F478140

General Info

Members Datasets Scaffolds Average Seq Length
734 302 734 187

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10338726|Ga0157372_103387262
Length 230
Sequence MARKSAPIKSRKNHAARQKHIRLFSYVTGKSKFFFVTLRKLIGMIRKLTGEVWKPLQFPGWKQLRKKYALSSLGRVASYSEDVLADGKLLNGSLTTGYKTLNLHRPGNNGTLYIHREIARLFLPKSSLKHKYVIHQNHNKLDNASKNLKWATLEEMIDHQQKSPAKIAYKKVQANRTVGLKLTASQVKSIKKTLSSKNRQLTIKKLAEKYKVSEMTMYRIKSGENWGRIK

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
192 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
195 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
201 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
224 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
235 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
249 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
250 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
253 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
254 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
263 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
272 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
275 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
276 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
277 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
278 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
282 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
283 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
284 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
285 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
290 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
291 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 3.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 1.36
Rhizosphere 91.14
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10148307 3300003316 Bacteria 1166
2 rootH2_10007161 3300003320 Bacteria 44535
3 rootH2_10022399 3300003320 Bacteria 6465
4 rootL2_10140308 3300003322 Unclassified 1719
5 rootL2_10142273 3300003322 Bacteria 4235
6 rootH1_10215893 3300003323 Unclassified 1302
7 Ga0065714_10142361 3300005288 Unclassified 1162
8 Ga0065715_10494551 3300005293 Bacteria 785
9 Ga0070676_10002584 3300005328 Bacteria 9312
10 Ga0070676_10314517 3300005328 Bacteria 1066
11 Ga0070676_10441621 3300005328 Unclassified 913
12 Ga0070683_100019393 3300005329 Bacteria 6039
13 Ga0070683_100127576 3300005329 Bacteria 2405
14 Ga0070690_100034920 3300005330 Bacteria 3153
15 Ga0070670_100050768 3300005331 Bacteria 3564
16 Ga0070670_100081061 3300005331 Unclassified 2788
17 Ga0070670_100770020 3300005331 Unclassified 868
18 Ga0070677_10026720 3300005333 Bacteria 2167
19 Ga0070677_10052363 3300005333 Bacteria 1656
20 Ga0068869_100059858 3300005334 Bacteria 2789
21 Ga0068869_100093585 3300005334 Bacteria 2265
22 Ga0068869_100194019 3300005334 Bacteria 1598
23 Ga0070666_10000064 3300005335 Bacteria 79823
24 Ga0070666_10038711 3300005335 Bacteria 3174
25 Ga0070666_10051154 3300005335 Bacteria 2781
26 Ga0070680_100080612 3300005336 Unclassified 2684
27 Ga0068868_100007677 3300005338 Bacteria 7694
28 Ga0068868_100010379 3300005338 Bacteria 6740
29 Ga0070660_100039611 3300005339 Bacteria 3583
30 Ga0070660_100131668 3300005339 Bacteria 2002
31 Ga0070660_100196720 3300005339 Bacteria 1634
32 Ga0070660_100244187 3300005339 Unclassified 1463
33 Ga0070660_100800973 3300005339 Unclassified 792
34 Ga0070689_100083123 3300005340 Unclassified 2516
35 Ga0070689_100146411 3300005340 Bacteria 1903
36 Ga0070689_100448810 3300005340 Bacteria 1097
37 Ga0070689_100577830 3300005340 Bacteria 971
38 Ga0070691_10264916 3300005341 Bacteria 926
39 Ga0070687_100010996 3300005343 Bacteria 3942
40 Ga0070661_100086783 3300005344 Bacteria 2314
41 Ga0070661_100397628 3300005344 Bacteria 1089
42 Ga0070661_100731109 3300005344 Unclassified 808
43 Ga0070692_10096976 3300005345 Bacteria 1611
44 Ga0070668_100061399 3300005347 Bacteria 2911
45 Ga0070668_100119474 3300005347 Bacteria 2105
46 Ga0070668_100124361 3300005347 Bacteria 2065
47 Ga0070669_100135403 3300005353 Bacteria 1894
48 Ga0070669_100375292 3300005353 Bacteria 1159
49 Ga0070669_100403196 3300005353 Bacteria 1119
50 Ga0070669_100510620 3300005353 Bacteria 998
51 Ga0070675_100007473 3300005354 Bacteria 8443
52 Ga0070675_100020329 3300005354 Bacteria 5298
53 Ga0070675_100100489 3300005354 Bacteria 2436
54 Ga0070675_100383148 3300005354 Bacteria 1252
55 Ga0070671_100008963 3300005355 Bacteria 8026
56 Ga0070671_100125143 3300005355 Bacteria 2164
57 Ga0070671_100135819 3300005355 Bacteria 2073
58 Ga0070671_100227586 3300005355 Bacteria 1582
59 Ga0070674_100381068 3300005356 Bacteria 1147
60 Ga0070673_100018983 3300005364 Unclassified 4929
61 Ga0070673_100045734 3300005364 Bacteria 3396
62 Ga0070673_100160576 3300005364 Bacteria 1911
63 Ga0070673_100408699 3300005364 Bacteria 1215
64 Ga0070673_100946510 3300005364 Bacteria 800
65 Ga0070688_100103413 3300005365 Unclassified 1882
66 Ga0070688_100203423 3300005365 Unclassified 1387
67 Ga0070659_100011442 3300005366 Bacteria 6563
68 Ga0070659_100019182 3300005366 Bacteria 5176
69 Ga0070659_100047005 3300005366 Bacteria 3384
70 Ga0070659_100252499 3300005366 Bacteria 1462
71 Ga0070659_100377818 3300005366 Unclassified 1193
72 Ga0070659_100531182 3300005366 Bacteria 1005
73 Ga0070667_100011187 3300005367 Bacteria 7423
74 Ga0070667_100033497 3300005367 Bacteria 4294
75 Ga0070667_100034808 3300005367 Bacteria 4217
76 Ga0070667_100069470 3300005367 Bacteria 2998
77 Ga0070667_100242915 3300005367 Bacteria 1608
78 Ga0070667_100244245 3300005367 Bacteria 1604
79 Ga0070713_100490799 3300005436 Unclassified 1158
80 Ga0070705_100468982 3300005440 Bacteria 949
81 Ga0070700_101238320 3300005441 Bacteria 625
82 Ga0070708_100414349 3300005445 Bacteria 1270
83 Ga0070663_100073450 3300005455 Bacteria 2495
84 Ga0070678_100006906 3300005456 Bacteria 6695
85 Ga0070678_100045196 3300005456 Bacteria 3149
86 Ga0070678_100181858 3300005456 Bacteria 1722
87 Ga0070678_100265992 3300005456 Bacteria 1444
88 Ga0070662_101067069 3300005457 Bacteria 693
89 Ga0070681_10109579 3300005458 Unclassified 2701
90 Ga0070681_10178456 3300005458 Bacteria 2045
91 Ga0070681_10289231 3300005458 Bacteria 1549
92 Ga0068867_100029629 3300005459 Bacteria 3944
93 Ga0068867_100036451 3300005459 Bacteria 3570
94 Ga0068867_100061121 3300005459 Bacteria 2796
95 Ga0068867_100152366 3300005459 Unclassified 1817
96 Ga0070685_10122612 3300005466 Unclassified 1616
97 Ga0070685_10156362 3300005466 Bacteria 1449
98 Ga0070707_100299458 3300005468 Bacteria 1563
99 Ga0070699_100597896 3300005518 Bacteria 1006
100 Ga0070699_100780244 3300005518 Bacteria 874
101 Ga0070679_100155068 3300005530 Bacteria 2265
102 Ga0070679_100634391 3300005530 Bacteria 1011
103 Ga0070684_100010278 3300005535 Bacteria 7408
104 Ga0070684_100126678 3300005535 Unclassified 2301
105 Ga0070684_100160370 3300005535 Unclassified 2040
106 Ga0068853_100019279 3300005539 Bacteria 5654
107 Ga0068853_100024928 3300005539 Bacteria 5018
108 Ga0068853_100052022 3300005539 Bacteria 3527
109 Ga0068853_100077511 3300005539 Bacteria 2903
110 Ga0068853_100190439 3300005539 Unclassified 1863
111 Ga0068853_100608342 3300005539 Bacteria 1038
112 Ga0070672_100015769 3300005543 Bacteria 5395
113 Ga0070672_100042923 3300005543 Bacteria 3483
114 Ga0070672_100062607 3300005543 Bacteria 2936
115 Ga0070672_100343483 3300005543 Bacteria 1271
116 Ga0070672_100678587 3300005543 Bacteria 901
117 Ga0070686_100032168 3300005544 Bacteria 3214
118 Ga0070686_100054825 3300005544 Bacteria 2551
119 Ga0070686_100587872 3300005544 Bacteria 876
120 Ga0070665_100551597 3300005548 Bacteria 1165
121 Ga0070665_101184131 3300005548 Bacteria 775
122 Ga0068855_100012109 3300005563 Bacteria 10421
123 Ga0068855_100088858 3300005563 Bacteria 3568
124 Ga0068855_100278449 3300005563 Bacteria 1858
125 Ga0068855_101488340 3300005563 Unclassified 695
126 Ga0068857_100002898 3300005577 Bacteria 14123
127 Ga0068857_100121848 3300005577 Bacteria 2349
128 Ga0068857_100571820 3300005577 Bacteria 1066
129 Ga0068854_100009648 3300005578 Bacteria 6235
130 Ga0068854_100198279 3300005578 Unclassified 1576
131 Ga0068854_100533459 3300005578 Unclassified 993
132 Ga0068856_100040323 3300005614 Bacteria 4586
133 Ga0068856_100408987 3300005614 Bacteria 1376
134 Ga0068852_100001591 3300005616 Bacteria 15446
135 Ga0068852_100012585 3300005616 Bacteria 6429
136 Ga0068852_100023322 3300005616 Bacteria 4979
137 Ga0068852_100034352 3300005616 Bacteria 4218
138 Ga0068852_100099067 3300005616 Bacteria 2626
139 Ga0068852_100426099 3300005616 Bacteria 1309
140 Ga0068859_100000003 3300005617 Bacteria 479218
141 Ga0068859_100041491 3300005617 Unclassified 4621
142 Ga0068859_100194990 3300005617 Bacteria 2110
143 Ga0068859_100906867 3300005617 Unclassified 966
144 Ga0068864_100005097 3300005618 Bacteria 10764
145 Ga0068864_100126246 3300005618 Unclassified 2293
146 Ga0068864_100767837 3300005618 Unclassified 945
147 Ga0068864_101641445 3300005618 Bacteria 647
148 Ga0068866_10279966 3300005718 Bacteria 1033
149 Ga0068861_100079736 3300005719 Bacteria 2560
150 Ga0068861_100983883 3300005719 Bacteria 804
151 Ga0068851_10021781 3300005834 Bacteria 3114
152 Ga0068851_10116076 3300005834 Bacteria 1434
153 Ga0068851_10278214 3300005834 Bacteria 956
154 Ga0068851_10297199 3300005834 Bacteria 927
155 Ga0068870_10021248 3300005840 Bacteria 3172
156 Ga0068870_10111411 3300005840 Bacteria 1563
157 Ga0068863_100046454 3300005841 Unclassified 4121
158 Ga0068863_100057340 3300005841 Unclassified 3686
159 Ga0068863_100058046 3300005841 Bacteria 3663
160 Ga0068863_101599000 3300005841 Bacteria 661
161 Ga0068858_100002247 3300005842 Bacteria 19511
162 Ga0068858_100477571 3300005842 Bacteria 1203
163 Ga0068858_101157739 3300005842 Bacteria 760
164 Ga0068860_100000003 3300005843 Bacteria 575741
165 Ga0068860_100000922 3300005843 Bacteria 32651
166 Ga0068860_100003440 3300005843 Bacteria 16286
167 Ga0068860_100023100 3300005843 Bacteria 6013
168 Ga0068860_100027499 3300005843 Bacteria 5478
169 Ga0068860_100593900 3300005843 Bacteria 1112
170 Ga0068862_100351733 3300005844 Bacteria 1367
171 Ga0068862_101203640 3300005844 Bacteria 756
172 Ga0075366_10091763 3300006195 Bacteria 1819
173 Ga0097621_100026591 3300006237 Bacteria 4542
174 Ga0097621_100138287 3300006237 Unclassified 2079
175 Ga0097621_100158346 3300006237 Bacteria 1945
