F478133
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 329 | 734 | 327 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10007560|Ga0075365_100075603 |
| Length | 341 |
| Sequence | MPNLPKPRLRRAGRARQLVAPAPEPQRKPNVETITAEGLRWVNIERPSPLEAAWLEEQFGFHALDLEDVMSRNQRPKIDEYPEYLFIVLHFPVFDRSVGRLNAGELDMFVGPDYLVTIPNQPLQPVAYLFERCRQKEELREQLFSKGSGFLLYRIIDDAFDYCFPMLRKIGNKLDALEEDIFSGRSEEVVRDIFNVKQEIINFRKISRPQRPVLRDLERTKHRYLVASEGEDLEIYFDDIVDAHERIWDMLENYKEVVEALEETNESVISHRVNDILRVLTSISVIVLPLTLIASIFGMNAGLPGGGDPASASLTTFAIVVGVMFALLVGMVAYFRHRDWL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 186 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 190 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 265 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 268 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 269 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 324 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.45 |
| Nodule | 0 |
| Rhizoplane | 9.13 |
| Rhizosphere | 86.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1005351 | 3300000546 | Bacteria | 1403 |
| 2 | JGI24746J21847_1000760 | 3300001977 | Bacteria | 4956 |
| 3 | JGI24740J21852_10010068 | 3300001979 | Bacteria | 3662 |
| 4 | JGI24748J21848_1000727 | 3300002074 | Bacteria | 3562 |
| 5 | JGI24034J26672_10001507 | 3300002239 | Bacteria | 3096 |
| 6 | JGI24742J22300_10001453 | 3300002244 | Bacteria | 3736 |
| 7 | rootH1_10002124 | 3300003323 | Bacteria | 3554 |
| 8 | JGI25407J50210_10002254 | 3300003373 | Bacteria | 4519 |
| 9 | JGI25407J50210_10007507 | 3300003373 | Bacteria | 2732 |
| 10 | JGI25407J50210_10019542 | 3300003373 | Bacteria | 1761 |
| 11 | Ga0070658_10159858 | 3300005327 | Bacteria | 1890 |
| 12 | Ga0070658_10270672 | 3300005327 | Bacteria | 1445 |
| 13 | Ga0070683_100000404 | 3300005329 | Bacteria | 29752 |
| 14 | Ga0070683_100023077 | 3300005329 | Bacteria | 5564 |
| 15 | Ga0070670_100073330 | 3300005331 | Bacteria | 2940 |
| 16 | Ga0070677_10000008 | 3300005333 | Bacteria | 74027 |
| 17 | Ga0070666_10005854 | 3300005335 | Bacteria | 7552 |
| 18 | Ga0070680_100003235 | 3300005336 | Bacteria | 12123 |
| 19 | Ga0070682_100245968 | 3300005337 | Bacteria | 1286 |
| 20 | Ga0068868_100000141 | 3300005338 | Bacteria | 46406 |
| 21 | Ga0068868_100002016 | 3300005338 | Bacteria | 13976 |
| 22 | Ga0068868_100021155 | 3300005338 | Bacteria | 4898 |
| 23 | Ga0070660_100003750 | 3300005339 | Bacteria | 10505 |
| 24 | Ga0070660_100144134 | 3300005339 | Bacteria | 1913 |
| 25 | Ga0070691_10000044 | 3300005341 | Bacteria | 36029 |
| 26 | Ga0070691_10000524 | 3300005341 | Bacteria | 14453 |
| 27 | Ga0070661_100000099 | 3300005344 | Bacteria | 71115 |
| 28 | Ga0070668_100012531 | 3300005347 | Bacteria | 6315 |
| 29 | Ga0070668_100014733 | 3300005347 | Bacteria | 5843 |
| 30 | Ga0070668_100035872 | 3300005347 | Bacteria | 3784 |
| 31 | Ga0070669_100145838 | 3300005353 | Bacteria | 1829 |
| 32 | Ga0070675_100000036 | 3300005354 | Bacteria | 85959 |
| 33 | Ga0070674_100000012 | 3300005356 | Bacteria | 130773 |
| 34 | Ga0070674_100124738 | 3300005356 | Bacteria | 1911 |
| 35 | Ga0070673_100006402 | 3300005364 | Bacteria | 7653 |
| 36 | Ga0070688_100000071 | 3300005365 | Bacteria | 50564 |
| 37 | Ga0070659_100004223 | 3300005366 | Bacteria | 10260 |
| 38 | Ga0070659_100057747 | 3300005366 | Bacteria | 3061 |
