteria 14438
322 Ga0207645_10089973 3300025907 Bacteria 1974
323 Ga0207705_10020554 3300025909 Bacteria 4714
324 Ga0207705_10028966 3300025909 Bacteria 3949
325 Ga0207705_10029460 3300025909 Bacteria 3913
326 Ga0207705_10645846 3300025909 Bacteria 823
327 Ga0207684_10111542 3300025910 Bacteria 2341
328 Ga0207684_10434069 3300025910 Bacteria 1128
329 Ga0207654_10008354 3300025911 Bacteria 5229
330 Ga0207707_10006272 3300025912 Bacteria 10385
331 Ga0207707_10012306 3300025912 Bacteria 7436
332 Ga0207707_10033902 3300025912 Bacteria 4468
333 Ga0207707_10110405 3300025912 Bacteria 2404
334 Ga0207707_10336073 3300025912 Bacteria 1303
335 Ga0207695_10000806 3300025913 Bacteria 58371
336 Ga0207695_10001360 3300025913 Bacteria 41481
337 Ga0207695_10006983 3300025913 Bacteria 14490
338 Ga0207695_10020583 3300025913 Bacteria 7553
339 Ga0207695_10094842 3300025913 Bacteria 2990
340 Ga0207695_10095321 3300025913 Bacteria 2980
341 Ga0207695_10099641 3300025913 Bacteria 2903
342 Ga0207695_10201036 3300025913 Bacteria 1907
343 Ga0207695_10584682 3300025913 Bacteria 998
344 Ga0207671_10028983 3300025914 Bacteria 4135
345 Ga0207693_10108979 3300025915 Bacteria 2172
346 Ga0207663_10289578 3300025916 Bacteria 1219
347 Ga0207660_10003252 3300025917 Bacteria 10643
348 Ga0207660_10043284 3300025917 Bacteria 3164
349 Ga0207660_10052150 3300025917 Bacteria 2911
350 Ga0207660_10090744 3300025917 Bacteria 2264
351 Ga0207660_10594690 3300025917 Bacteria 901
352 Ga0207657_10000524 3300025919 Bacteria 40619
353 Ga0207657_10022610 3300025919 Bacteria 5878
354 Ga0207657_10122371 3300025919 Bacteria 2140
355 Ga0207657_10167188 3300025919 Bacteria 1783
356 Ga0207657_10269930 3300025919 Bacteria 1352
357 Ga0207649_10002238 3300025920 Bacteria 10931
358 Ga0207649_10015519 3300025920 Bacteria 4280
359 Ga0207649_10225976 3300025920 Bacteria 1336
360 Ga0207652_10008722 3300025921 Bacteria 8160
361 Ga0207652_10058808 3300025921 Bacteria 3312
362 Ga0207652_10059551 3300025921 Bacteria 3292
363 Ga0207652_10136635 3300025921 Bacteria 2189
364 Ga0207681_10013955 3300025923 Bacteria 4978
365 Ga0207681_10104032 3300025923 Bacteria 2053
366 Ga0207694_10001760 3300025924 Bacteria 18157
367 Ga0207694_10004511 3300025924 Bacteria 10863
368 Ga0207694_10146019 3300025924 Bacteria 1904
369 Ga0207694_10180375 3300025924 Bacteria 1712
370 Ga0207694_10240098 3300025924 Bacteria 1481
371 Ga0207650_10005184 3300025925 Bacteria 8891
372 Ga0207650_10008066 3300025925 Bacteria 7176
373 Ga0207650_10133200 3300025925 Bacteria 1947
374 Ga0207650_10593141 3300025925 Bacteria 931
375 Ga0207659_10023091 3300025926 Bacteria 4148
376 Ga0207659_10035920 3300025926 Bacteria 3429
377 Ga0207687_10168112 3300025927 Bacteria 1689
378 Ga0207687_10517100 3300025927 Bacteria 998
379 Ga0207687_10523119 3300025927 Bacteria 992
380 Ga0207700_10021182 3300025928 Bacteria 4432
381 Ga0207664_10003618 3300025929 Bacteria 10344
382 Ga0207664_10095049 3300025929 Bacteria 2451
383 Ga0207664_10119111 3300025929 Bacteria 2207
384 Ga0207664_10231373 3300025929 Bacteria 1607
385 Ga0207644_10008388 3300025931 Bacteria 6762
386 Ga0207644_10169098 3300025931 Bacteria 1705
387 Ga0207690_10004332 3300025932 Bacteria 8383
388 Ga0207690_10135756 3300025932 Bacteria 1806
389 Ga0207706_10076464 3300025933 Bacteria 2944
390 Ga0207686_10051120 3300025934 Bacteria 2573
391 Ga0207686_10445358 3300025934 Bacteria 995
392 Ga0207709_10002633 3300025935 Bacteria 11161
393 Ga0207709_10102956 3300025935 Bacteria 1891
394 Ga0207709_10558088 3300025935 Bacteria 902
395 Ga0207670_10077452 3300025936 Bacteria 2316
396 Ga0207670_10519936 3300025936 Bacteria 969
397 Ga0207669_10076299 3300025937 Bacteria 2127
398 Ga0207704_10022141 3300025938 Bacteria 3399
399 Ga0207704_10115350 3300025938 Bacteria 1825
400 Ga0207691_10000343 3300025940 Bacteria 46843
401 Ga0207691_10000826 3300025940 Bacteria 30881
402 Ga0207691_10001614 3300025940 Bacteria 22406
403 Ga0207691_10007847 3300025940 Bacteria 10281
404 Ga0207691_10091643 3300025940 Bacteria 2723
405 Ga0207691_10211364 3300025940 Bacteria 1685
406 Ga0207711_10072118 3300025941 Bacteria 2999
407 Ga0207711_10091298 3300025941 Bacteria 2678
408 Ga0207711_10142215 3300025941 Bacteria 2159
409 Ga0207711_10446166 3300025941 Bacteria 1204
410 Ga0207689_10021920 3300025942 Bacteria 5373
411 Ga0207679_10002888 3300025945 Bacteria 10658
412 Ga0207679_10023404 3300025945 Bacteria 4223
413 Ga0207679_10054441 3300025945 Bacteria 2945
414 Ga0207679_10205861 3300025945 Bacteria 1647
415 Ga0207679_10206787 3300025945 Bacteria 1643
416 Ga0207679_10222219 3300025945 Bacteria 1590
417 Ga0207679_10264469 3300025945 Bacteria 1468
418 Ga0207667_10005070 3300025949 Bacteria 16094
419 Ga0207667_10005399 3300025949 Bacteria 15585
420 Ga0207667_10023396 3300025949 Bacteria 6803