176 Ga0097621_100211027 3300006237 Bacteria 1689
177 Ga0097621_100219110 3300006237 Bacteria 1658
178 Ga0097621_100242133 3300006237 Bacteria 1577
179 Ga0097621_100409435 3300006237 Bacteria 1215
180 Ga0068871_100013185 3300006358 Bacteria 6129
181 Ga0068871_100018561 3300006358 Bacteria 5290
182 Ga0068871_100026836 3300006358 Bacteria 4498
183 Ga0068871_100113278 3300006358 Bacteria 2284
184 Ga0068871_100276411 3300006358 Bacteria 1468
185 Ga0068871_100346534 3300006358 Bacteria 1313
186 Ga0075428_100083609 3300006844 Bacteria 3483
187 Ga0075428_100588646 3300006844 Bacteria 1188
188 Ga0075431_100005333 3300006847 Bacteria 12682
189 Ga0068865_100017354 3300006881 Bacteria 4629
190 Ga0068865_100167870 3300006881 Unclassified 1679
191 Ga0068865_100168017 3300006881 Bacteria 1679
192 Ga0068865_100410993 3300006881 Bacteria 1110
193 Ga0068865_100644082 3300006881 Unclassified 900
194 Ga0097620_100000003 3300006931 Bacteria 479218
195 Ga0097620_100041490 3300006931 Unclassified 4621
196 Ga0097620_100194970 3300006931 Bacteria 2110
197 Ga0097620_100906832 3300006931 Unclassified 966
198 Ga0105240_10005046 3300009093 Bacteria 19803
199 Ga0105240_10010802 3300009093 Bacteria 12790
200 Ga0105240_10037254 3300009093 Bacteria 6252
201 Ga0105240_10074008 3300009093 Bacteria 4206
202 Ga0105240_10116116 3300009093 Bacteria 3230
203 Ga0111539_10030751 3300009094 Bacteria 6526
204 Ga0111539_10452587 3300009094 Bacteria 1495
205 Ga0105245_10265262 3300009098 Unclassified 1673
206 Ga0105247_10094094 3300009101 Bacteria 1906
207 Ga0105247_10120246 3300009101 Bacteria 1701
208 Ga0114129_10053458 3300009147 Bacteria 5664
209 Ga0105243_10209203 3300009148 Bacteria 1716
210 Ga0105241_10000543 3300009174 Bacteria 28453
211 Ga0105241_10005905 3300009174 Bacteria 9035
212 Ga0105241_10058013 3300009174 Bacteria 2972
213 Ga0105241_10162841 3300009174 Bacteria 1835
214 Ga0105242_10055664 3300009176 Bacteria 3236
215 Ga0105242_10178068 3300009176 Unclassified 1874
216 Ga0105242_10244250 3300009176 Bacteria 1615
217 Ga0105242_10696219 3300009176 Bacteria 994
218 Ga0105242_10818356 3300009176 Bacteria 924
219 Ga0105248_10025753 3300009177 Bacteria 6543
220 Ga0105248_10200253 3300009177 Unclassified 2250
221 Ga0105237_10000144 3300009545 Bacteria 100105
222 Ga0105237_10001993 3300009545 Bacteria 25973
223 Ga0105237_10006883 3300009545 Bacteria 12532
224 Ga0105237_10009632 3300009545 Bacteria 10342
225 Ga0105237_10028528 3300009545 Bacteria 5683
226 Ga0105237_10044226 3300009545 Bacteria 4484
227 Ga0105237_10194909 3300009545 Bacteria 2025
228 Ga0105237_10462293 3300009545 Bacteria 1275
229 Ga0105237_10545364 3300009545 Bacteria 1166
230 Ga0105237_10730935 3300009545 Bacteria 996
231 Ga0105237_11271910 3300009545 Unclassified 742
232 Ga0105238_10114132 3300009551 Unclassified 2681
233 Ga0105238_10319511 3300009551 Bacteria 1538
234 Ga0105238_10642642 3300009551 Bacteria 1071
235 Ga0105238_10860636 3300009551 Bacteria 924
236 Ga0105249_10011114 3300009553 Bacteria 7908
237 Ga0105249_10058402 3300009553 Unclassified 3536
238 Ga0105249_10261905 3300009553 Bacteria 1719
239 Ga0105239_10000488 3300010375 Bacteria 57554
240 Ga0105239_10000925 3300010375 Bacteria 41596
241 Ga0105239_10024627 3300010375 Bacteria 6630
242 Ga0105239_10091051 3300010375 Unclassified 3365
243 Ga0105239_10099620 3300010375 Unclassified 3213
244 Ga0105239_10173973 3300010375 Unclassified 2408
245 Ga0105239_10427139 3300010375 Bacteria 1502
246 Ga0105239_10739892 3300010375 Bacteria 1125
247 Ga0105246_10006531 3300011119 Bacteria 7120
248 Ga0105246_10059895 3300011119 Bacteria 2643
249 Ga0105246_10696054 3300011119 Bacteria 890
250 Ga0157373_10050446 3300013100 Bacteria 2963
251 Ga0157373_10136394 3300013100 Bacteria 1725
252 Ga0157373_10424115 3300013100 Unclassified 955
253 Ga0157373_10538270 3300013100 Unclassified 846
254 Ga0157371_10035183 3300013102 Bacteria 3589
255 Ga0157371_10102061 3300013102 Unclassified 2035
256 Ga0157371_10385346 3300013102 Bacteria 1024
257 Ga0157371_10430149 3300013102 Bacteria 968
258 Ga0157370_10021933 3300013104 Bacteria 6360
259 Ga0157370_10023822 3300013104 Bacteria 6073
260 Ga0157370_10065454 3300013104 Bacteria 3439
261 Ga0157370_10166787 3300013104 Bacteria 2048
262 Ga0157370_10353171 3300013104 Unclassified 1355
263 Ga0157370_10389553 3300013104 Bacteria 1283
264 Ga0157370_10674300 3300013104 Unclassified 944
265 Ga0157369_10015498 3300013105 Bacteria 8589
266 Ga0157369_10027496 3300013105 Bacteria 6305
267 Ga0157369_10115382 3300013105 Bacteria 2852
268 Ga0157369_10520744 3300013105 Bacteria 1230
269 Ga0157374_10000013 3300013296 Bacteria 461240
270 Ga0157374_10017547 3300013296 Bacteria 6305
271 Ga0157374_10110213 3300013296 Bacteria 2647
272 Ga0157374_10145499 3300013296 Bacteria 2302
273 Ga0157374_10332914 3300013296 Unclassified 1506
274 Ga0157378_10034604 3300013297 Bacteria 4467
275 Ga0157378_10038252 3300013297 Unclassified 4251
276 Ga0157378_10150594 3300013297 Bacteria 2167
277 Ga0157378_12084047 3300013297 Unclassified 618
278 Ga0163162_10000253 3300013306 Bacteria 48450
279 Ga0163162_10001229 3300013306 Bacteria 23943
280 Ga0163162_10007984 3300013306 Bacteria 10321
281 Ga0163162_10009127 3300013306 Bacteria 9644
282 Ga0163162_10024760 3300013306 Bacteria 5928
283 Ga0163162_10314484 3300013306 Bacteria 1699
284 Ga0163162_11185762 3300013306 Bacteria 866
285 Ga0157372_10004419 3300013307 Bacteria 14994
286 Ga0157372_10004778 3300013307 Bacteria 14389
287 Ga0157372_10029858 3300013307 Bacteria 5957
288 Ga0157372_10050322 3300013307 Bacteria 4635
289 Ga0157372_10055189 3300013307 Unclassified 4436
290 Ga0157372_10109539 3300013307 Unclassified 3163
291 Ga0157372_10286395 3300013307 Bacteria 1916
292 Ga0157372_10338726 3300013307 Bacteria 1752
293 Ga0157372_10371445 3300013307 Unclassified 1666
294 Ga0157372_10698759 3300013307 Bacteria 1180
295 Ga0157372_10771460 3300013307 Unclassified 1118
296 Ga0157372_10836045 3300013307 Bacteria 1069
297 Ga0157372_10903328 3300013307 Bacteria 1025
298 Ga0157372_11125747 3300013307 Unclassified 908
299 Ga0157372_11583697 3300013307 Unclassified 754
300 Ga0157375_10000422 3300013308 Bacteria 38347
301 Ga0157375_10031081 3300013308 Bacteria 5041
302 Ga0157375_10075044 3300013308 Bacteria 3405
303 Ga0157375_10218582 3300013308 Unclassified 2064
304 Ga0157375_10347506 3300013308 Bacteria 1649
305 Ga0157375_10348819 3300013308 Bacteria 1646
306 Ga0157375_10367677 3300013308 Bacteria 1604
307 Ga0163163_10001496 3300014325 Bacteria 19803
308 Ga0163163_10004119 3300014325 Bacteria 12386
309 Ga0163163_10028299 3300014325 Bacteria 5379
310 Ga0163163_10065372 3300014325 Bacteria 3610
311 Ga0163163_10310861 3300014325 Bacteria 1629
312 Ga0163163_10404031 3300014325 Unclassified 1424
313 Ga0163163_10803621 3300014325 Bacteria 1004
314 Ga0163163_10970266 3300014325 Unclassified 913
315 Ga0163163_11168118 3300014325 Bacteria 832
316 Ga0157380_10001771 3300014326 Bacteria 14268
317 Ga0157380_10011391 3300014326 Bacteria 6426
318 Ga0157380_10046227 3300014326 Unclassified 3418
319 Ga0157380_10629489 3300014326 Unclassified 1066
320 Ga0157380_11049558 3300014326 Bacteria 851
321 Ga0157380_11433910 3300014326 Bacteria 742
322 Ga0157377_10010186 3300014745 Bacteria 4641
323 Ga0157377_10095251 3300014745 Unclassified 1764
324 Ga0157377_10438605 3300014745 Bacteria 899
325 Ga0157379_10006012 3300014968 Bacteria 10464
326 Ga0157379_10013492 3300014968 Bacteria 7160
327 Ga0157379_10050043 3300014968 Bacteria 3729
328 Ga0157379_10080957 3300014968 Bacteria 2909
329 Ga0157379_10181170 3300014968 Bacteria 1903
330 Ga0157376_10001313 3300014969 Bacteria 16384
331 Ga0157376_10018142 3300014969 Bacteria 5387
332 Ga0157376_10018439 3300014969 Bacteria 5351
333 Ga0157376_10033468 3300014969 Bacteria 4138
334 Ga0157376_10350619 3300014969 Bacteria 1412
335 Ga0157376_11362639 3300014969 Unclassified 740
336 Ga0163161_10002701 3300017792 Bacteria 12608
337 Ga0163161_10036635 3300017792 Bacteria 3514
338 Ga0163161_10153052 3300017792 Bacteria 1754
339 Ga0163161_10288247 3300017792 Bacteria 1290
340 Ga0163161_10354781 3300017792 Bacteria 1167
341 Ga0197907_10511360 3300020069 Unclassified 1145
342 Ga0206352_11004656 3300020078 Unclassified 1241
343 Ga0206350_10162210 3300020080 Unclassified 1016
344 Ga0209646_1007831 3300025246 Bacteria 1733
345 Ga0207666_1042856 3300025271 Bacteria 709
346 Ga0207697_10032830 3300025315 Bacteria 2125
347 Ga0207697_10075258 3300025315 Bacteria 1419
348 Ga0207656_10047186 3300025321 Unclassified 1851
349 Ga0207682_10006837 3300025893 Bacteria 4577
350 Ga0207682_10063915 3300025893 Bacteria 1546
351 Ga0207682_10075863 3300025893 Bacteria 1432
352 Ga0207682_10152211 3300025893 Unclassified 1044
353 Ga0207642_10250461 3300025899 Bacteria 1005
354 Ga0207710_10054535 3300025900 Bacteria 1800
355 Ga0207710_10070967 3300025900 Bacteria 1597
356 Ga0207688_10034169 3300025901 Bacteria 2815
357 Ga0207688_10079716 3300025901 Bacteria 1868
358 Ga0207680_10000054 3300025903 Bacteria 54305
359 Ga0207680_10099815 3300025903 Bacteria 1863
360 Ga0207680_10141780 3300025903 Bacteria 1594
361 Ga0207680_10248323 3300025903 Bacteria 1228
362 Ga0207647_10000064 3300025904 Bacteria 82970
363 Ga0207647_10003263 3300025904 Bacteria 12181
364 Ga0207647_10008387 3300025904 Bacteria 7412
365 Ga0207647_10174890 3300025904 Bacteria 1249
366 Ga0207645_10000352 3300025907 Bacteria 38310
367 Ga0207645_10112575 3300025907 Bacteria 1763
368 Ga0207643_10027738 3300025908 Bacteria 3141
369 Ga0207643_10113336 3300025908 Unclassified 1599
370 Ga0207705_10065461 3300025909 Unclassified 2627
371 Ga0207654_10001121 3300025911 Bacteria 14469
372 Ga0207654_10003601 3300025911 Bacteria 7823
373 Ga0207654_10232166 3300025911 Bacteria 1229
374 Ga0207654_10348665 3300025911 Bacteria 1019
375 Ga0207707_10088343 3300025912 Unclassified 2707
376 Ga0207707_10181623 3300025912 Bacteria 1837
377 Ga0207695_10000056 3300025913 Bacteria 382433
378 Ga0207695_10001122 3300025913 Bacteria 46534
379 Ga0207695_10001317 3300025913 Bacteria 42084
380 Ga0207695_10001383 3300025913 Bacteria 41051
381 Ga0207695_10015819 3300025913 Bacteria 8863
382 Ga0207695_10054760 3300025913 Bacteria 4162
383 Ga0207695_10071354 3300025913 Bacteria 3547
384 Ga0207695_10079185 3300025913 Unclassified 3332
385 Ga0207671_10001689 3300025914 Bacteria 25015
386 Ga0207671_10002585 3300025914 Bacteria 19130