421 Ga0207667_10024982 3300025949 Bacteria 6549
422 Ga0207667_10035108 3300025949 Bacteria 5380
423 Ga0207667_10173798 3300025949 Bacteria 2214
424 Ga0207651_10000672 3300025960 Bacteria 14616
425 Ga0207651_10022567 3300025960 Bacteria 3851
426 Ga0207651_10086815 3300025960 Bacteria 2275
427 Ga0207651_10095402 3300025960 Bacteria 2190
428 Ga0207651_10442950 3300025960 Bacteria 1113
429 Ga0207651_10872936 3300025960 Bacteria 800
430 Ga0207712_10027674 3300025961 Bacteria 3787
431 Ga0207668_10038769 3300025972 Bacteria 3201
432 Ga0207668_10114188 3300025972 Bacteria 2032
433 Ga0207668_10181768 3300025972 Bacteria 1659
434 Ga0207640_10009128 3300025981 Bacteria 5538
435 Ga0207640_10329991 3300025981 Bacteria 1218
436 Ga0207640_10357053 3300025981 Bacteria 1176
437 Ga0207658_10001180 3300025986 Bacteria 20855
438 Ga0207658_10093617 3300025986 Bacteria 2336
439 Ga0207677_10004841 3300026023 Bacteria 7265
440 Ga0207677_10120538 3300026023 Bacteria 1972
441 Ga0207677_10148576 3300026023 Bacteria 1804
442 Ga0207677_10276451 3300026023 Bacteria 1376
443 Ga0207677_10572532 3300026023 Bacteria 987
444 Ga0207703_10062768 3300026035 Bacteria 3044
445 Ga0207703_10162752 3300026035 Bacteria 1955
446 Ga0207639_10042766 3300026041 Bacteria 3397
447 Ga0207639_10154037 3300026041 Bacteria 1928
448 Ga0207639_10217459 3300026041 Bacteria 1648
449 Ga0207639_10273461 3300026041 Bacteria 1483
450 Ga0207639_10276853 3300026041 Bacteria 1474
451 Ga0207678_10000974 3300026067 Bacteria 26088
452 Ga0207678_10111746 3300026067 Bacteria 2331
453 Ga0207678_10172888 3300026067 Bacteria 1844
454 Ga0207678_10599802 3300026067 Bacteria 965
455 Ga0207708_10011960 3300026075 Bacteria 6465
456 Ga0207702_10010434 3300026078 Bacteria 7771
457 Ga0207702_10016629 3300026078 Bacteria 6087
458 Ga0207702_10203534 3300026078 Bacteria 1836
459 Ga0207702_10225287 3300026078 Bacteria 1749
460 Ga0207702_10225422 3300026078 Bacteria 1749
461 Ga0207702_10253264 3300026078 Bacteria 1654
462 Ga0207702_10269471 3300026078 Bacteria 1605
463 Ga0207641_10119950 3300026088 Bacteria 2345
464 Ga0207641_10218621 3300026088 Bacteria 1765
465 Ga0207648_10002497 3300026089 Bacteria 19743
466 Ga0207648_10004228 3300026089 Bacteria 14837
467 Ga0207648_10012406 3300026089 Bacteria 7978
468 Ga0207648_10020098 3300026089 Bacteria 6022
469 Ga0207648_10022240 3300026089 Bacteria 5697
470 Ga0207648_10127594 3300026089 Bacteria 2238
471 Ga0207648_10389729 3300026089 Bacteria 1261
472 Ga0207648_10426923 3300026089 Bacteria 1204
473 Ga0207676_10000548 3300026095 Bacteria 31359
474 Ga0207676_10075779 3300026095 Bacteria 2715
475 Ga0207676_10455771 3300026095 Bacteria 1206
476 Ga0207674_10000045 3300026116 Bacteria 122251
477 Ga0207674_10436833 3300026116 Bacteria 1265
478 Ga0207675_100017006 3300026118 Bacteria 6796
479 Ga0207675_100022734 3300026118 Bacteria 5834
480 Ga0207675_100105148 3300026118 Bacteria 2661
481 Ga0207683_10000009 3300026121 Bacteria 150281
482 Ga0207683_10000182 3300026121 Bacteria 54134
483 Ga0207683_10035293 3300026121 Bacteria 4348
484 Ga0207698_10001283 3300026142 Bacteria 14640
485 Ga0207698_10029233 3300026142 Bacteria 3943
486 Ga0207698_10316101 3300026142 Bacteria 1460
487 Ga0207698_10434707 3300026142 Bacteria 1263
488 Ga0209984_1011506 3300027424 Bacteria 1146
489 Ga0209974_10004711 3300027876 Bacteria 4846
490 Ga0207428_10017142 3300027907 Bacteria 6224
491 Ga0207428_10460627 3300027907 Bacteria 926
492 Ga0268266_10000551 3300028379 Bacteria 52218
493 Ga0268266_10032142 3300028379 Bacteria 4458
494 Ga0268265_10002908 3300028380 Bacteria 12578
495 Ga0268265_10151184 3300028380 Bacteria 1958
496 Ga0268265_10381476 3300028380 Bacteria 1297
497 Ga0268264_10039584 3300028381 Bacteria 3895
498 Ga0268264_10432779 3300028381 Bacteria 1271
499 Ga0268264_10858882 3300028381 Bacteria 909
500 Ga0265330_10069042 3300031235 Bacteria 1530
501 Ga0265325_10007961 3300031241 Bacteria 6294
502 Ga0265325_10072852 3300031241 Bacteria 1721
503 Ga0265340_10002715 3300031247 Bacteria 10073
504 Ga0265340_10033158 3300031247 Bacteria 2573
505 Ga0265340_10083189 3300031247 Bacteria 1504
506 Ga0265339_10007542 3300031249 Bacteria 7014
507 Ga0265331_10000250 3300031250 Bacteria 63883
508 Ga0265327_10000007 3300031251 Bacteria 678515
509 Ga0265327_10000280 3300031251 Bacteria 100757
510 Ga0265316_10055609 3300031344 Bacteria 3094
511 Ga0307513_10001002 3300031456 Bacteria 40842
512 Ga0307513_10361575 3300031456 Bacteria 1196
513 Ga0307513_10377296 3300031456 Bacteria 1158
514 Ga0307408_100029509 3300031548 Bacteria 3801
515 Ga0307408_100287883 3300031548 Bacteria 1371
516 Ga0265313_10008203 3300031595 Bacteria 6978
517 Ga0265313_10020281 3300031595 Bacteria 3671
518 Ga0265314_10154468 3300031711 Bacteria 1403
519 Ga0265342_10062731 3300031712 Bacteria 2186
520 Ga0307405_10002589 3300031731 Bacteria 8020
521 Ga0307413_10028792 3300031824 Bacteria 3100
522 Ga0307413_10097044 3300031824 Bacteria 1937
523 Ga0307410_10017443 3300031852 Bacteria 4312
524 Ga0307406_10049422 3300031901 Bacteria 2661
525 Ga0307407_10100077 3300031903 Bacteria 1797
526 Ga0307412_10050730 3300031911 Bacteria 2740
527 Ga0307409_100195811 3300031995 Bacteria 1803
528 Ga0307409_100256209 3300031995 Bacteria 1603
529 Ga0307416_100069094 3300032002 Bacteria 2922
530 Ga0307416_100085395 3300032002 Bacteria 2686
531 Ga0307411_10003144 3300032005 Bacteria 7573
532 Ga0307411_10043493 3300032005 Bacteria 2874
533 Ga0307411_10089629 3300032005 Bacteria 2143
534 Ga0307510_10019906 3300033180 Bacteria 7860
535 Ga0373930_0013043 3300034816 Bacteria 1526
536 Ga0373958_0003476 3300034819 Bacteria 2274
537 Ga0373923_0167773 3300035111 Bacteria 1004
538 Ga0373936_0003352 3300035113 Bacteria 6002
539 Ga0373931_0135708 3300035691 Bacteria 1420
540 Ga0373937_0142189 3300036401 Bacteria 2245
541 Ga0373937_0196697 3300036401 Bacteria 1895
542 Ga0395900_0029076 3300037418 Bacteria 5669
543 Ga0395900_0225305 3300037418 Bacteria 1888
544 Ga0395898_0200182 3300037466 Bacteria 1907
545 Ga0395905_0014988 3300037471 Bacteria 7393
546 Ga0395905_0025761 3300037471 Bacteria 5545
547 Ga0436364_0098673 3300037853 Bacteria 6312
548 Ga0395901_0171472 3300038443 Bacteria 2277
549 Ga0395901_0258871 3300038443 Bacteria 1811
550 Ga0400483_041511 3300039062 Bacteria 11733
551 Ga0400483_068901 3300039062 Bacteria 1132
552 Ga0400483_206794 3300039062 Bacteria 8594
553 Ga0436365_0503502 3300039437 Bacteria 2683
554 Ga0436365_0874983 3300039437 Bacteria 53988
555 Ga0436360_0404552 3300039438 Bacteria 2610
556 Ga0436360_0605189 3300039438 Bacteria 1492
557 Ga0436360_0614325 3300039438 Bacteria 2486
558 Ga0436360_1178753 3300039438 Bacteria 8244
559 Ga0436361_0025705 3300039447 Bacteria 809
560 Ga0436361_0469822 3300039447 Bacteria 6391
561 Ga0436361_0672930 3300039447 Bacteria 1141
562 Ga0436361_0788745 3300039447 Bacteria 34906
563 Ga0436361_0794633 3300039447 Bacteria 1356
564 Ga0436361_0885505 3300039447 Bacteria 4065
565 Ga0436361_1082188 3300039447 Bacteria 1795
566 Ga0436363_0854040 3300039450 Bacteria 16936
567 Ga0436362_0009912 3300039453 Bacteria 1529
568 Ga0436362_1093207 3300039453 Bacteria 1383
569 Ga0436362_1161051 3300039453 Bacteria 1132
570 Ga0451837_0626772 3300041494 Bacteria 2044
571 Ga0451849_1443180 3300041505 Bacteria 4173
572 Ga0451843_1776483 3300041509 Bacteria 2786
573 Ga0439450_009520 3300042008 Bacteria 1847
574 Ga0466969_0000722 3300044656 Bacteria 17863
575 Ga0466969_0114506 3300044656 Bacteria 1260
576 Ga0466966_0005576 3300044684 Bacteria 8276
577 Ga0466961_0001425 3300044693 Bacteria 14831
578 Ga0466964_0072768 3300044706 Bacteria 1457
579 Ga0466971_0009671 3300044719 Bacteria 4207
580 Ga0466957_0029156 3300044842 Bacteria 3289
581 Ga0466959_0000040 3300045049 Bacteria 101109
582 Ga0451576_0233789 3300045051 Bacteria 1920
583 Ga0466958_0026837 3300045836 Bacteria 3404
584 Ga0466967_0115997 3300045976 Bacteria 2467
585 Ga0495653_0020962 3300046463 Bacteria 5296
586 Ga0495580_0007478 3300046472 Bacteria 8778
587 Ga0495582_0025557 3300046473 Bacteria 3235
588 Ga0495628_0004869 3300046516 Bacteria 11820
589 Ga0495643_0014143 3300046522 Bacteria 4755
590 Ga0495648_0030142 3300046524 Bacteria 3592
591 Ga0495640_0148576 3300046533 Bacteria 1507
592 Ga0495622_0000126 3300046557 Bacteria 66247
593 Ga0495633_0094747 3300046558 Bacteria 1387
594 Ga0495656_0019662 3300046615 Bacteria 2609
595 Ga0495668_0153531 3300046616 Bacteria 1261
596 Ga0495634_0142013 3300046642 Bacteria 1524
597 Ga0495659_0019428 3300046664 Bacteria 2274
598 Ga0495646_0058453 3300046680 Bacteria 2305
599 Ga0495658_0112940 3300046683 Bacteria 1635
600 Ga0495624_0003707 3300046690 Bacteria 11296
601 Ga0495624_0059831 3300046690 Bacteria 2389
602 Ga0495660_0012577 3300046810 Bacteria 4913
603 Ga0495672_0024117 3300047320 Bacteria 3926
604 Ga0495676_0027671 3300047321 Bacteria 4858
605 Ga0495680_0182815 3300047322 Bacteria 1512
606 Ga0495686_0003731 3300047472 Bacteria 12996
607 Ga0495593_0010943 3300047673 Bacteria 5224
608 Ga0495602_0010213 3300048088 Bacteria 9745
609 Ga0495615_0064971 3300048090 Bacteria 972
610 Ga0495626_0029736 3300048091 Bacteria 2641
611 Ga0496101_0047366 3300048904 Bacteria 3086
612 Ga0496102_0207031 3300048905 Bacteria 1849
613 Ga0496104_0033852 3300048907 Bacteria 4762
614 Ga0496105_0250086 3300048908 Bacteria 1436
615 Ga0496106_0005904 3300048909 Bacteria 9050
616 Ga0496106_0334733 3300048909 Bacteria 1215
617 Ga0496108_0240464 3300048911 Bacteria 1575
618 Ga0496109_0089142 3300048912 Bacteria 2851
619 Ga0496109_0666179 3300048912 Bacteria 978
620 Ga0496110_0055644 3300048913 Bacteria 3481