387 Ga0207671_10003111 3300025914 Bacteria 16871
388 Ga0207671_10012969 3300025914 Bacteria 6668
389 Ga0207671_10016185 3300025914 Bacteria 5806
390 Ga0207671_10044863 3300025914 Unclassified 3268
391 Ga0207671_10061597 3300025914 Bacteria 2784
392 Ga0207671_10429961 3300025914 Unclassified 1051
393 Ga0207660_10096729 3300025917 Bacteria 2199
394 Ga0207662_10070492 3300025918 Bacteria 2114
395 Ga0207657_10033042 3300025919 Bacteria 4667
396 Ga0207657_10198499 3300025919 Unclassified 1615
397 Ga0207657_10378679 3300025919 Bacteria 1115
398 Ga0207649_10095654 3300025920 Bacteria 1955
399 Ga0207649_10172496 3300025920 Bacteria 1508
400 Ga0207649_10651184 3300025920 Unclassified 814
401 Ga0207652_10226420 3300025921 Bacteria 1685
402 Ga0207652_10680372 3300025921 Bacteria 919
403 Ga0207681_10077005 3300025923 Bacteria 2343
404 Ga0207681_10536743 3300025923 Unclassified 961
405 Ga0207681_10837024 3300025923 Bacteria 769
406 Ga0207694_10060486 3300025924 Unclassified 2948
407 Ga0207694_10119359 3300025924 Unclassified 2104
408 Ga0207694_11052315 3300025924 Bacteria 689
409 Ga0207650_10018897 3300025925 Bacteria 4842
410 Ga0207650_10067533 3300025925 Bacteria 2683
411 Ga0207650_10204764 3300025925 Unclassified 1582
412 Ga0207650_10276199 3300025925 Bacteria 1367
413 Ga0207650_10579361 3300025925 Unclassified 942
414 Ga0207659_10013556 3300025926 Bacteria 5226
415 Ga0207659_10184807 3300025926 Bacteria 1654
416 Ga0207659_10332966 3300025926 Unclassified 1256
417 Ga0207659_10780781 3300025926 Unclassified 820
418 Ga0207659_11346805 3300025926 Bacteria 612
419 Ga0207687_10315357 3300025927 Bacteria 1264
420 Ga0207644_10049783 3300025931 Bacteria 3001
421 Ga0207644_10085796 3300025931 Unclassified 2336
422 Ga0207644_10193366 3300025931 Bacteria 1601
423 Ga0207644_10194340 3300025931 Bacteria 1597
424 Ga0207644_10282153 3300025931 Bacteria 1334
425 Ga0207690_10015227 3300025932 Bacteria 4657
426 Ga0207690_10141315 3300025932 Bacteria 1774
427 Ga0207690_10159314 3300025932 Unclassified 1681
428 Ga0207706_10617107 3300025933 Bacteria 930
429 Ga0207686_10079447 3300025934 Bacteria 2136
430 Ga0207686_10178649 3300025934 Unclassified 1503
431 Ga0207686_10704682 3300025934 Bacteria 803
432 Ga0207670_10035867 3300025936 Bacteria 3221
433 Ga0207669_10185902 3300025937 Bacteria 1494
434 Ga0207669_10225503 3300025937 Bacteria 1378
435 Ga0207669_10460782 3300025937 Bacteria 1009
436 Ga0207704_10036624 3300025938 Bacteria 2824
437 Ga0207704_10056617 3300025938 Bacteria 2403
438 Ga0207691_10005099 3300025940 Bacteria 12675
439 Ga0207691_10017616 3300025940 Bacteria 6768
440 Ga0207691_10024317 3300025940 Bacteria 5696
441 Ga0207691_10171699 3300025940 Unclassified 1899
442 Ga0207691_10529598 3300025940 Bacteria 1000
443 Ga0207691_10561829 3300025940 Bacteria 967
444 Ga0207691_10814508 3300025940 Bacteria 784
445 Ga0207691_11211432 3300025940 Bacteria 626
446 Ga0207689_10000337 3300025942 Bacteria 43636
447 Ga0207689_10003324 3300025942 Bacteria 14720
448 Ga0207689_10059536 3300025942 Bacteria 3141
449 Ga0207661_10083293 3300025944 Unclassified 2646
450 Ga0207661_10305716 3300025944 Bacteria 1427
451 Ga0207679_10170845 3300025945 Bacteria 1790
452 Ga0207667_10004402 3300025949 Bacteria 17256
453 Ga0207667_10010335 3300025949 Bacteria 10916
454 Ga0207667_10206295 3300025949 Bacteria 2015
455 Ga0207667_10227636 3300025949 Unclassified 1910
456 Ga0207651_10009029 3300025960 Bacteria 5423
457 Ga0207651_10052009 3300025960 Unclassified 2791
458 Ga0207651_10071439 3300025960 Bacteria 2460
459 Ga0207651_10209932 3300025960 Bacteria 1566
460 Ga0207651_10316254 3300025960 Bacteria 1304
461 Ga0207712_10005606 3300025961 Bacteria 7914
462 Ga0207712_10078718 3300025961 Bacteria 2393
463 Ga0207668_10466938 3300025972 Bacteria 1080
464 Ga0207668_10538802 3300025972 Bacteria 1009
465 Ga0207640_10030773 3300025981 Bacteria 3309
466 Ga0207640_10043608 3300025981 Bacteria 2868
467 Ga0207640_10064775 3300025981 Unclassified 2435
468 Ga0207640_10543385 3300025981 Bacteria 975
469 Ga0207640_10846660 3300025981 Unclassified 795
470 Ga0207658_10016928 3300025986 Bacteria 5018
471 Ga0207658_10085598 3300025986 Unclassified 2428
472 Ga0207658_10120149 3300025986 Unclassified 2094
473 Ga0207658_10182831 3300025986 Bacteria 1736
474 Ga0207658_10756524 3300025986 Unclassified 880
475 Ga0207677_10001184 3300026023 Bacteria 14185
476 Ga0207677_10020347 3300026023 Bacteria 4028
477 Ga0207677_10047442 3300026023 Bacteria 2884
478 Ga0207677_10147398 3300026023 Bacteria 1811
479 Ga0207703_10018354 3300026035 Bacteria 5462
480 Ga0207639_10003376 3300026041 Bacteria 10738
481 Ga0207639_10005516 3300026041 Bacteria 8551
482 Ga0207639_10012234 3300026041 Bacteria 5972
483 Ga0207639_10047321 3300026041 Unclassified 3250
484 Ga0207639_10049107 3300026041 Bacteria 3197
485 Ga0207639_10092994 3300026041 Bacteria 2417
486 Ga0207639_10145648 3300026041 Bacteria 1978
487 Ga0207639_10194828 3300026041 Bacteria 1733
488 Ga0207639_10549310 3300026041 Unclassified 1060
489 Ga0207639_10565444 3300026041 Bacteria 1045
490 Ga0207678_10163164 3300026067 Bacteria 1903
491 Ga0207678_10163319 3300026067 Bacteria 1902
492 Ga0207678_10189342 3300026067 Bacteria 1758
493 Ga0207678_10853090 3300026067 Bacteria 805
494 Ga0207702_10020706 3300026078 Bacteria 5440
495 Ga0207702_10028278 3300026078 Bacteria 4659
496 Ga0207702_10920178 3300026078 Unclassified 867
497 Ga0207641_10000026 3300026088 Bacteria 245091
498 Ga0207648_10001428 3300026089 Bacteria 26300
499 Ga0207648_10087264 3300026089 Bacteria 2723
500 Ga0207648_10209801 3300026089 Unclassified 1729
501 Ga0207648_10304236 3300026089 Bacteria 1430
502 Ga0207648_10418865 3300026089 Unclassified 1216
503 Ga0207676_10023052 3300026095 Unclassified 4586
504 Ga0207676_10123693 3300026095 Unclassified 2186
505 Ga0207676_10171220 3300026095 Bacteria 1892
506 Ga0207676_10409887 3300026095 Bacteria 1269
507 Ga0207676_10507695 3300026095 Bacteria 1146
508 Ga0207676_10586145 3300026095 Unclassified 1069
509 Ga0207674_10012728 3300026116 Bacteria 9402
510 Ga0207674_10036451 3300026116 Bacteria 5125
511 Ga0207674_10107502 3300026116 Bacteria 2767
512 Ga0207675_100039383 3300026118 Bacteria 4411
513 Ga0207675_100446592 3300026118 Unclassified 1281
514 Ga0207675_101092334 3300026118 Bacteria 817
515 Ga0207683_10001458 3300026121 Bacteria 21328
516 Ga0207683_10065455 3300026121 Bacteria 3205
517 Ga0207683_10172343 3300026121 Bacteria 1960
518 Ga0207683_10183521 3300026121 Unclassified 1898
519 Ga0207683_10211141 3300026121 Bacteria 1767
520 Ga0207698_10004047 3300026142 Bacteria 8902
521 Ga0207698_10016155 3300026142 Bacteria 5023
522 Ga0207698_10023910 3300026142 Bacteria 4278
523 Ga0207698_10038711 3300026142 Bacteria 3526
524 Ga0207698_10073503 3300026142 Bacteria 2723
525 Ga0209984_1011145 3300027424 Bacteria 1162
526 Ga0209995_1014031 3300027471 Unclassified 1314
527 Ga0210002_1020593 3300027617 Bacteria 1062
528 Ga0209974_10049027 3300027876 Unclassified 1416
529 Ga0209974_10145073 3300027876 Bacteria 854
530 Ga0268266_10000169 3300028379 Bacteria 119437
531 Ga0268266_10101400 3300028379 Bacteria 2537
532 Ga0268264_10000063 3300028381 Bacteria 301702
533 Ga0268264_10001200 3300028381 Bacteria 25018
534 Ga0268264_10004205 3300028381 Bacteria 12288
535 Ga0268264_10006017 3300028381 Bacteria 10265
536 Ga0268264_10041768 3300028381 Bacteria 3794
537 Ga0268264_10079293 3300028381 Bacteria 2801
538 Ga0268264_10290277 3300028381 Bacteria 1536
539 Ga0268264_10375142 3300028381 Unclassified 1361
540 Ga0307517_10139002 3300028786 Bacteria 1714
541 Ga0307515_10001389 3300028794 Bacteria 54743
542 Ga0307511_10000409 3300030521 Bacteria 45829
543 Ga0265327_10006319 3300031251 Bacteria 9518
544 Ga0307513_10085521 3300031456 Bacteria 3236
545 Ga0307513_10475437 3300031456 Unclassified 970
546 Ga0307509_10131040 3300031507 Bacteria 2463
547 Ga0307509_10411529 3300031507 Bacteria 1056
548 Ga0307508_10000485 3300031616 Bacteria 47975
549 Ga0307508_10318065 3300031616 Bacteria 1148
550 Ga0307516_10003090 3300031730 Bacteria 21666
551 Ga0307516_10093156 3300031730 Bacteria 2839
552 Ga0307516_10199285 3300031730 Bacteria 1723
553 Ga0307410_10435550 3300031852 Bacteria 1066
554 Ga0307406_10112818 3300031901 Bacteria 1875
555 Ga0307416_100110558 3300032002 Bacteria 2420
556 Ga0307416_100914187 3300032002 Bacteria 978
557 Ga0307414_10374611 3300032004 Bacteria 1229
558 Ga0307414_10664091 3300032004 Bacteria 941
559 Ga0307411_10204649 3300032005 Bacteria 1519
560 Ga0307411_10687572 3300032005 Bacteria 890
561 Ga0307415_100093430 3300032126 Bacteria 2184
562 Ga0307415_100571597 3300032126 Bacteria 1001
563 Ga0307415_100763073 3300032126 Bacteria 879
564 Ga0307510_10000156 3300033180 Bacteria 56919
565 Ga0373939_0241877 3300035114 Bacteria 699
566 Ga0373927_0143992 3300035695 Bacteria 1560
567 Ga0373925_0301651 3300037068 Bacteria 1293
568 Ga0395900_0040184 3300037418 Bacteria 4821
569 Ga0395898_0320103 3300037466 Viruses 1480
570 Ga0395901_0111267 3300038443 Bacteria 2876
571 Ga0439436_0038066 3300041404 Bacteria 1384
572 Ga0439439_0126279 3300041406 Bacteria 716
573 Ga0451792_09039 3300041445 Bacteria 595
574 Ga0451791_0594761 3300041451 Bacteria 911
575 Ga0451800_1224414 3300041459 Bacteria 1972
576 Ga0451805_092861 3300041461 Bacteria 646
577 Ga0451833_0563121 3300041491 Bacteria 1165
578 Ga0451841_0486093 3300041498 Bacteria 996
579 Ga0451849_0231858 3300041505 Unclassified 1499
580 Ga0451849_0981161 3300041505 Bacteria 1617
581 Ga0451850_60345 3300041506 Bacteria 720
582 Ga0451853_3832616 3300041512 Bacteria 894
583 Ga0439433_0016269 3300041999 Unclassified 1647
584 Ga0439445_0045264 3300042004 Bacteria 1177
585 Ga0439448_0149498 3300042005 Bacteria 810
586 Ga0439449_0051924 3300042007 Bacteria 1516
587 Ga0439449_0146400 3300042007 Bacteria 880
588 Ga0439457_000945 3300042014 Bacteria 8724
589 Ga0451577_0001932 3300042876 Bacteria 26161
590 Ga0451577_0106051 3300042876 Bacteria 2512
591 Ga0466969_0168597 3300044656 Bacteria 1004
592 Ga0466972_0001713 3300044658 Bacteria 10754
593 Ga0466972_0019149 3300044658 Bacteria 3423
594 Ga0466972_0049494 3300044658 Bacteria 2030
595 Ga0466972_0242982 3300044658 Unclassified 842
596 Ga0453683_0245289 3300044673 Bacteria 1141
597 Ga0453683_0337265 3300044673 Unclassified 967
598 Ga0466965_0096230 3300044683 Bacteria 1510
599 Ga0466961_0053887 3300044693 Bacteria 2566