621 Ga0496110_0274091 3300048913 Bacteria 1536
622 Ga0496110_0292116 3300048913 Bacteria 1485
623 Ga0496112_0305970 3300048915 Bacteria 1535
624 Ga0496114_0036117 3300048917 Bacteria 4085
625 Ga0496114_0066918 3300048917 Bacteria 3013
626 Ga0496114_0369051 3300048917 Bacteria 1270
627 Ga0496115_0163647 3300048918 Bacteria 1839
628 Ga0496117_0000427 3300048920 Bacteria 70530
629 Ga0496121_0072024 3300048924 Bacteria 2776
630 Ga0496124_0000046 3300048927 Bacteria 287043
631 Ga0496125_0000545 3300048928 Bacteria 64939
632 Ga0496126_0394898 3300048929 Bacteria 1123
633 Ga0501031_0271311 3300049568 Bacteria 1101
634 Ga0501033_0008244 3300049570 Bacteria 8066
635 Ga0501033_0012171 3300049570 Bacteria 6568
636 Ga0501034_0003497 3300049571 Bacteria 17835
637 Ga0501034_0034901 3300049571 Bacteria 5100
638 Ga0501034_0073475 3300049571 Bacteria 3428
639 Ga0501034_0083970 3300049571 Bacteria 3187
640 Ga0501034_0258542 3300049571 Bacteria 1684
641 Ga0501036_0000257 3300049572 Bacteria 36095
642 Ga0501037_0002777 3300049573 Bacteria 12676
643 Ga0501037_0041628 3300049573 Bacteria 3378
644 Ga0501037_0218121 3300049573 Bacteria 1343
645 Ga0501038_0015573 3300049574 Bacteria 6912
646 Ga0501038_0137858 3300049574 Bacteria 1998
647 Ga0501038_0448708 3300049574 Bacteria 992
648 Ga0501043_0001370 3300049579 Bacteria 21370
649 Ga0501043_0085430 3300049579 Bacteria 2480
650 Ga0501046_0001784 3300049580 Bacteria 20535
651 Ga0501047_0006873 3300049581 Bacteria 10691
652 Ga0501047_0063051 3300049581 Bacteria 3575
653 Ga0501047_0184266 3300049581 Bacteria 1953
654 Ga0501047_0399209 3300049581 Bacteria 1208
655 Ga0501048_0169128 3300049582 Bacteria 1548
656 Ga0501069_0005141 3300049585 Bacteria 6793
657 Ga0501070_0003776 3300049586 Bacteria 13081
658 Ga0501071_0305798 3300049587 Bacteria 1206
659 Ga0501073_0015471 3300049589 Bacteria 5535
660 Ga0501073_0479362 3300049589 Bacteria 860
661 Ga0501074_0022336 3300049590 Bacteria 4596
662 Ga0501074_0094537 3300049590 Bacteria 2140
663 Ga0501076_0510148 3300049592 Bacteria 991
664 Ga0501079_0029442 3300049741 Bacteria 4216
665 Ga0501080_0006486 3300049742 Bacteria 10508
666 Ga0501080_0084524 3300049742 Bacteria 2949
667 Ga0501080_0296413 3300049742 Bacteria 1467
668 Ga0501083_0022836 3300049744 Bacteria 4340
669 Ga0501083_0039192 3300049744 Bacteria 3218
670 Ga0501083_0061714 3300049744 Bacteria 2502
671 Ga0501083_0221679 3300049744 Bacteria 1232
672 Ga0501035_0003798 3300049822 Bacteria 14391
673 Ga0501035_0222071 3300049822 Bacteria 1613
674 Ga0501044_0003872 3300049823 Bacteria 16771
675 Ga0501044_0006073 3300049823 Bacteria 13326
676 Ga0501044_0018509 3300049823 Bacteria 7462
677 Ga0501044_0183067 3300049823 Bacteria 2061
678 Ga0501044_0249859 3300049823 Bacteria 1715
679 Ga0501044_0752675 3300049823 Bacteria 856
680 Ga0501045_0211595 3300049824 Bacteria 1444
681 nmdc:mga03683_4675_c1 3300050489 Bacteria 4564
682 nmdc:mga00v17_27_c2 3300050491 Bacteria 60228
683 nmdc:mga00v17_34091_c1 3300050491 Bacteria 3021
684 nmdc:mga0k408_60154_c2 3300050493 Bacteria 1379
685 nmdc:mga05p37_223159_c1 3300050507 Bacteria 2273
686 nmdc:mga09592_119231_c1 3300050508 Bacteria 2265
687 nmdc:mga08y16_223668_c1 3300050511 Bacteria 1948
688 nmdc:mga08y16_6264_c1 3300050511 Bacteria 12472
689 nmdc:mga08y16_833632_c1 3300050511 Bacteria 913
690 nmdc:mga0n895_201090_c1 3300050512 Bacteria 2023
691 nmdc:mga0n895_489921_c1 3300050512 Bacteria 1239
692 nmdc:mga0rr50_57969_c1 3300050513 Bacteria 2900
693 nmdc:mga08x19_12019_c1 3300050514 Bacteria 5210
694 nmdc:mga08x19_194951_c1 3300050514 Bacteria 1387
695 Ga0500643_000374 3300053087 Bacteria 34998
696 Ga0500643_020753 3300053087 Bacteria 2140
697 Ga0500646_0062098 3300053090 Bacteria 1102
698 Ga0500554_003869 3300053102 Bacteria 3109
699 Ga0500559_0003582 3300053136 Bacteria 7596
700 Ga0500568_0000668 3300053139 Bacteria 24820
701 Ga0500616_0007439 3300053153 Bacteria 6956
702 Ga0500616_0026014 3300053153 Bacteria 3244
703 Ga0500622_0033224 3300053156 Bacteria 2704
704 Ga0500624_022600 3300053157 Bacteria 1024
705 Ga0500627_0179372 3300053158 Bacteria 953
706 Ga0500645_001741 3300053730 Bacteria 10557
707 Ga0500645_001866 3300053730 Bacteria 10084
708 Ga0501084_0075279 3300054114 Bacteria 2828
709 Ga0501084_0265183 3300054114 Bacteria 1450
710 Ga0501084_0351336 3300054114 Bacteria 1245
711 Ga0501082_0062503 3300060353 Bacteria 3205
712 Ga0466962_0000450 3300061719 Bacteria 17837
713 Ga0530510_0191115 3300061734 Bacteria 1520
714 2535485421 2534681786 Bacteria 3308809
715 2537876257 2537561587 Bacteria 5425293
716 2596374431 2595698237 Bacteria 6712432
717 2738743189 2738541281 Bacteria 5112672
718 2739352806 2738543032 Bacteria 5115625
719 2739612421 2739367655 Bacteria 4051151
720 2753360354 2751185800 Bacteria 5467370
721 2758640380 2758568016 Bacteria 5645291
722 2758642790 2758568016 Bacteria 5645291
723 2792835520 2791355137 Bacteria 9654227
724 2842700470 2842698319 Bacteria 5190321
725 2842715345 2842711865 Bacteria 7155354
726 2854911670 2854911287 Bacteria 5582813
727 2854913567 2854911287 Bacteria 5582813
728 2855736496 2855730933 Bacteria 7047938
729 2855773433 2855767633 Bacteria 7049357
730 2857546698 2857542790 Bacteria 5326616
731 2881418611 2881412998 Bacteria 6492157
732 2915650445 2915650412 Bacteria 4288180
733 2924754960 2924754689 Bacteria 6774424
734 8002394802 8002392321 Bacteria 4159911
735 Ga0395901_0016643
736 JGI24740J21852_10078825
737 Ga0070658_10007411
738 Ga0070676_10010301
739 Ga0070676_10169957
740 Ga0070676_10239067
741 Ga0070683_100008427
742 Ga0070690_100056989
743 Ga0070670_100192158
744 Ga0070670_100257209
745 Ga0070677_10000303
746 Ga0070677_10020974
747 Ga0068869_100066857
748 Ga0070666_10007495
749 Ga0070666_10010571
750 Ga0070666_10371291
751 Ga0070680_100073271
752 Ga0068868_100000202
753 Ga0068868_100426788
754 Ga0068868_100551771
755 Ga0070660_100004342
756 Ga0070660_100012151
757 Ga0070660_100054219
758 Ga0070660_100063163
759 Ga0070660_100166387
760 Ga0070689_100068704
761 Ga0070689_100084918
762 Ga0070689_100517755
763 Ga0070661_100002674
764 Ga0070661_100005346
765 Ga0070661_100053473
766 Ga0070661_100189793
767 Ga0070661_100234980
768 Ga0070692_10012611
769 Ga0070668_100001226
770 Ga0070668_100013228
771 Ga0070668_100021611
772 Ga0070668_100030266
773 Ga0070668_100321385
774 Ga0070669_100011290
775 Ga0070669_100135950
776 Ga0070675_100004894
777 Ga0070675_100018428
778 Ga0070675_100020120
779 Ga0070675_100028350
780 Ga0070675_100189929
781 Ga0070671_100005030
782 Ga0070671_100007991
783 Ga0070671_100083526
784 Ga0070674_100000310
785 Ga0070674_100040277
786 Ga0070674_100091895
787 Ga0070674_100138643
788 Ga0070673_100000377
789 Ga0070673_100015977
790 Ga0070673_100024384
791 Ga0070673_100035279
792 Ga0070673_100045407
793 Ga0070673_100171359
794 Ga0070659_100002822
795 Ga0070659_100039163
796 Ga0070659_100171595
797 Ga0070667_100009129
798 Ga0070667_100021029
799 Ga0070667_100126024
800 Ga0070667_100322824
801 Ga0070709_10032614
802 Ga0070709_10503515
803 Ga0070714_100001888
804 Ga0070714_100112229
805 Ga0070714_100143716
806 Ga0070714_100448063
807 Ga0070713_100051580
808 Ga0070710_10013243
809 Ga0070705_100107555
810 Ga0070700_100000389
811 Ga0070694_100123770
812 Ga0070708_100052118
813 Ga0070663_100000590
814 Ga0070663_100141421
815 Ga0070663_100163345
816 Ga0070663_100498446
817 Ga0070678_100002811
818 Ga0070678_100091988
819 Ga0070662_100055724
820 Ga0070662_100121970
821 Ga0070681_10012100
822 Ga0070681_10042339
823 Ga0070681_10113222
824 Ga0068867_100004591
825 Ga0068867_100017430
826 Ga0068867_100024393
827 Ga0068867_100030016
828 Ga0068867_100096522
829 Ga0068867_100374839
830 Ga0068867_100383796
831 Ga0070685_10014848
832 Ga0070706_100144128
833 Ga0070706_100167220
834 Ga0070706_100241043
835 Ga0070698_100003313
836 Ga0070698_100366248
837 Ga0070699_100001885
838 Ga0070699_100024597
839 Ga0070679_100005852
840 Ga0070679_100007564
841 Ga0070679_100021550
842 Ga0070679_100221193
843 Ga0070679_100819547
844 Ga0070679_100887894
845 Ga0070684_100001171
846 Ga0070684_100005136
847 Ga0070697_100104285
848 Ga0068853_100001630
849 Ga0068853_100053634
850 Ga0068853_100082326
851 Ga0068853_100119321
852 Ga0068853_100207744
853 Ga0068853_100255155
854 Ga0068853_100349604
855 Ga0068853_100582658
856 Ga0070672_100000154
857 Ga0070672_100012524
858 Ga0070672_100028014
859 Ga0070672_100030677
860 Ga0070672_100036976
861 Ga0070672_100055143
862 Ga0070672_100118285
863 Ga0070672_100169363
864 Ga0070695_100095318
865 Ga0070696_100068958
866 Ga0070696_100075437
867 Ga0070696_100144725
868 Ga0070693_100000664
869 Ga0070693_100029155
870 Ga0070665_100001485
871 Ga0070665_100002599
872 Ga0070665_100016813
873 Ga0070665_100113299
874 Ga0070665_100453913
875 Ga0068855_100000453
876 Ga0068855_100021038
877 Ga0068855_100023304
878 Ga0068855_100032340
879 Ga0068855_100040480
880 Ga0068855_100071949
881 Ga0068855_100202606
882 Ga0070664_100007881
883 Ga0070664_100022623
884 Ga0070664_100055758
885 Ga0070664_100135705
886 Ga0070664_100269620
887 Ga0068857_100009699
888 Ga0068857_100011559
889 Ga0068854_100327529
890 Ga0068856_100079751
891 Ga0068856_100095318
892 Ga0068856_100130033
893 Ga0068856_100272361
894 Ga0068856_100526687
895 Ga0070702_100090588
896 Ga0068852_100006808
897 Ga0068852_100014848
898 Ga0068852_100039716
899 Ga0068852_100112109
900 Ga0068852_100172530
901 Ga0068852_100226062
902 Ga0068852_100425308
903 Ga0068852_100510253
904 Ga0068859_100442671
905 Ga0068859_100784661
906 Ga0068864_100000871
907 Ga0068864_100031930
908 Ga0068864_100147230
909 Ga0068866_10003537