600 Ga0453684_0023709 3300044712 Bacteria 9015
601 Ga0453684_0024719 3300044712 Bacteria 8759
602 Ga0453684_0226048 3300044712 Unclassified 2164
603 Ga0453684_0923574 3300044712 Unclassified 933
604 Ga0466971_0065433 3300044719 Bacteria 1646
605 Ga0466968_0024154 3300044735 Bacteria 2482
606 Ga0466968_0053392 3300044735 Bacteria 1731
607 Ga0466970_0074443 3300044765 Bacteria 1828
608 Ga0466970_0116658 3300044765 Bacteria 1460
609 Ga0466957_0001412 3300044842 Bacteria 12519
610 Ga0466957_0072732 3300044842 Bacteria 2129
611 Ga0466959_0054555 3300045049 Bacteria 2919
612 Ga0451576_0313597 3300045051 Unclassified 1641
613 Ga0466958_0165347 3300045836 Bacteria 1400
614 Ga0495638_0042798 3300046460 Bacteria 2860
615 Ga0495638_0118921 3300046460 Bacteria 1563
616 Ga0495606_0008396 3300046507 Bacteria 8987
617 Ga0495630_0970953 3300046517 Bacteria 646
618 Ga0495648_0005427 3300046524 Bacteria 10592
619 Ga0495611_0000061 3300046648 Bacteria 77533
620 Ga0495635_0130120 3300046663 Unclassified 1716
621 Ga0495672_0016954 3300047320 Bacteria 4882
622 Ga0495672_0092833 3300047320 Bacteria 1654
623 Ga0495672_0131956 3300047320 Bacteria 1313
624 Ga0495687_001475 3300047443 Bacteria 21512
625 Ga0495686_0000010 3300047472 Bacteria 573229
626 Ga0496100_0188765 3300048903 Bacteria 1495
627 Ga0496102_0941024 3300048905 Bacteria 785
628 Ga0496104_0544376 3300048907 Bacteria 1072
629 Ga0496106_0446598 3300048909 Bacteria 1039
630 Ga0496114_0126267 3300048917 Bacteria 2205
631 Ga0496115_0182577 3300048918 Bacteria 1734
632 Ga0501308_043395 3300049128 Bacteria 639
633 Ga0501308_054016 3300049128 Bacteria 594
634 Ga0501304_024782 3300049160 Bacteria 612
635 Ga0501305_075692 3300049161 Bacteria 598
636 Ga0501298_076408 3300049521 Bacteria 730
637 Ga0501317_045829 3300049533 Bacteria 681
638 Ga0501327_08393 3300049543 Bacteria 656
639 Ga0501335_008372 3300049551 Bacteria 971
640 Ga0501032_0116661 3300049569 Bacteria 1765
641 Ga0501033_0113933 3300049570 Bacteria 1966
642 Ga0501033_0201368 3300049570 Unclassified 1422
643 Ga0501034_0000007 3300049571 Bacteria 357805
644 Ga0501034_0009847 3300049571 Bacteria 9994
645 Ga0501034_0023022 3300049571 Bacteria 6348
646 Ga0501034_0211523 3300049571 Bacteria 1894
647 Ga0501036_0277678 3300049572 Bacteria 1402
648 Ga0501036_0282605 3300049572 Bacteria 1389
649 Ga0501036_0957360 3300049572 Unclassified 701
650 Ga0501037_0089565 3300049573 Unclassified 2226
651 Ga0501037_0182795 3300049573 Bacteria 1487
652 Ga0501038_0004606 3300049574 Bacteria 12825
653 Ga0501039_0022527 3300049575 Unclassified 4835
654 Ga0501039_0023758 3300049575 Bacteria 4705
655 Ga0501043_0013799 3300049579 Bacteria 6323
656 Ga0501043_0024672 3300049579 Bacteria 4716
657 Ga0501043_0030889 3300049579 Bacteria 4213
658 Ga0501043_0033225 3300049579 Bacteria 4058
659 Ga0501043_0049730 3300049579 Bacteria 3296
660 Ga0501046_0156098 3300049580 Bacteria 1719
661 Ga0501046_0210364 3300049580 Unclassified 1444
662 Ga0501046_0241229 3300049580 Bacteria 1333
663 Ga0501047_0058438 3300049581 Bacteria 3726
664 Ga0501047_0535195 3300049581 Bacteria 997
665 Ga0501047_0620678 3300049581 Unclassified 902
666 Ga0501047_0695658 3300049581 Unclassified 834
667 Ga0501201_008448 3300049651 Bacteria 995
668 Ga0501202_014928 3300049652 Bacteria 1491
669 Ga0501227_103046 3300049665 Bacteria 760
670 Ga0501233_069478 3300049668 Unclassified 890
671 Ga0501240_026182 3300049673 Bacteria 910
672 Ga0501243_001398 3300049675 Bacteria 3449
673 Ga0501252_007922 3300049682 Bacteria 1212
674 Ga0501257_063921 3300049686 Unclassified 933
675 Ga0501257_071849 3300049686 Bacteria 885
676 Ga0501257_101105 3300049686 Bacteria 757
677 Ga0501259_009713 3300049688 Bacteria 1564
678 Ga0501261_030697 3300049690 Bacteria 812
679 Ga0501221_017241 3300049704 Bacteria 1376
680 Ga0501225_0001947 3300049705 Bacteria 6463
681 Ga0501245_022368 3300049708 Bacteria 997
682 Ga0501083_0411517 3300049744 Unclassified 880
683 Ga0501083_0614166 3300049744 Unclassified 707
684 Ga0501266_002322 3300049763 Bacteria 2407
685 Ga0501270_045225 3300049767 Bacteria 780
686 Ga0501035_0266957 3300049822 Bacteria 1449
687 Ga0501044_0060496 3300049823 Bacteria 3878
688 Ga0501044_0105210 3300049823 Bacteria 2835
689 Ga0501044_0158560 3300049823 Unclassified 2241
690 Ga0501044_0357018 3300049823 Bacteria 1380
691 Ga0501284_00001 3300050005 Bacteria 261916
692 nmdc:mga06r32_21132_c1 3300050510 Bacteria 6006
693 nmdc:mga08y16_26956_c1 3300050511 Bacteria 6056
694 Ga0500578_0001290 3300053086 Bacteria 25877
695 Ga0500646_0003313 3300053090 Bacteria 4137
696 Ga0500646_0253714 3300053090 Unclassified 620
697 Ga0500647_0273419 3300053091 Bacteria 733
698 Ga0500583_0000019 3300053092 Bacteria 130534
699 Ga0500583_0013004 3300053092 Bacteria 3201
700 Ga0500583_0031093 3300053092 Bacteria 2343
701 Ga0500651_0449276 3300053093 Bacteria 717
702 Ga0500554_126087 3300053102 Bacteria 864
703 Ga0500555_061837 3300053103 Bacteria 1005
704 Ga0500569_150637 3300053109 Bacteria 785
705 Ga0500655_062479 3300053133 Bacteria 752
706 Ga0500658_0238651 3300053134 Bacteria 835
707 Ga0500559_0063794 3300053136 Bacteria 1647
708 Ga0500568_0043964 3300053139 Unclassified 1784
709 Ga0500573_0131318 3300053140 Bacteria 1387
710 Ga0500588_0001676 3300053146 Bacteria 4291
711 Ga0500588_0025075 3300053146 Bacteria 1653
712 Ga0500589_168170 3300053147 Bacteria 874
713 Ga0500590_251484 3300053148 Bacteria 702
714 Ga0500604_0012513 3300053151 Bacteria 2291
715 Ga0500604_0019789 3300053151 Bacteria 1889
716 Ga0500616_0167768 3300053153 Bacteria 1000
717 Ga0500616_0320113 3300053153 Bacteria 639
718 Ga0500619_064314 3300053154 Bacteria 1212
719 Ga0500636_0251058 3300053177 Bacteria 902
720 Ga0500611_008861 3300053727 Bacteria 1573
721 Ga0500661_048378 3300055283 Bacteria 758
722 Ga0587073_0154144 3300059492 Bacteria 652
723 Ga0587077_126219 3300059493 Bacteria 644
724 Ga0587099_024505 3300059622 Bacteria 702
725 Ga0587109_053307 3300059624 Bacteria 834
726 Ga0587128_026935 3300059630 Unclassified 925
727 Ga0587130_023913 3300059631 Bacteria 675
728 Ga0587062_042940 3300059639 Bacteria 740
729 Ga0587067_043997 3300059640 Unclassified 878
730 Ga0587068_073042 3300059641 Bacteria 680
731 Ga0587081_07056 3300060246 Bacteria 769
732 Ga0587111_0077246 3300060346 Bacteria 789
733 Ga0466962_0001581 3300061719 Bacteria 10654
734 Ga0466962_0397283 3300061719 Bacteria 690

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100770020 Ga0070670_1007700202 185
2 3300005353 Ga0070669_100510620 Ga0070669_1005106201 185
3 3300005354 Ga0070675_100020329 Ga0070675_1000203294 185
4 3300005364 Ga0070673_100160576 Ga0070673_1001605762 185
5 3300005518 Ga0070699_100780244 Ga0070699_1007802441 185
6 3300005543 Ga0070672_100678587 Ga0070672_1006785871 185
7 3300005617 Ga0068859_100906867 Ga0068859_1009068672 185
8 3300005844 Ga0068862_100351733 Ga0068862_1003517332 185
9 3300006844 Ga0075428_100083609 Ga0075428_1000836092 185
10 3300006844 Ga0075428_100588646 Ga0075428_1005886462 185
11 3300006847 Ga0075431_100005333 Ga0075431_1000053336 185
12 3300006931 Ga0097620_100906832 Ga0097620_1009068322 185
13 3300009094 Ga0111539_10030751 Ga0111539_100307512 185
14 3300009094 Ga0111539_10452587 Ga0111539_104525872 185
15 3300009147 Ga0114129_10053458 Ga0114129_100534582 185
16 3300013307 Ga0157372_10836045 Ga0157372_108360452 185
17 3300013308 Ga0157375_10367677 Ga0157375_103676771 185
18 3300014326 Ga0157380_11049558 Ga0157380_110495582 185
19 3300025271 Ga0207666_1042856 Ga0207666_10428561 185
20 3300025923 Ga0207681_10837024 Ga0207681_108370242 185
21 3300025926 Ga0207659_10780781 Ga0207659_107807811 185
22 3300025940 Ga0207691_11211432 Ga0207691_112114321 185
23 3300025960 Ga0207651_10316254 Ga0207651_103162542 185
24 3300025981 Ga0207640_10543385 Ga0207640_105433852 185
25 3300027617 Ga0210002_1020593 Ga0210002_10205932 185
26 3300027876 Ga0209974_10145073 Ga0209974_101450732 185
27 3300032002 Ga0307416_100914187 Ga0307416_1009141872 185
28 3300049521 Ga0501298_076408 Ga0501298_076408_154_711 185
29 3300049569 Ga0501032_0116661 Ga0501032_0116661_531_1088 185
30 3300049570 Ga0501033_0113933 Ga0501033_0113933_700_1257 185
31 3300049571 Ga0501034_0023022 Ga0501034_0023022_5313_5870 185
32 3300049572 Ga0501036_0277678 Ga0501036_0277678_310_867 185
33 3300049573 Ga0501037_0182795 Ga0501037_0182795_170_727 185
34 3300049575 Ga0501039_0023758 Ga0501039_0023758_723_1280 185
35 3300049579 Ga0501043_0030889 Ga0501043_0030889_3497_4054 185
36 3300049579 Ga0501043_0049730 Ga0501043_0049730_761_1318 185
37 3300049580 Ga0501046_0241229 Ga0501046_0241229_281_838 185
38 3300049822 Ga0501035_0266957 Ga0501035_0266957_608_1165 185
39 3300049823 Ga0501044_0105210 Ga0501044_0105210_972_1529 185
40 3300050510 nmdc:mga06r32_21132_c1 nmdc:mga06r32_21132_c1_1844_2401 185
41 3300050511 nmdc:mga08y16_26956_c1 nmdc:mga08y16_26956_c1_578_1135 185
42 3300003316 rootH1_10148307 rootH1_101483072 186
43 3300003320 rootH2_10007161 rootH2_100071618 186
44 3300003320 rootH2_10022399 rootH2_100223998 186
45 3300003322 rootL2_10140308 rootL2_101403082 186
46 3300003322 rootL2_10142273 rootL2_101422733 186
47 3300003323 rootH1_10215893 rootH1_102158932 186
48 3300005288 Ga0065714_10142361 Ga0065714_101423611 186
49 3300005293 Ga0065715_10494551 Ga0065715_104945511 186
50 3300005328 Ga0070676_10002584 Ga0070676_100025845 186
51 3300005328 Ga0070676_10314517 Ga0070676_103145172 186
52 3300005328 Ga0070676_10441621 Ga0070676_104416212 186
53 3300005329 Ga0070683_100019393 Ga0070683_1000193933 186
54 3300005329 Ga0070683_100127576 Ga0070683_1001275763 186
55 3300005330 Ga0070690_100034920 Ga0070690_1000349203 186
56 3300005331 Ga0070670_100050768 Ga0070670_1000507682 186
57 3300005331 Ga0070670_100081061 Ga0070670_1000810612 186
58 3300005333 Ga0070677_10026720 Ga0070677_100267202 186
59 3300005333 Ga0070677_10052363 Ga0070677_100523632 186
60 3300005334 Ga0068869_100059858 Ga0068869_1000598582 186
61 3300005334 Ga0068869_100093585 Ga0068869_1000935852 186
62 3300005334 Ga0068869_100194019 Ga0068869_1001940192 186
63 3300005335 Ga0070666_10000064 Ga0070666_1000006429 186
64 3300005335 Ga0070666_10038711 Ga0070666_100387112 186
65 3300005335 Ga0070666_10051154 Ga0070666_100511542 186
66 3300005336 Ga0070680_100080612 Ga0070680_1000806124 186
67 3300005338 Ga0068868_100007677 Ga0068868_1000076772 186
68 3300005338 Ga0068868_100010379 Ga0068868_1000103795 186