910 Ga0068866_10056517
911 Ga0068866_10131774
912 Ga0068861_100000316
913 Ga0068861_100004991
914 Ga0068851_10000162
915 Ga0068851_10004370
916 Ga0068851_10017787
917 Ga0068870_10039511
918 Ga0068870_10123732
919 Ga0068870_10306147
920 Ga0068863_100006936
921 Ga0068863_100010991
922 Ga0068863_100108141
923 Ga0068863_100223289
924 Ga0068858_100072757
925 Ga0068858_100150752
926 Ga0068860_100074217
927 Ga0068860_100243430
928 Ga0068862_100057288
929 Ga0068862_100123419
930 Ga0075364_10209920
931 Ga0075432_10007467
932 Ga0075362_10043316
933 Ga0075366_10063992
934 Ga0097621_100009127
935 Ga0097621_100030201
936 Ga0068871_100010900
937 Ga0068871_100075325
938 Ga0075434_100609147
939 Ga0075429_100069086
940 Ga0068865_100003157
941 Ga0068865_100012280
942 Ga0075436_100018225
943 Ga0075436_100227664
944 Ga0097620_100010242
945 Ga0097620_100442683
946 Ga0097620_100784535
947 Ga0105240_10005452
948 Ga0105240_10005556
949 Ga0105240_10009189
950 Ga0105240_10071585
951 Ga0105240_10121999
952 Ga0105240_10696894
953 Ga0111539_10004114
954 Ga0111539_10158467
955 Ga0111539_10207054
956 Ga0111539_11125707
957 Ga0111539_11176176
958 Ga0105245_10108460
959 Ga0105245_10202208
960 Ga0105243_10038652
961 Ga0105241_10001153
962 Ga0105241_10286296
963 Ga0105242_10002660
964 Ga0105248_10015640
965 Ga0105248_10096242
966 Ga0105248_10237679
967 Ga0105237_10006464
968 Ga0105237_10261443
969 Ga0105237_10299783
970 Ga0105237_10423989
971 Ga0105238_10002904
972 Ga0105238_10014966
973 Ga0105238_10070887
974 Ga0105238_10085095
975 Ga0105249_10050559
976 Ga0105249_10714541
977 Ga0099796_10143091
978 Ga0105239_10021891
979 Ga0105239_10037066
980 Ga0105239_10449320
981 Ga0105239_10674763
982 Ga0157373_10001625
983 Ga0157373_10002315
984 Ga0157373_10131286
985 Ga0157371_10006118
986 Ga0157371_10198392
987 Ga0157370_10010719
988 Ga0157370_10013088
989 Ga0157370_10039789
990 Ga0157370_10041188
991 Ga0157370_10047695
992 Ga0157370_10066646
993 Ga0157370_10092245
994 Ga0157370_10349031
995 Ga0157370_10515518
996 Ga0157369_10018507
997 Ga0157369_10068397
998 Ga0157369_10086410
999 Ga0157369_10419440
1000 Ga0157374_10002469
1001 Ga0157374_10024112
1002 Ga0157374_10310029
1003 Ga0157374_10494809
1004 Ga0157374_10523599
1005 Ga0157378_10045990
1006 Ga0157378_10198283
1007 Ga0157378_10254941
1008 Ga0157378_10739708
1009 Ga0157378_10751920
1010 Ga0163162_10014407
1011 Ga0163162_10133422
1012 Ga0163162_10142267
1013 Ga0163162_10242048
1014 Ga0157372_10008916
1015 Ga0157372_10028729
1016 Ga0157372_10048489
1017 Ga0157372_10106261
1018 Ga0157372_10175351
1019 Ga0157375_10001062
1020 Ga0157375_10008634
1021 Ga0157375_10672425
1022 Ga0163163_11008069
1023 Ga0182008_10088059
1024 Ga0182008_10094444
1025 Ga0157377_10006333
1026 Ga0157379_10111123
1027 Ga0157376_10032804
1028 Ga0157376_10198234
1029 Ga0163161_10012661
1030 Ga0163161_10189905
1031 Ga0163161_10509870
1032 Ga0206351_10961181
1033 Ga0213872_10000191
1034 Ga0213872_10134565
1035 Ga0213874_10019065
1036 Ga0213876_10010100
1037 Ga0213876_10128763
1038 Ga0213871_10005091
1039 Ga0213871_10020431
1040 Ga0209025_1000040
1041 Ga0207697_10005684
1042 Ga0207697_10199249
1043 Ga0207656_10000949
1044 Ga0207656_10001351
1045 Ga0207656_10023192
1046 Ga0207656_10115911
1047 Ga0207682_10000069
1048 Ga0207682_10044012
1049 Ga0207642_10057581
1050 Ga0207688_10059946
1051 Ga0207680_10013991
1052 Ga0207680_10168905
1053 Ga0207699_10025473
1054 Ga0207645_10001232
1055 Ga0207645_10002497
1056 Ga0207645_10089973
1057 Ga0207705_10020554
1058 Ga0207705_10028966
1059 Ga0207705_10029460
1060 Ga0207705_10645846
1061 Ga0207684_10111542
1062 Ga0207684_10434069
1063 Ga0207654_10008354
1064 Ga0207707_10006272
1065 Ga0207707_10012306
1066 Ga0207707_10033902
1067 Ga0207707_10110405
1068 Ga0207707_10336073
1069 Ga0207695_10000806
1070 Ga0207695_10001360
1071 Ga0207695_10006983
1072 Ga0207695_10020583
1073 Ga0207695_10094842
1074 Ga0207695_10095321
1075 Ga0207695_10099641
1076 Ga0207695_10201036
1077 Ga0207695_10584682
1078 Ga0207671_10028983
1079 Ga0207693_10108979
1080 Ga0207663_10289578
1081 Ga0207660_10003252
1082 Ga0207660_10043284
1083 Ga0207660_10052150
1084 Ga0207660_10090744
1085 Ga0207660_10594690
1086 Ga0207657_10000524
1087 Ga0207657_10022610
1088 Ga0207657_10122371
1089 Ga0207657_10167188
1090 Ga0207657_10269930
1091 Ga0207649_10002238
1092 Ga0207649_10015519
1093 Ga0207649_10225976
1094 Ga0207652_10008722
1095 Ga0207652_10058808
1096 Ga0207652_10059551
1097 Ga0207652_10136635
1098 Ga0207681_10013955
1099 Ga0207681_10104032
1100 Ga0207694_10001760
1101 Ga0207694_10004511
1102 Ga0207694_10146019
1103 Ga0207694_10180375
1104 Ga0207694_10240098
1105 Ga0207650_10005184
1106 Ga0207650_10008066
1107 Ga0207650_10133200
1108 Ga0207650_10593141
1109 Ga0207659_10023091
1110 Ga0207659_10035920