69 3300005339 Ga0070660_100039611 Ga0070660_1000396112 186
70 3300005339 Ga0070660_100131668 Ga0070660_1001316681 186
71 3300005339 Ga0070660_100196720 Ga0070660_1001967202 186
72 3300005339 Ga0070660_100244187 Ga0070660_1002441872 186
73 3300005339 Ga0070660_100800973 Ga0070660_1008009731 186
74 3300005340 Ga0070689_100083123 Ga0070689_1000831233 186
75 3300005340 Ga0070689_100146411 Ga0070689_1001464112 186
76 3300005340 Ga0070689_100448810 Ga0070689_1004488102 186
77 3300005340 Ga0070689_100577830 Ga0070689_1005778302 186
78 3300005341 Ga0070691_10264916 Ga0070691_102649161 186
79 3300005343 Ga0070687_100010996 Ga0070687_1000109963 186
80 3300005344 Ga0070661_100086783 Ga0070661_1000867833 186
81 3300005344 Ga0070661_100397628 Ga0070661_1003976281 186
82 3300005344 Ga0070661_100731109 Ga0070661_1007311091 186
83 3300005345 Ga0070692_10096976 Ga0070692_100969762 186
84 3300005347 Ga0070668_100061399 Ga0070668_1000613991 186
85 3300005347 Ga0070668_100119474 Ga0070668_1001194742 186
86 3300005347 Ga0070668_100124361 Ga0070668_1001243612 186
87 3300005353 Ga0070669_100135403 Ga0070669_1001354032 186
88 3300005353 Ga0070669_100375292 Ga0070669_1003752922 186
89 3300005353 Ga0070669_100403196 Ga0070669_1004031962 186
90 3300005354 Ga0070675_100007473 Ga0070675_1000074732 186
91 3300005354 Ga0070675_100100489 Ga0070675_1001004892 186
92 3300005354 Ga0070675_100383148 Ga0070675_1003831481 186
93 3300005355 Ga0070671_100008963 Ga0070671_1000089632 186
94 3300005355 Ga0070671_100125143 Ga0070671_1001251432 186
95 3300005355 Ga0070671_100135819 Ga0070671_1001358191 186
96 3300005355 Ga0070671_100227586 Ga0070671_1002275862 186
97 3300005356 Ga0070674_100381068 Ga0070674_1003810682 186
98 3300005364 Ga0070673_100018983 Ga0070673_1000189837 186
99 3300005364 Ga0070673_100045734 Ga0070673_1000457342 186
100 3300005364 Ga0070673_100408699 Ga0070673_1004086992 186
101 3300005364 Ga0070673_100946510 Ga0070673_1009465101 186
102 3300005365 Ga0070688_100103413 Ga0070688_1001034133 186
103 3300005365 Ga0070688_100203423 Ga0070688_1002034231 186
104 3300005366 Ga0070659_100011442 Ga0070659_1000114426 186
105 3300005366 Ga0070659_100019182 Ga0070659_1000191824 186
106 3300005366 Ga0070659_100047005 Ga0070659_1000470055 186
107 3300005366 Ga0070659_100252499 Ga0070659_1002524992 186
108 3300005366 Ga0070659_100377818 Ga0070659_1003778182 186
109 3300005366 Ga0070659_100531182 Ga0070659_1005311821 186
110 3300005367 Ga0070667_100011187 Ga0070667_1000111874 186
111 3300005367 Ga0070667_100033497 Ga0070667_1000334972 186
112 3300005367 Ga0070667_100034808 Ga0070667_1000348082 186
113 3300005367 Ga0070667_100069470 Ga0070667_1000694701 186
114 3300005367 Ga0070667_100242915 Ga0070667_1002429152 186
115 3300005367 Ga0070667_100244245 Ga0070667_1002442452 186
116 3300005436 Ga0070713_100490799 Ga0070713_1004907991 186
117 3300005440 Ga0070705_100468982 Ga0070705_1004689821 186
118 3300005441 Ga0070700_101238320 Ga0070700_1012383201 186
119 3300005445 Ga0070708_100414349 Ga0070708_1004143491 186
120 3300005455 Ga0070663_100073450 Ga0070663_1000734502 186
121 3300005456 Ga0070678_100006906 Ga0070678_1000069062 186
122 3300005456 Ga0070678_100045196 Ga0070678_1000451964 186
123 3300005456 Ga0070678_100181858 Ga0070678_1001818581 186
124 3300005456 Ga0070678_100265992 Ga0070678_1002659922 186
125 3300005457 Ga0070662_101067069 Ga0070662_1010670691 186
126 3300005458 Ga0070681_10109579 Ga0070681_101095792 186
127 3300005458 Ga0070681_10178456 Ga0070681_101784562 186
128 3300005458 Ga0070681_10289231 Ga0070681_102892311 186
129 3300005459 Ga0068867_100029629 Ga0068867_1000296294 186
130 3300005459 Ga0068867_100036451 Ga0068867_1000364512 186
131 3300005459 Ga0068867_100061121 Ga0068867_1000611212 186
132 3300005459 Ga0068867_100152366 Ga0068867_1001523662 186
133 3300005466 Ga0070685_10122612 Ga0070685_101226122 186
134 3300005466 Ga0070685_10156362 Ga0070685_101563622 186
135 3300005468 Ga0070707_100299458 Ga0070707_1002994582 186
136 3300005518 Ga0070699_100597896 Ga0070699_1005978962 186
137 3300005530 Ga0070679_100155068 Ga0070679_1001550681 186
138 3300005530 Ga0070679_100634391 Ga0070679_1006343912 186
139 3300005535 Ga0070684_100010278 Ga0070684_1000102782 186
140 3300005535 Ga0070684_100126678 Ga0070684_1001266783 186
141 3300005535 Ga0070684_100160370 Ga0070684_1001603701 186
142 3300005539 Ga0068853_100019279 Ga0068853_1000192793 186
143 3300005539 Ga0068853_100024928 Ga0068853_1000249283 186
144 3300005539 Ga0068853_100052022 Ga0068853_1000520224 186
145 3300005539 Ga0068853_100077511 Ga0068853_1000775112 186
146 3300005539 Ga0068853_100190439 Ga0068853_1001904391 186
147 3300005539 Ga0068853_100608342 Ga0068853_1006083422 186
148 3300005543 Ga0070672_100015769 Ga0070672_1000157694 186
149 3300005543 Ga0070672_100042923 Ga0070672_1000429232 186
150 3300005543 Ga0070672_100062607 Ga0070672_1000626073 186
151 3300005543 Ga0070672_100343483 Ga0070672_1003434832 186
152 3300005544 Ga0070686_100032168 Ga0070686_1000321683 186
153 3300005544 Ga0070686_100054825 Ga0070686_1000548252 186
154 3300005544 Ga0070686_100587872 Ga0070686_1005878721 186
155 3300005548 Ga0070665_100551597 Ga0070665_1005515972 186
156 3300005548 Ga0070665_101184131 Ga0070665_1011841311 186
157 3300005563 Ga0068855_100012109 Ga0068855_10001210910 186
158 3300005563 Ga0068855_100088858 Ga0068855_1000888584 186
159 3300005563 Ga0068855_100278449 Ga0068855_1002784492 186
160 3300005563 Ga0068855_101488340 Ga0068855_1014883401 186
161 3300005577 Ga0068857_100002898 Ga0068857_10000289812 186
162 3300005577 Ga0068857_100121848 Ga0068857_1001218482 186
163 3300005577 Ga0068857_100571820 Ga0068857_1005718201 186
164 3300005578 Ga0068854_100009648 Ga0068854_1000096483 186
165 3300005578 Ga0068854_100198279 Ga0068854_1001982792 186
166 3300005578 Ga0068854_100533459 Ga0068854_1005334591 186
167 3300005614 Ga0068856_100040323 Ga0068856_1000403233 186
168 3300005614 Ga0068856_100408987 Ga0068856_1004089872 186
169 3300005616 Ga0068852_100001591 Ga0068852_1000015918 186
170 3300005616 Ga0068852_100012585 Ga0068852_1000125853 186
171 3300005616 Ga0068852_100023322 Ga0068852_1000233223 186
172 3300005616 Ga0068852_100034352 Ga0068852_1000343522 186
173 3300005616 Ga0068852_100099067 Ga0068852_1000990672 186
174 3300005616 Ga0068852_100426099 Ga0068852_1004260991 186
175 3300005617 Ga0068859_100000003 Ga0068859_100000003112 186
176 3300005617 Ga0068859_100041491 Ga0068859_1000414916 186
177 3300005617 Ga0068859_100194990 Ga0068859_1001949902 186
178 3300005618 Ga0068864_100005097 Ga0068864_10000509710 186
179 3300005618 Ga0068864_100126246 Ga0068864_1001262462 186
180 3300005618 Ga0068864_100767837 Ga0068864_1007678372 186
181 3300005618 Ga0068864_101641445 Ga0068864_1016414451 186
182 3300005718 Ga0068866_10279966 Ga0068866_102799661 186
183 3300005719 Ga0068861_100079736 Ga0068861_1000797362 186
184 3300005719 Ga0068861_100983883 Ga0068861_1009838831 186
185 3300005834 Ga0068851_10021781 Ga0068851_100217812 186
186 3300005834 Ga0068851_10116076 Ga0068851_101160762 186
187 3300005834 Ga0068851_10278214 Ga0068851_102782142 186
188 3300005834 Ga0068851_10297199 Ga0068851_102971991 186
189 3300005840 Ga0068870_10021248 Ga0068870_100212482 186
190 3300005840 Ga0068870_10111411 Ga0068870_101114112 186
191 3300005841 Ga0068863_100046454 Ga0068863_1000464544 186
192 3300005841 Ga0068863_100057340 Ga0068863_1000573401 186
193 3300005841 Ga0068863_100058046 Ga0068863_1000580463 186
194 3300005841 Ga0068863_101599000 Ga0068863_1015990001 186
195 3300005842 Ga0068858_100002247 Ga0068858_1000022472 186
196 3300005842 Ga0068858_100477571 Ga0068858_1004775712 186
197 3300005842 Ga0068858_101157739 Ga0068858_1011577391 186
198 3300005843 Ga0068860_100000003 Ga0068860_100000003274 186
199 3300005843 Ga0068860_100000922 Ga0068860_10000092218 186
200 3300005843 Ga0068860_100003440 Ga0068860_1000034408 186
201 3300005843 Ga0068860_100023100 Ga0068860_1000231004 186
202 3300005843 Ga0068860_100027499 Ga0068860_1000274995 186
203 3300005843 Ga0068860_100593900 Ga0068860_1005939002 186
204 3300005844 Ga0068862_101203640 Ga0068862_1012036401 186
205 3300006195 Ga0075366_10091763 Ga0075366_100917633 186
206 3300006237 Ga0097621_100026591 Ga0097621_1000265912 186
207 3300006237 Ga0097621_100138287 Ga0097621_1001382872 186
208 3300006237 Ga0097621_100158346 Ga0097621_1001583462 186
209 3300006237 Ga0097621_100211027 Ga0097621_1002110271 186
210 3300006237 Ga0097621_100219110 Ga0097621_1002191102 186
211 3300006237 Ga0097621_100242133 Ga0097621_1002421332 186
212 3300006237 Ga0097621_100409435 Ga0097621_1004094352 186
213 3300006358 Ga0068871_100013185 Ga0068871_1000131852 186
214 3300006358 Ga0068871_100018561 Ga0068871_1000185611 186
215 3300006358 Ga0068871_100026836 Ga0068871_1000268363 186
216 3300006358 Ga0068871_100113278 Ga0068871_1001132783 186
217 3300006358 Ga0068871_100276411 Ga0068871_1002764112 186
218 3300006358 Ga0068871_100346534 Ga0068871_1003465342 186
219 3300006881 Ga0068865_100017354 Ga0068865_1000173542 186
220 3300006881 Ga0068865_100167870 Ga0068865_1001678702 186
221 3300006881 Ga0068865_100168017 Ga0068865_1001680172 186
222 3300006881 Ga0068865_100410993 Ga0068865_1004109932 186
223 3300006881 Ga0068865_100644082 Ga0068865_1006440822 186
224 3300006931 Ga0097620_100000003 Ga0097620_100000003112 186
225 3300006931 Ga0097620_100041490 Ga0097620_1000414901 186
226 3300006931 Ga0097620_100194970 Ga0097620_1001949702 186
227 3300009093 Ga0105240_10005046 Ga0105240_1000504617 186
228 3300009093 Ga0105240_10010802 Ga0105240_100108024 186
229 3300009093 Ga0105240_10037254 Ga0105240_100372545 186
230 3300009093 Ga0105240_10074008 Ga0105240_100740084 186
231 3300009093 Ga0105240_10116116 Ga0105240_101161162 186
232 3300009098 Ga0105245_10265262 Ga0105245_102652622 186
233 3300009101 Ga0105247_10094094 Ga0105247_100940942 186
234 3300009101 Ga0105247_10120246 Ga0105247_101202462 186
235 3300009148 Ga0105243_10209203 Ga0105243_102092032 186
236 3300009174 Ga0105241_10000543 Ga0105241_1000054326 186
237 3300009174 Ga0105241_10005905 Ga0105241_100059054 186
238 3300009174 Ga0105241_10058013 Ga0105241_100580134 186
239 3300009174 Ga0105241_10162841 Ga0105241_101628412 186
240 3300009176 Ga0105242_10055664 Ga0105242_100556642 186
241 3300009176 Ga0105242_10178068 Ga0105242_101780682 186
242 3300009176 Ga0105242_10244250 Ga0105242_102442502 186
243 3300009176 Ga0105242_10696219 Ga0105242_106962192 186
244 3300009176 Ga0105242_10818356 Ga0105242_108183562 186
245 3300009177 Ga0105248_10025753 Ga0105248_100257534 186
246 3300009177 Ga0105248_10200253 Ga0105248_102002533 186
247 3300009545 Ga0105237_10000144 Ga0105237_1000014436 186
248 3300009545 Ga0105237_10001993 Ga0105237_100019939 186
249 3300009545 Ga0105237_10006883 Ga0105237_1000688311 186
250 3300009545 Ga0105237_10009632 Ga0105237_100096324 186
251 3300009545 Ga0105237_10028528 Ga0105237_100285282 186
252 3300009545 Ga0105237_10044226 Ga0105237_100442262 186
253 3300009545 Ga0105237_10194909 Ga0105237_101949092 186
254 3300009545 Ga0105237_10462293 Ga0105237_104622931 186
255 3300009545 Ga0105237_10545364 Ga0105237_105453641 186
256 3300009545 Ga0105237_10730935 Ga0105237_107309351 186
257 3300009545 Ga0105237_11271910 Ga0105237_112719101 186
258 3300009551 Ga0105238_10114132 Ga0105238_101141322 186
259 3300009551 Ga0105238_10319511 Ga0105238_103195113 186
260 3300009551 Ga0105238_10642642 Ga0105238_106426422 186
261 3300009551 Ga0105238_10860636 Ga0105238_108606362 186
262 3300009553 Ga0105249_10011114 Ga0105249_100111144 186
263 3300009553 Ga0105249_10058402 Ga0105249_100584023 186
264 3300009553 Ga0105249_10261905 Ga0105249_102619052 186
265 3300010375 Ga0105239_10000488 Ga0105239_1000048815 186
266 3300010375 Ga0105239_10000925 Ga0105239_1000092523 186
267 3300010375 Ga0105239_10024627 Ga0105239_100246274 186
268 3300010375 Ga0105239_10091051 Ga0105239_100910512 186
269 3300010375 Ga0105239_10099620 Ga0105239_100996204 186
270 3300010375 Ga0105239_10173973 Ga0105239_101739732 186
271 3300010375 Ga0105239_10427139 Ga0105239_104271392 186
272 3300010375 Ga0105239_10739892 Ga0105239_107398921 186
273 3300011119 Ga0105246_10006531 Ga0105246_100065312 186
274 3300011119 Ga0105246_10059895 Ga0105246_100598954 186
275 3300011119 Ga0105246_10696054 Ga0105246_106960542 186
276 3300013100 Ga0157373_10050446 Ga0157373_100504462 186
277 3300013100 Ga0157373_10136394 Ga0157373_101363942 186
278 3300013100 Ga0157373_10424115 Ga0157373_104241152 186
279 3300013100 Ga0157373_10538270 Ga0157373_105382702 186
280 3300013102 Ga0157371_10035183 Ga0157371_100351834 186
281 3300013102 Ga0157371_10102061 Ga0157371_101020612 186
282 3300013102 Ga0157371_10385346 Ga0157371_103853462 186
283 3300013102 Ga0157371_10430149 Ga0157371_104301492 186
284 3300013104 Ga0157370_10021933 Ga0157370_100219335 186
285 3300013104 Ga0157370_10023822 Ga0157370_100238224 186
286 3300013104 Ga0157370_10065454 Ga0157370_100654543 186
287 3300013104 Ga0157370_10166787 Ga0157370_101667873 186
288 3300013104 Ga0157370_10353171 Ga0157370_103531711 186
289 3300013104 Ga0157370_10389553 Ga0157370_103895532 186
290 3300013104 Ga0157370_10674300 Ga0157370_106743001 186
291 3300013105 Ga0157369_10015498 Ga0157369_100154988 186
292 3300013105 Ga0157369_10027496 Ga0157369_100274962 186
293 3300013105 Ga0157369_10115382 Ga0157369_101153823 186
294 3300013105 Ga0157369_10520744 Ga0157369_105207442 186
295 3300013296 Ga0157374_10000013 Ga0157374_10000013333 186
296 3300013296 Ga0157374_10017547 Ga0157374_100175473 186
297 3300013296 Ga0157374_10110213 Ga0157374_101102133 186
298 3300013296 Ga0157374_10145499 Ga0157374_101454992 186
299 3300013296 Ga0157374_10332914 Ga0157374_103329142 186
300 3300013297 Ga0157378_10034604 Ga0157378_100346042 186
301 3300013297 Ga0157378_10038252 Ga0157378_100382523 186
302 3300013297 Ga0157378_10150594 Ga0157378_101505942 186
303 3300013297 Ga0157378_12084047 Ga0157378_120840471 186
304 3300013306 Ga0163162_10000253 Ga0163162_1000025326 186
305 3300013306 Ga0163162_10001229 Ga0163162_100012294 186
306 3300013306 Ga0163162_10007984 Ga0163162_100079842 186
307 3300013306 Ga0163162_10009127 Ga0163162_100091275 186
308 3300013306 Ga0163162_10024760 Ga0163162_100247603 186
309 3300013306 Ga0163162_10314484 Ga0163162_103144842 186
310 3300013306 Ga0163162_11185762 Ga0163162_111857622 186
311 3300013307 Ga0157372_10004419 Ga0157372_1000441915 186
312 3300013307 Ga0157372_10004778 Ga0157372_1000477811 186
313 3300013307 Ga0157372_10029858 Ga0157372_100298583 186
314 3300013307 Ga0157372_10050322 Ga0157372_100503222 186
315 3300013307 Ga0157372_10055189 Ga0157372_100551894 186
316 3300013307 Ga0157372_10109539 Ga0157372_101095393 186
317 3300013307 Ga0157372_10286395 Ga0157372_102863952 186
318 3300013307 Ga0157372_10338726 Ga0157372_103387262 186
319 3300013307 Ga0157372_10371445 Ga0157372_103714452 186
320 3300013307 Ga0157372_10698759 Ga0157372_106987592 186
321 3300013307 Ga0157372_10771460 Ga0157372_107714602 186
322 3300013307 Ga0157372_10903328 Ga0157372_109033282 186
323 3300013307 Ga0157372_11125747 Ga0157372_111257472 186
324 3300013307 Ga0157372_11583697 Ga0157372_115836971 186
325 3300013308 Ga0157375_10000422 Ga0157375_1000042230 186
326 3300013308 Ga0157375_10031081 Ga0157375_100310813 186
327 3300013308 Ga0157375_10075044 Ga0157375_100750442 186
328 3300013308 Ga0157375_10218582 Ga0157375_102185821 186
329 3300013308 Ga0157375_10347506 Ga0157375_103475063 186
330 3300013308 Ga0157375_10348819 Ga0157375_103488192 186
331 3300014325 Ga0163163_10001496 Ga0163163_1000149615 186
332 3300014325 Ga0163163_10004119 Ga0163163_100041195 186
333 3300014325 Ga0163163_10028299 Ga0163163_100282992 186
334 3300014325 Ga0163163_10065372 Ga0163163_100653723 186
335 3300014325 Ga0163163_10310861 Ga0163163_103108611 186
336 3300014325 Ga0163163_10404031 Ga0163163_104040312 186
337 3300014325 Ga0163163_10803621 Ga0163163_108036212 186
338 3300014325 Ga0163163_10970266 Ga0163163_109702661 186
339 3300014325 Ga0163163_11168118 Ga0163163_111681181 186
340 3300014326 Ga0157380_10001771 Ga0157380_100017714 186
341 3300014326 Ga0157380_10011391 Ga0157380_100113916 186
342 3300014326 Ga0157380_10046227 Ga0157380_100462272 186
343 3300014326 Ga0157380_10629489 Ga0157380_106294892 186
344 3300014326 Ga0157380_11433910 Ga0157380_114339101 186
345 3300014745 Ga0157377_10010186 Ga0157377_100101862 186
346 3300014745 Ga0157377_10095251 Ga0157377_100952512 186
347 3300014745 Ga0157377_10438605 Ga0157377_104386052 186
348 3300014968 Ga0157379_10006012 Ga0157379_100060124 186
349 3300014968 Ga0157379_10013492 Ga0157379_100134926 186
350 3300014968 Ga0157379_10050043 Ga0157379_100500432 186
351 3300014968 Ga0157379_10080957 Ga0157379_100809572 186
352 3300014968 Ga0157379_10181170 Ga0157379_101811702 186
353 3300014969 Ga0157376_10001313 Ga0157376_1000131311 186
354 3300014969 Ga0157376_10018142 Ga0157376_100181422 186
355 3300014969 Ga0157376_10018439 Ga0157376_100184392 186
356 3300014969 Ga0157376_10033468 Ga0157376_100334684 186
357 3300014969 Ga0157376_10350619 Ga0157376_103506192 186
358 3300014969 Ga0157376_11362639 Ga0157376_113626391 186
359 3300017792 Ga0163161_10002701 Ga0163161_100027015 186
360 3300017792 Ga0163161_10036635 Ga0163161_100366354 186
361 3300017792 Ga0163161_10153052 Ga0163161_101530522 186
362 3300017792 Ga0163161_10288247 Ga0163161_102882472 186
363 3300017792 Ga0163161_10354781 Ga0163161_103547812 186
364 3300020069 Ga0197907_10511360 Ga0197907_105113602 186
365 3300020078 Ga0206352_11004656 Ga0206352_110046561 186
366 3300020080 Ga0206350_10162210 Ga0206350_101622101 186
367 3300025246 Ga0209646_1007831 Ga0209646_10078312 186
368 3300025315 Ga0207697_10032830 Ga0207697_100328303 186
369 3300025315 Ga0207697_10075258 Ga0207697_100752582 186
370 3300025321 Ga0207656_10047186 Ga0207656_100471861 186
371 3300025893 Ga0207682_10006837 Ga0207682_100068375 186
372 3300025893 Ga0207682_10063915 Ga0207682_100639152 186
373 3300025893 Ga0207682_10075863 Ga0207682_100758632 186
374 3300025893 Ga0207682_10152211 Ga0207682_101522111 186
375 3300025899 Ga0207642_10250461 Ga0207642_102504612 186
376 3300025900 Ga0207710_10054535 Ga0207710_100545352 186
377 3300025900 Ga0207710_10070967 Ga0207710_100709672 186
378 3300025901 Ga0207688_10034169 Ga0207688_100341691 186
379 3300025901 Ga0207688_10079716 Ga0207688_100797161 186
380 3300025903 Ga0207680_10000054 Ga0207680_1000005440 186
381 3300025903 Ga0207680_10099815 Ga0207680_100998152 186
382 3300025903 Ga0207680_10141780 Ga0207680_101417801 186
383 3300025903 Ga0207680_10248323 Ga0207680_102483231 186
384 3300025904 Ga0207647_10000064 Ga0207647_1000006421 186
385 3300025904 Ga0207647_10003263 Ga0207647_100032634 186
386 3300025904 Ga0207647_10008387 Ga0207647_100083873 186
387 3300025904 Ga0207647_10174890 Ga0207647_101748902 186
388 3300025907 Ga0207645_10000352 Ga0207645_1000035226 186
389 3300025907 Ga0207645_10112575 Ga0207645_101125751 186
390 3300025908 Ga0207643_10027738 Ga0207643_100277382 186
391 3300025908 Ga0207643_10113336 Ga0207643_101133362 186
392 3300025909 Ga0207705_10065461 Ga0207705_100654612 186
393 3300025911 Ga0207654_10001121 Ga0207654_100011215 186
394 3300025911 Ga0207654_10003601 Ga0207654_1000360111 186
395 3300025911 Ga0207654_10232166 Ga0207654_102321662 186
396 3300025911 Ga0207654_10348665 Ga0207654_103486651 186
397 3300025912 Ga0207707_10088343 Ga0207707_100883432 186
398 3300025912 Ga0207707_10181623 Ga0207707_101816231 186
399 3300025913 Ga0207695_10000056 Ga0207695_10000056330 186
400 3300025913 Ga0207695_10001122 Ga0207695_1000112216 186
401 3300025913 Ga0207695_10001317 Ga0207695_1000131734 186
402 3300025913 Ga0207695_10001383 Ga0207695_100013838 186
403 3300025913 Ga0207695_10015819 Ga0207695_100158194 186
404 3300025913 Ga0207695_10054760 Ga0207695_100547604 186
405 3300025913 Ga0207695_10071354 Ga0207695_100713542 186
406 3300025913 Ga0207695_10079185 Ga0207695_100791852 186
407 3300025914 Ga0207671_10001689 Ga0207671_1000168917 186
408 3300025914 Ga0207671_10002585 Ga0207671_1000258513 186
409 3300025914 Ga0207671_10003111 Ga0207671_100031114 186
410 3300025914 Ga0207671_10012969 Ga0207671_100129692 186
411 3300025914 Ga0207671_10016185 Ga0207671_100161854 186
412 3300025914 Ga0207671_10044863 Ga0207671_100448632 186
413 3300025914 Ga0207671_10061597 Ga0207671_100615972 186
414 3300025914 Ga0207671_10429961 Ga0207671_104299612 186
415 3300025917 Ga0207660_10096729 Ga0207660_100967292 186
416 3300025918 Ga0207662_10070492 Ga0207662_100704921 186
417 3300025919 Ga0207657_10033042 Ga0207657_100330424 186
418 3300025919 Ga0207657_10198499 Ga0207657_101984992 186
419 3300025919 Ga0207657_10378679 Ga0207657_103786792 186
420 3300025920 Ga0207649_10095654 Ga0207649_100956542 186