1111 Ga0207687_10168112
1112 Ga0207687_10517100
1113 Ga0207687_10523119
1114 Ga0207700_10021182
1115 Ga0207664_10003618
1116 Ga0207664_10095049
1117 Ga0207664_10119111
1118 Ga0207664_10231373
1119 Ga0207644_10008388
1120 Ga0207644_10169098
1121 Ga0207690_10004332
1122 Ga0207690_10135756
1123 Ga0207706_10076464
1124 Ga0207686_10051120
1125 Ga0207686_10445358
1126 Ga0207709_10002633
1127 Ga0207709_10102956
1128 Ga0207709_10558088
1129 Ga0207670_10077452
1130 Ga0207670_10519936
1131 Ga0207669_10076299
1132 Ga0207704_10022141
1133 Ga0207704_10115350
1134 Ga0207691_10000343
1135 Ga0207691_10000826
1136 Ga0207691_10001614
1137 Ga0207691_10007847
1138 Ga0207691_10091643
1139 Ga0207691_10211364
1140 Ga0207711_10072118
1141 Ga0207711_10091298
1142 Ga0207711_10142215
1143 Ga0207711_10446166
1144 Ga0207689_10021920
1145 Ga0207679_10002888
1146 Ga0207679_10023404
1147 Ga0207679_10054441
1148 Ga0207679_10205861
1149 Ga0207679_10206787
1150 Ga0207679_10222219
1151 Ga0207679_10264469
1152 Ga0207667_10005070
1153 Ga0207667_10005399
1154 Ga0207667_10023396
1155 Ga0207667_10024982
1156 Ga0207667_10035108
1157 Ga0207667_10173798
1158 Ga0207651_10000672
1159 Ga0207651_10022567
1160 Ga0207651_10086815
1161 Ga0207651_10095402
1162 Ga0207651_10442950
1163 Ga0207651_10872936
1164 Ga0207712_10027674
1165 Ga0207668_10038769
1166 Ga0207668_10114188
1167 Ga0207668_10181768
1168 Ga0207640_10009128
1169 Ga0207640_10329991
1170 Ga0207640_10357053
1171 Ga0207658_10001180
1172 Ga0207658_10093617
1173 Ga0207677_10004841
1174 Ga0207677_10120538
1175 Ga0207677_10148576
1176 Ga0207677_10276451
1177 Ga0207677_10572532
1178 Ga0207703_10062768
1179 Ga0207703_10162752
1180 Ga0207639_10042766
1181 Ga0207639_10154037
1182 Ga0207639_10217459
1183 Ga0207639_10273461
1184 Ga0207639_10276853
1185 Ga0207678_10000974
1186 Ga0207678_10111746
1187 Ga0207678_10172888
1188 Ga0207678_10599802
1189 Ga0207708_10011960
1190 Ga0207702_10010434
1191 Ga0207702_10016629
1192 Ga0207702_10203534
1193 Ga0207702_10225287
1194 Ga0207702_10225422
1195 Ga0207702_10253264
1196 Ga0207702_10269471
1197 Ga0207641_10119950
1198 Ga0207641_10218621
1199 Ga0207648_10002497
1200 Ga0207648_10004228
1201 Ga0207648_10012406
1202 Ga0207648_10020098
1203 Ga0207648_10022240
1204 Ga0207648_10127594
1205 Ga0207648_10389729
1206 Ga0207648_10426923
1207 Ga0207676_10000548
1208 Ga0207676_10075779
1209 Ga0207676_10455771
1210 Ga0207674_10000045
1211 Ga0207674_10436833
1212 Ga0207675_100017006
1213 Ga0207675_100022734
1214 Ga0207675_100105148
1215 Ga0207683_10000009
1216 Ga0207683_10000182
1217 Ga0207683_10035293
1218 Ga0207698_10001283
1219 Ga0207698_10029233
1220 Ga0207698_10316101
1221 Ga0207698_10434707
1222 Ga0209984_1011506
1223 Ga0209974_10004711
1224 Ga0207428_10017142
1225 Ga0207428_10460627
1226 Ga0268266_10000551
1227 Ga0268266_10032142
1228 Ga0268265_10002908
1229 Ga0268265_10151184
1230 Ga0268265_10381476
1231 Ga0268264_10039584
1232 Ga0268264_10432779
1233 Ga0268264_10858882
1234 Ga0265330_10069042
1235 Ga0265325_10007961
1236 Ga0265325_10072852
1237 Ga0265340_10002715
1238 Ga0265340_10033158
1239 Ga0265340_10083189
1240 Ga0265339_10007542
1241 Ga0265331_10000250
1242 Ga0265327_10000007
1243 Ga0265327_10000280
1244 Ga0265316_10055609
1245 Ga0307513_10001002
1246 Ga0307513_10361575
1247 Ga0307513_10377296
1248 Ga0307408_100029509
1249 Ga0307408_100287883
1250 Ga0265313_10008203
1251 Ga0265313_10020281
1252 Ga0265314_10154468
1253 Ga0265342_10062731
1254 Ga0307405_10002589
1255 Ga0307413_10028792
1256 Ga0307413_10097044
1257 Ga0307410_10017443
1258 Ga0307406_10049422
1259 Ga0307407_10100077
1260 Ga0307412_10050730
1261 Ga0307409_100195811
1262 Ga0307409_100256209
1263 Ga0307416_100069094
1264 Ga0307416_100085395
1265 Ga0307411_10003144
1266 Ga0307411_10043493
1267 Ga0307411_10089629
1268 Ga0307510_10019906
1269 Ga0373930_0013043
1270 Ga0373958_0003476
1271 Ga0373923_0167773
1272 Ga0373936_0003352
1273 Ga0373931_0135708
1274 Ga0373937_0142189
1275 Ga0373937_0196697
1276 Ga0395900_0029076
1277 Ga0395900_0225305
1278 Ga0395898_0200182
1279 Ga0395905_0014988
1280 Ga0395905_0025761
1281 Ga0436364_0098673
1282 Ga0395901_0171472
1283 Ga0395901_0258871
1284 Ga0400483_041511
1285 Ga0400483_068901
1286 Ga0400483_206794
1287 Ga0436365_0503502
1288 Ga0436365_0874983
1289 Ga0436360_0404552
1290 Ga0436360_0605189
1291 Ga0436360_0614325
1292 Ga0436360_1178753
1293 Ga0436361_0025705
1294 Ga0436361_0469822
1295 Ga0436361_0672930
1296 Ga0436361_0788745
1297 Ga0436361_0794633
1298 Ga0436361_0885505
1299 Ga0436361_1082188
1300 Ga0436363_0854040
1301 Ga0436362_0009912
1302 Ga0436362_1093207
1303 Ga0436362_1161051
1304 Ga0451837_0626772
1305 Ga0451849_1443180
1306 Ga0451843_1776483
1307 Ga0439450_009520
1308 Ga0466969_0000722
1309 Ga0466969_0114506
1310 Ga0466966_0005576
1311 Ga0466961_0001425