421 3300025920 Ga0207649_10172496 Ga0207649_101724961 186
422 3300025920 Ga0207649_10651184 Ga0207649_106511841 186
423 3300025921 Ga0207652_10226420 Ga0207652_102264202 186
424 3300025921 Ga0207652_10680372 Ga0207652_106803722 186
425 3300025923 Ga0207681_10077005 Ga0207681_100770052 186
426 3300025923 Ga0207681_10536743 Ga0207681_105367432 186
427 3300025924 Ga0207694_10060486 Ga0207694_100604862 186
428 3300025924 Ga0207694_10119359 Ga0207694_101193592 186
429 3300025924 Ga0207694_11052315 Ga0207694_110523151 186
430 3300025925 Ga0207650_10018897 Ga0207650_100188972 186
431 3300025925 Ga0207650_10067533 Ga0207650_100675332 186
432 3300025925 Ga0207650_10204764 Ga0207650_102047642 186
433 3300025925 Ga0207650_10276199 Ga0207650_102761993 186
434 3300025925 Ga0207650_10579361 Ga0207650_105793611 186
435 3300025926 Ga0207659_10013556 Ga0207659_100135564 186
436 3300025926 Ga0207659_10184807 Ga0207659_101848072 186
437 3300025926 Ga0207659_10332966 Ga0207659_103329662 186
438 3300025926 Ga0207659_11346805 Ga0207659_113468051 186
439 3300025927 Ga0207687_10315357 Ga0207687_103153572 186
440 3300025931 Ga0207644_10049783 Ga0207644_100497833 186
441 3300025931 Ga0207644_10085796 Ga0207644_100857962 186
442 3300025931 Ga0207644_10193366 Ga0207644_101933662 186
443 3300025931 Ga0207644_10194340 Ga0207644_101943402 186
444 3300025931 Ga0207644_10282153 Ga0207644_102821532 186
445 3300025932 Ga0207690_10015227 Ga0207690_100152276 186
446 3300025932 Ga0207690_10141315 Ga0207690_101413152 186
447 3300025932 Ga0207690_10159314 Ga0207690_101593142 186
448 3300025933 Ga0207706_10617107 Ga0207706_106171071 186
449 3300025934 Ga0207686_10079447 Ga0207686_100794472 186
450 3300025934 Ga0207686_10178649 Ga0207686_101786493 186
451 3300025934 Ga0207686_10704682 Ga0207686_107046821 186
452 3300025936 Ga0207670_10035867 Ga0207670_100358673 186
453 3300025937 Ga0207669_10185902 Ga0207669_101859022 186
454 3300025937 Ga0207669_10225503 Ga0207669_102255032 186
455 3300025937 Ga0207669_10460782 Ga0207669_104607822 186
456 3300025938 Ga0207704_10036624 Ga0207704_100366242 186
457 3300025938 Ga0207704_10056617 Ga0207704_100566172 186
458 3300025940 Ga0207691_10005099 Ga0207691_100050996 186
459 3300025940 Ga0207691_10017616 Ga0207691_100176164 186
460 3300025940 Ga0207691_10024317 Ga0207691_100243174 186
461 3300025940 Ga0207691_10171699 Ga0207691_101716992 186
462 3300025940 Ga0207691_10529598 Ga0207691_105295982 186
463 3300025940 Ga0207691_10561829 Ga0207691_105618292 186
464 3300025940 Ga0207691_10814508 Ga0207691_108145081 186
465 3300025942 Ga0207689_10000337 Ga0207689_1000033711 186
466 3300025942 Ga0207689_10003324 Ga0207689_100033242 186
467 3300025942 Ga0207689_10059536 Ga0207689_100595362 186
468 3300025944 Ga0207661_10083293 Ga0207661_100832932 186
469 3300025944 Ga0207661_10305716 Ga0207661_103057162 186
470 3300025945 Ga0207679_10170845 Ga0207679_101708452 186
471 3300025949 Ga0207667_10004402 Ga0207667_1000440212 186
472 3300025949 Ga0207667_10010335 Ga0207667_100103355 186
473 3300025949 Ga0207667_10206295 Ga0207667_102062952 186
474 3300025949 Ga0207667_10227636 Ga0207667_102276362 186
475 3300025960 Ga0207651_10009029 Ga0207651_100090296 186
476 3300025960 Ga0207651_10052009 Ga0207651_100520093 186
477 3300025960 Ga0207651_10071439 Ga0207651_100714392 186
478 3300025960 Ga0207651_10209932 Ga0207651_102099322 186
479 3300025961 Ga0207712_10005606 Ga0207712_100056065 186
480 3300025961 Ga0207712_10078718 Ga0207712_100787183 186
481 3300025972 Ga0207668_10466938 Ga0207668_104669382 186
482 3300025972 Ga0207668_10538802 Ga0207668_105388021 186
483 3300025981 Ga0207640_10030773 Ga0207640_100307732 186
484 3300025981 Ga0207640_10043608 Ga0207640_100436082 186
485 3300025981 Ga0207640_10064775 Ga0207640_100647752 186
486 3300025981 Ga0207640_10846660 Ga0207640_108466601 186
487 3300025986 Ga0207658_10016928 Ga0207658_100169282 186
488 3300025986 Ga0207658_10085598 Ga0207658_100855981 186
489 3300025986 Ga0207658_10120149 Ga0207658_101201492 186
490 3300025986 Ga0207658_10182831 Ga0207658_101828312 186
491 3300025986 Ga0207658_10756524 Ga0207658_107565242 186
492 3300026023 Ga0207677_10001184 Ga0207677_100011849 186
493 3300026023 Ga0207677_10020347 Ga0207677_100203472 186
494 3300026023 Ga0207677_10047442 Ga0207677_100474421 186
495 3300026023 Ga0207677_10147398 Ga0207677_101473982 186
496 3300026035 Ga0207703_10018354 Ga0207703_100183541 186
497 3300026041 Ga0207639_10003376 Ga0207639_1000337610 186
498 3300026041 Ga0207639_10005516 Ga0207639_100055162 186
499 3300026041 Ga0207639_10012234 Ga0207639_100122346 186
500 3300026041 Ga0207639_10047321 Ga0207639_100473212 186
501 3300026041 Ga0207639_10049107 Ga0207639_100491072 186
502 3300026041 Ga0207639_10092994 Ga0207639_100929942 186
503 3300026041 Ga0207639_10145648 Ga0207639_101456483 186
504 3300026041 Ga0207639_10194828 Ga0207639_101948282 186
505 3300026041 Ga0207639_10549310 Ga0207639_105493102 186
506 3300026041 Ga0207639_10565444 Ga0207639_105654442 186
507 3300026067 Ga0207678_10163164 Ga0207678_101631642 186
508 3300026067 Ga0207678_10163319 Ga0207678_101633192 186
509 3300026067 Ga0207678_10189342 Ga0207678_101893422 186
510 3300026067 Ga0207678_10853090 Ga0207678_108530901 186
511 3300026078 Ga0207702_10020706 Ga0207702_100207067 186
512 3300026078 Ga0207702_10028278 Ga0207702_100282783 186
513 3300026078 Ga0207702_10920178 Ga0207702_109201781 186
514 3300026088 Ga0207641_10000026 Ga0207641_1000002699 186
515 3300026089 Ga0207648_10001428 Ga0207648_100014289 186
516 3300026089 Ga0207648_10087264 Ga0207648_100872643 186
517 3300026089 Ga0207648_10209801 Ga0207648_102098012 186
518 3300026089 Ga0207648_10304236 Ga0207648_103042361 186
519 3300026089 Ga0207648_10418865 Ga0207648_104188652 186
520 3300026095 Ga0207676_10023052 Ga0207676_100230521 186
521 3300026095 Ga0207676_10123693 Ga0207676_101236932 186
522 3300026095 Ga0207676_10171220 Ga0207676_101712202 186
523 3300026095 Ga0207676_10409887 Ga0207676_104098872 186
524 3300026095 Ga0207676_10507695 Ga0207676_105076952 186
525 3300026095 Ga0207676_10586145 Ga0207676_105861452 186
526 3300026116 Ga0207674_10012728 Ga0207674_100127285 186
527 3300026116 Ga0207674_10036451 Ga0207674_100364512 186
528 3300026116 Ga0207674_10107502 Ga0207674_101075022 186
529 3300026118 Ga0207675_100039383 Ga0207675_1000393832 186
530 3300026118 Ga0207675_100446592 Ga0207675_1004465922 186
531 3300026118 Ga0207675_101092334 Ga0207675_1010923342 186
532 3300026121 Ga0207683_10001458 Ga0207683_100014582 186
533 3300026121 Ga0207683_10065455 Ga0207683_100654552 186
534 3300026121 Ga0207683_10172343 Ga0207683_101723432 186
535 3300026121 Ga0207683_10183521 Ga0207683_101835211 186
536 3300026121 Ga0207683_10211141 Ga0207683_102111411 186
537 3300026142 Ga0207698_10004047 Ga0207698_100040472 186
538 3300026142 Ga0207698_10016155 Ga0207698_100161553 186
539 3300026142 Ga0207698_10023910 Ga0207698_100239105 186
540 3300026142 Ga0207698_10038711 Ga0207698_100387112 186
541 3300026142 Ga0207698_10073503 Ga0207698_100735032 186
542 3300027424 Ga0209984_1011145 Ga0209984_10111452 186
543 3300027471 Ga0209995_1014031 Ga0209995_10140312 186
544 3300027876 Ga0209974_10049027 Ga0209974_100490272 186
545 3300028379 Ga0268266_10000169 Ga0268266_10000169102 186
546 3300028379 Ga0268266_10101400 Ga0268266_101014002 186
547 3300028381 Ga0268264_10000063 Ga0268264_10000063191 186
548 3300028381 Ga0268264_10001200 Ga0268264_1000120010 186
549 3300028381 Ga0268264_10004205 Ga0268264_100042059 186
550 3300028381 Ga0268264_10006017 Ga0268264_100060177 186
551 3300028381 Ga0268264_10041768 Ga0268264_100417682 186
552 3300028381 Ga0268264_10079293 Ga0268264_100792932 186
553 3300028381 Ga0268264_10290277 Ga0268264_102902772 186
554 3300028381 Ga0268264_10375142 Ga0268264_103751422 186
555 3300028786 Ga0307517_10139002 Ga0307517_101390022 186
556 3300028794 Ga0307515_10001389 Ga0307515_1000138933 186
557 3300030521 Ga0307511_10000409 Ga0307511_100004094 186
558 3300031251 Ga0265327_10006319 Ga0265327_100063192 186
559 3300031456 Ga0307513_10085521 Ga0307513_100855212 186
560 3300031456 Ga0307513_10475437 Ga0307513_104754371 186
561 3300031507 Ga0307509_10131040 Ga0307509_101310402 186
562 3300031507 Ga0307509_10411529 Ga0307509_104115291 186
563 3300031616 Ga0307508_10000485 Ga0307508_1000048528 186
564 3300031616 Ga0307508_10318065 Ga0307508_103180652 186
565 3300031730 Ga0307516_10003090 Ga0307516_100030908 186
566 3300031730 Ga0307516_10093156 Ga0307516_100931563 186
567 3300031730 Ga0307516_10199285 Ga0307516_101992852 186
568 3300031852 Ga0307410_10435550 Ga0307410_104355502 186
569 3300031901 Ga0307406_10112818 Ga0307406_101128182 186
570 3300032002 Ga0307416_100110558 Ga0307416_1001105583 186
571 3300032004 Ga0307414_10374611 Ga0307414_103746112 186
572 3300032004 Ga0307414_10664091 Ga0307414_106640912 186
573 3300032005 Ga0307411_10204649 Ga0307411_102046492 186
574 3300032005 Ga0307411_10687572 Ga0307411_106875721 186
575 3300032126 Ga0307415_100093430 Ga0307415_1000934302 186
576 3300032126 Ga0307415_100571597 Ga0307415_1005715972 186
577 3300032126 Ga0307415_100763073 Ga0307415_1007630731 186
578 3300033180 Ga0307510_10000156 Ga0307510_1000015634 186
579 3300035114 Ga0373939_0241877 Ga0373939_0241877_49_612 186
580 3300035695 Ga0373927_0143992 Ga0373927_0143992_289_852 186
581 3300037068 Ga0373925_0301651 Ga0373925_0301651_53_616 186
582 3300037418 Ga0395900_0040184 Ga0395900_0040184_4049_4609 186
583 3300037466 Ga0395898_0320103 Ga0395898_0320103_10_570 186
584 3300038443 Ga0395901_0111267 Ga0395901_0111267_2203_2763 186
585 3300041404 Ga0439436_0038066 Ga0439436_0038066_676_1239 186
586 3300041406 Ga0439439_0126279 Ga0439439_0126279_135_695 186
587 3300041445 Ga0451792_09039 Ga0451792_09039_11_574 186
588 3300041451 Ga0451791_0594761 Ga0451791_0594761_256_819 186
589 3300041459 Ga0451800_1224414 Ga0451800_1224414_449_1012 186
590 3300041461 Ga0451805_092861 Ga0451805_092861_13_576 186
591 3300041491 Ga0451833_0563121 Ga0451833_0563121_312_875 186
592 3300041498 Ga0451841_0486093 Ga0451841_0486093_389_952 186
593 3300041505 Ga0451849_0231858 Ga0451849_0231858_732_1298 186
594 3300041505 Ga0451849_0981161 Ga0451849_0981161_371_934 186
595 3300041506 Ga0451850_60345 Ga0451850_60345_23_586 186
596 3300041512 Ga0451853_3832616 Ga0451853_3832616_57_620 186
597 3300041999 Ga0439433_0016269 Ga0439433_0016269_971_1531 186