1312 Ga0466964_0072768
1313 Ga0466971_0009671
1314 Ga0466957_0029156
1315 Ga0466959_0000040
1316 Ga0451576_0233789
1317 Ga0466958_0026837
1318 Ga0466967_0115997
1319 Ga0495653_0020962
1320 Ga0495580_0007478
1321 Ga0495582_0025557
1322 Ga0495628_0004869
1323 Ga0495643_0014143
1324 Ga0495648_0030142
1325 Ga0495640_0148576
1326 Ga0495622_0000126
1327 Ga0495633_0094747
1328 Ga0495656_0019662
1329 Ga0495668_0153531
1330 Ga0495634_0142013
1331 Ga0495659_0019428
1332 Ga0495646_0058453
1333 Ga0495658_0112940
1334 Ga0495624_0003707
1335 Ga0495624_0059831
1336 Ga0495660_0012577
1337 Ga0495672_0024117
1338 Ga0495676_0027671
1339 Ga0495680_0182815
1340 Ga0495686_0003731
1341 Ga0495593_0010943
1342 Ga0495602_0010213
1343 Ga0495615_0064971
1344 Ga0495626_0029736
1345 Ga0496101_0047366
1346 Ga0496102_0207031
1347 Ga0496104_0033852
1348 Ga0496105_0250086
1349 Ga0496106_0005904
1350 Ga0496106_0334733
1351 Ga0496108_0240464
1352 Ga0496109_0089142
1353 Ga0496109_0666179
1354 Ga0496110_0055644
1355 Ga0496110_0274091
1356 Ga0496110_0292116
1357 Ga0496112_0305970
1358 Ga0496114_0036117
1359 Ga0496114_0066918
1360 Ga0496114_0369051
1361 Ga0496115_0163647
1362 Ga0496117_0000427
1363 Ga0496121_0072024
1364 Ga0496124_0000046
1365 Ga0496125_0000545
1366 Ga0496126_0394898
1367 Ga0501031_0271311
1368 Ga0501033_0008244
1369 Ga0501033_0012171
1370 Ga0501034_0003497
1371 Ga0501034_0034901
1372 Ga0501034_0073475
1373 Ga0501034_0083970
1374 Ga0501034_0258542
1375 Ga0501036_0000257
1376 Ga0501037_0002777
1377 Ga0501037_0041628
1378 Ga0501037_0218121
1379 Ga0501038_0015573
1380 Ga0501038_0137858
1381 Ga0501038_0448708
1382 Ga0501043_0001370
1383 Ga0501043_0085430
1384 Ga0501046_0001784
1385 Ga0501047_0006873
1386 Ga0501047_0063051
1387 Ga0501047_0184266
1388 Ga0501047_0399209
1389 Ga0501048_0169128
1390 Ga0501069_0005141
1391 Ga0501070_0003776
1392 Ga0501071_0305798
1393 Ga0501073_0015471
1394 Ga0501073_0479362
1395 Ga0501074_0022336
1396 Ga0501074_0094537
1397 Ga0501076_0510148
1398 Ga0501079_0029442
1399 Ga0501080_0006486
1400 Ga0501080_0084524
1401 Ga0501080_0296413
1402 Ga0501083_0022836
1403 Ga0501083_0039192
1404 Ga0501083_0061714
1405 Ga0501083_0221679
1406 Ga0501035_0003798
1407 Ga0501035_0222071
1408 Ga0501044_0003872
1409 Ga0501044_0006073
1410 Ga0501044_0018509
1411 Ga0501044_0183067
1412 Ga0501044_0249859
1413 Ga0501044_0752675
1414 Ga0501045_0211595
1415 nmdc:mga03683_4675_c1
1416 nmdc:mga00v17_27_c2
1417 nmdc:mga00v17_34091_c1
1418 nmdc:mga0k408_60154_c2
1419 nmdc:mga05p37_223159_c1
1420 nmdc:mga09592_119231_c1
1421 nmdc:mga08y16_223668_c1
1422 nmdc:mga08y16_6264_c1
1423 nmdc:mga08y16_833632_c1
1424 nmdc:mga0n895_201090_c1
1425 nmdc:mga0n895_489921_c1
1426 nmdc:mga0rr50_57969_c1
1427 nmdc:mga08x19_12019_c1
1428 nmdc:mga08x19_194951_c1
1429 Ga0500643_000374
1430 Ga0500643_020753
1431 Ga0500646_0062098
1432 Ga0500554_003869
1433 Ga0500559_0003582
1434 Ga0500568_0000668
1435 Ga0500616_0007439
1436 Ga0500616_0026014
1437 Ga0500622_0033224
1438 Ga0500624_022600
1439 Ga0500627_0179372
1440 Ga0500645_001741
1441 Ga0500645_001866
1442 Ga0501084_0075279
1443 Ga0501084_0265183
1444 Ga0501084_0351336
1445 Ga0501082_0062503
1446 Ga0466962_0000450
1447 Ga0530510_0191115
1448 2535485421
1449 2537876257
1450 2596374431
1451 2738743189
1452 2739352806
1453 2739612421
1454 2753360354
1455 2758640380
1456 2758642790
1457 2792835520
1458 2842700470
1459 2842715345
1460 2854911670
1461 2854913567
1462 2855736496
1463 2855773433
1464 2857546698
1465 2881418611
1466 2915650445
1467 2924754960
1468 8002394802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

25

209

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9621 1 223
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9375 1 223
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.9249 2 241
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9191 1 222
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.9099 2 241
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9621 1 223 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9375 1 223 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.916 1 210 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9119 2 246 3.40.50.620
af_A4I154_9_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8984 1 248 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1H2PLR8-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9961 1 113 GO:0009055
AF-A0A3D5N4G0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9961 1 100 GO:0009055
AF-A0A7W9RY60-F1-model_v4 Electron transfer flavoprotein alpha/beta subunit 0.996 1 110 GO:0009055
AF-A0A368TRL3-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9947 1 110 GO:0009055
AF-A0A4S8F3U0-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9934 2 116 GO:0009055

Map