598 3300042004 Ga0439445_0045264 Ga0439445_0045264_338_901 186
599 3300042005 Ga0439448_0149498 Ga0439448_0149498_189_752 186
600 3300042007 Ga0439449_0051924 Ga0439449_0051924_527_1087 186
601 3300042007 Ga0439449_0146400 Ga0439449_0146400_35_598 186
602 3300042014 Ga0439457_000945 Ga0439457_000945_2836_3399 186
603 3300042876 Ga0451577_0001932 Ga0451577_0001932_23822_24382 186
604 3300042876 Ga0451577_0106051 Ga0451577_0106051_37_600 186
605 3300044656 Ga0466969_0168597 Ga0466969_0168597_15_578 186
606 3300044658 Ga0466972_0001713 Ga0466972_0001713_1471_2034 186
607 3300044658 Ga0466972_0019149 Ga0466972_0019149_2753_3316 186
608 3300044658 Ga0466972_0049494 Ga0466972_0049494_1142_1705 186
609 3300044658 Ga0466972_0242982 Ga0466972_0242982_40_600 186
610 3300044673 Ga0453683_0245289 Ga0453683_0245289_492_1052 186
611 3300044673 Ga0453683_0337265 Ga0453683_0337265_381_944 186
612 3300044683 Ga0466965_0096230 Ga0466965_0096230_577_1140 186
613 3300044693 Ga0466961_0053887 Ga0466961_0053887_1760_2323 186
614 3300044712 Ga0453684_0023709 Ga0453684_0023709_3343_3903 186
615 3300044712 Ga0453684_0024719 Ga0453684_0024719_5090_5650 186
616 3300044712 Ga0453684_0226048 Ga0453684_0226048_831_1391 186
617 3300044712 Ga0453684_0923574 Ga0453684_0923574_12_575 186
618 3300044719 Ga0466971_0065433 Ga0466971_0065433_240_803 186
619 3300044735 Ga0466968_0024154 Ga0466968_0024154_1656_2219 186
620 3300044735 Ga0466968_0053392 Ga0466968_0053392_861_1424 186
621 3300044765 Ga0466970_0074443 Ga0466970_0074443_828_1391 186
622 3300044765 Ga0466970_0116658 Ga0466970_0116658_800_1363 186
623 3300044842 Ga0466957_0001412 Ga0466957_0001412_2906_3469 186
624 3300044842 Ga0466957_0072732 Ga0466957_0072732_1541_2104 186
625 3300045049 Ga0466959_0054555 Ga0466959_0054555_393_956 186
626 3300045051 Ga0451576_0313597 Ga0451576_0313597_416_976 186
627 3300045836 Ga0466958_0165347 Ga0466958_0165347_385_948 186
628 3300046460 Ga0495638_0042798 Ga0495638_0042798_1320_1883 186
629 3300046460 Ga0495638_0118921 Ga0495638_0118921_677_1240 186
630 3300046507 Ga0495606_0008396 Ga0495606_0008396_6770_7333 186
631 3300046517 Ga0495630_0970953 Ga0495630_0970953_50_610 186
632 3300046524 Ga0495648_0005427 Ga0495648_0005427_9481_10044 186
633 3300046648 Ga0495611_0000061 Ga0495611_0000061_37477_38040 186
634 3300046663 Ga0495635_0130120 Ga0495635_0130120_1068_1628 186
635 3300047320 Ga0495672_0016954 Ga0495672_0016954_680_1240 186
636 3300047320 Ga0495672_0092833 Ga0495672_0092833_76_639 186
637 3300047320 Ga0495672_0131956 Ga0495672_0131956_687_1247 186
638 3300047443 Ga0495687_001475 Ga0495687_001475_20092_20655 186
639 3300047472 Ga0495686_0000010 Ga0495686_0000010_485701_486264 186
640 3300048903 Ga0496100_0188765 Ga0496100_0188765_509_1072 186
641 3300048905 Ga0496102_0941024 Ga0496102_0941024_125_688 186
642 3300048907 Ga0496104_0544376 Ga0496104_0544376_202_762 186
643 3300048909 Ga0496106_0446598 Ga0496106_0446598_209_772 186
644 3300048917 Ga0496114_0126267 Ga0496114_0126267_868_1431 186
645 3300048918 Ga0496115_0182577 Ga0496115_0182577_234_797 186
646 3300049128 Ga0501308_043395 Ga0501308_043395_60_623 186
647 3300049128 Ga0501308_054016 Ga0501308_054016_10_573 186
648 3300049160 Ga0501304_024782 Ga0501304_024782_21_584 186
649 3300049161 Ga0501305_075692 Ga0501305_075692_15_578 186
650 3300049533 Ga0501317_045829 Ga0501317_045829_89_652 186
651 3300049543 Ga0501327_08393 Ga0501327_08393_73_636 186
652 3300049551 Ga0501335_008372 Ga0501335_008372_384_944 186
653 3300049570 Ga0501033_0201368 Ga0501033_0201368_539_1102 186
654 3300049571 Ga0501034_0000007 Ga0501034_0000007_343596_344159 186
655 3300049571 Ga0501034_0009847 Ga0501034_0009847_5474_6037 186
656 3300049571 Ga0501034_0211523 Ga0501034_0211523_244_807 186
657 3300049572 Ga0501036_0282605 Ga0501036_0282605_237_800 186
658 3300049572 Ga0501036_0957360 Ga0501036_0957360_13_576 186
659 3300049573 Ga0501037_0089565 Ga0501037_0089565_379_942 186
660 3300049574 Ga0501038_0004606 Ga0501038_0004606_604_1167 186
661 3300049575 Ga0501039_0022527 Ga0501039_0022527_2521_3084 186
662 3300049579 Ga0501043_0013799 Ga0501043_0013799_5045_5608 186
663 3300049579 Ga0501043_0024672 Ga0501043_0024672_3927_4487 186
664 3300049579 Ga0501043_0033225 Ga0501043_0033225_1128_1691 186
665 3300049580 Ga0501046_0156098 Ga0501046_0156098_27_590 186
666 3300049580 Ga0501046_0210364 Ga0501046_0210364_430_993 186
667 3300049581 Ga0501047_0058438 Ga0501047_0058438_2637_3200 186
668 3300049581 Ga0501047_0535195 Ga0501047_0535195_17_580 186
669 3300049581 Ga0501047_0620678 Ga0501047_0620678_202_765 186
670 3300049581 Ga0501047_0695658 Ga0501047_0695658_106_666 186
671 3300049651 Ga0501201_008448 Ga0501201_008448_155_715 186
672 3300049652 Ga0501202_014928 Ga0501202_014928_595_1164 186
673 3300049665 Ga0501227_103046 Ga0501227_103046_88_657 186
674 3300049668 Ga0501233_069478 Ga0501233_069478_132_692 186
675 3300049673 Ga0501240_026182 Ga0501240_026182_136_705 186
676 3300049675 Ga0501243_001398 Ga0501243_001398_2620_3189 186
677 3300049682 Ga0501252_007922 Ga0501252_007922_187_756 186
678 3300049686 Ga0501257_063921 Ga0501257_063921_138_698 186
679 3300049686 Ga0501257_071849 Ga0501257_071849_227_790 186
680 3300049686 Ga0501257_101105 Ga0501257_101105_131_700 186
681 3300049688 Ga0501259_009713 Ga0501259_009713_362_931 186
682 3300049690 Ga0501261_030697 Ga0501261_030697_217_780 186
683 3300049704 Ga0501221_017241 Ga0501221_017241_574_1143 186
684 3300049705 Ga0501225_0001947 Ga0501225_0001947_5746_6309 186
685 3300049708 Ga0501245_022368 Ga0501245_022368_176_745 186
686 3300049744 Ga0501083_0411517 Ga0501083_0411517_46_609 186
687 3300049744 Ga0501083_0614166 Ga0501083_0614166_97_657 186
688 3300049763 Ga0501266_002322 Ga0501266_002322_622_1191 186
689 3300049767 Ga0501270_045225 Ga0501270_045225_159_728 186
690 3300049823 Ga0501044_0060496 Ga0501044_0060496_3105_3668 186
691 3300049823 Ga0501044_0158560 Ga0501044_0158560_875_1438 186
692 3300049823 Ga0501044_0357018 Ga0501044_0357018_731_1300 186
693 3300050005 Ga0501284_00001 Ga0501284_00001_76570_77136 186
694 3300053086 Ga0500578_0001290 Ga0500578_0001290_273_836 186
695 3300053090 Ga0500646_0003313 Ga0500646_0003313_1444_2007 186
696 3300053090 Ga0500646_0253714 Ga0500646_0253714_43_606 186
697 3300053091 Ga0500647_0273419 Ga0500647_0273419_37_600 186
698 3300053092 Ga0500583_0000019 Ga0500583_0000019_38643_39206 186
699 3300053092 Ga0500583_0013004 Ga0500583_0013004_1655_2218 186
700 3300053092 Ga0500583_0031093 Ga0500583_0031093_65_628 186
701 3300053093 Ga0500651_0449276 Ga0500651_0449276_69_632 186
702 3300053102 Ga0500554_126087 Ga0500554_126087_236_799 186
703 3300053103 Ga0500555_061837 Ga0500555_061837_315_878 186
704 3300053109 Ga0500569_150637 Ga0500569_150637_176_739 186
705 3300053133 Ga0500655_062479 Ga0500655_062479_92_655 186
706 3300053134 Ga0500658_0238651 Ga0500658_0238651_32_595 186
707 3300053136 Ga0500559_0063794 Ga0500559_0063794_724_1284 186
708 3300053139 Ga0500568_0043964 Ga0500568_0043964_71_634 186
709 3300053140 Ga0500573_0131318 Ga0500573_0131318_93_656 186
710 3300053146 Ga0500588_0001676 Ga0500588_0001676_738_1304 186
711 3300053146 Ga0500588_0025075 Ga0500588_0025075_732_1295 186
712 3300053147 Ga0500589_168170 Ga0500589_168170_44_607 186
713 3300053148 Ga0500590_251484 Ga0500590_251484_31_594 186
714 3300053151 Ga0500604_0012513 Ga0500604_0012513_940_1500 186
715 3300053151 Ga0500604_0019789 Ga0500604_0019789_1054_1617 186
716 3300053153 Ga0500616_0167768 Ga0500616_0167768_113_676 186
717 3300053153 Ga0500616_0320113 Ga0500616_0320113_19_582 186
718 3300053154 Ga0500619_064314 Ga0500619_064314_207_770 186
719 3300053177 Ga0500636_0251058 Ga0500636_0251058_276_839 186
720 3300053727 Ga0500611_008861 Ga0500611_008861_599_1162 186
721 3300055283 Ga0500661_048378 Ga0500661_048378_179_742 186
722 3300059492 Ga0587073_0154144 Ga0587073_0154144_16_579 186
723 3300059493 Ga0587077_126219 Ga0587077_126219_68_631 186
724 3300059622 Ga0587099_024505 Ga0587099_024505_18_581 186
725 3300059624 Ga0587109_053307 Ga0587109_053307_249_812 186
726 3300059630 Ga0587128_026935 Ga0587128_026935_66_629 186
727 3300059631 Ga0587130_023913 Ga0587130_023913_91_654 186
728 3300059639 Ga0587062_042940 Ga0587062_042940_156_719 186
729 3300059640 Ga0587067_043997 Ga0587067_043997_119_682 186
730 3300059641 Ga0587068_073042 Ga0587068_073042_39_602 186
731 3300060246 Ga0587081_07056 Ga0587081_07056_62_625 186
732 3300060346 Ga0587111_0077246 Ga0587111_0077246_69_632 186
733 3300061719 Ga0466962_0001581 Ga0466962_0001581_9572_10135 186
734 3300061719 Ga0466962_0397283 Ga0466962_0397283_36_599 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07463

NUMOD4

NUMOD4 motif

51

104

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nvs-assembly1.cif.gz_A crystal structure of the q18cp6_clod6 protein from glyoxalase family. northeast structural genomics consortium target cfr3 0.748 144 179
1hlv-assembly1.cif.gz_A crystal structure of cenp-b(1-129) complexed with the cenp-b box dna 0.7353 135 181
8d9l-assembly1.cif.gz_B cryoem structure of human mettl1-wdr4 in complex with lys-trna and sam 0.7237 23 46
2a6c-assembly1.cif.gz_A crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution 0.7214 141 182
7cv2-assembly1.cif.gz_A crystal structure of b. halodurans niar in niacin-bound form 0.704 141 179
ID Description Score Start End Superfamily
af_I1L164_121_266_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8187 139 179 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.7947 144 180 1.10.10.10
af_Q55BX2_260_507_1.50.10.20 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7814 158 183 1.50.10.20
5iydM02 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.7572 150 179 1.10.472.10
1u3eM01 Alpha Beta;Alpha-Beta Complex;Homing Intron 3 (I-Ppo) Encoded Endonuclease; Chain A; 0.7402 9 123 3.90.75.20
ID Description Score Start End GO Terms
AF-A0A522E5Y1-F1-model_v4 NUMOD4 domain-containing protein 0.9421 1 70 GO:0016788
AF-A0A522E5Y1-F1-model_v4 NUMOD4 domain-containing protein 0.9293 1 70 GO:0016788
AF-A0A0F9FC16-F1-model_v4 HNH nuclease domain-containing protein 0.8856 25 118
AF-A0A6P0ZHP4-F1-model_v4 deleted 0.8811 48 116
AF-A0A3C1E2S7-F1-model_v4 deleted 0.8732 42 116

Feature Viewer

pLDDT pTM Quality
89.88 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map