| 39 | Ga0070667_100000603 | 3300005367 | Bacteria | 35115 |
| 40 | Ga0070711_100008252 | 3300005439 | Bacteria | 6371 |
| 41 | Ga0070705_100122056 | 3300005440 | Bacteria | 1684 |
| 42 | Ga0070700_100005895 | 3300005441 | Bacteria | 6511 |
| 43 | Ga0070700_100063907 | 3300005441 | Bacteria | 2329 |
| 44 | Ga0070700_100283756 | 3300005441 | Bacteria | 1202 |
| 45 | Ga0070663_100001716 | 3300005455 | Bacteria | 12160 |
| 46 | Ga0070663_100022099 | 3300005455 | Bacteria | 4246 |
| 47 | Ga0070663_100084612 | 3300005455 | Bacteria | 2338 |
| 48 | Ga0070678_100061536 | 3300005456 | Bacteria | 2768 |
| 49 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 50 | Ga0070681_10013391 | 3300005458 | Bacteria | 8148 |
| 51 | Ga0070681_10084184 | 3300005458 | Bacteria | 3133 |
| 52 | Ga0068867_100005480 | 3300005459 | Bacteria | 8981 |
| 53 | Ga0070685_10000020 | 3300005466 | Bacteria | 104332 |
| 54 | Ga0070685_10000674 | 3300005466 | Bacteria | 18541 |
| 55 | Ga0070685_10035279 | 3300005466 | Bacteria | 2821 |
| 56 | Ga0070679_100005826 | 3300005530 | Bacteria | 11429 |
| 57 | Ga0070679_100021006 | 3300005530 | Bacteria | 6371 |
| 58 | Ga0070679_100023402 | 3300005530 | Bacteria | 6046 |
| 59 | Ga0070684_100042488 | 3300005535 | Bacteria | 3924 |
| 60 | Ga0070684_100043406 | 3300005535 | Bacteria | 3882 |
| 61 | Ga0070684_100052595 | 3300005535 | Bacteria | 3542 |
| 62 | Ga0070684_100143253 | 3300005535 | Bacteria | 2162 |
| 63 | Ga0068853_100083524 | 3300005539 | Bacteria | 2798 |
| 64 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 65 | Ga0070672_100059780 | 3300005543 | Bacteria | 2999 |
| 66 | Ga0070693_100003731 | 3300005547 | Bacteria | 7127 |
| 67 | Ga0070693_100167441 | 3300005547 | Bacteria | 1405 |
| 68 | Ga0070665_100000135 | 3300005548 | Bacteria | 138925 |
| 69 | Ga0070665_100005405 | 3300005548 | Bacteria | 13178 |
| 70 | Ga0070665_100081770 | 3300005548 | Bacteria | 3235 |
| 71 | Ga0070704_100062477 | 3300005549 | Bacteria | 2670 |
| 72 | Ga0070704_100146231 | 3300005549 | Bacteria | 1852 |
| 73 | Ga0070704_100216168 | 3300005549 | Bacteria | 1556 |
| 74 | Ga0068855_100294366 | 3300005563 | Bacteria | 1799 |
| 75 | Ga0070664_100013275 | 3300005564 | Bacteria | 6709 |
| 76 | Ga0070664_100058703 | 3300005564 | Bacteria | 3273 |
| 77 | Ga0070664_100144185 | 3300005564 | Bacteria | 2099 |
| 78 | Ga0070664_100214497 | 3300005564 | Bacteria | 1720 |
| 79 | Ga0068857_100065380 | 3300005577 | Bacteria | 3234 |
| 80 | Ga0068854_100001203 | 3300005578 | Bacteria | 15515 |
| 81 | Ga0068854_100056337 | 3300005578 | Bacteria | 2833 |
| 82 | Ga0068854_100070238 | 3300005578 | Bacteria | 2559 |
| 83 | Ga0068856_100004032 | 3300005614 | Bacteria | 14706 |
| 84 | Ga0068856_100026571 | 3300005614 | Bacteria | 5645 |
| 85 | Ga0068856_100157815 | 3300005614 | Bacteria | 2278 |
| 86 | Ga0068856_100250189 | 3300005614 | Bacteria | 1787 |
| 87 | Ga0068856_100266325 | 3300005614 | Bacteria | 1729 |
| 88 | Ga0070702_100013201 | 3300005615 | Bacteria | 4164 |
| 89 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 90 | Ga0068852_100007835 | 3300005616 | Bacteria | 7819 |
| 91 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 92 | Ga0068864_100043739 | 3300005618 | Bacteria | 3836 |
| 93 | Ga0068864_100103015 | 3300005618 | Bacteria | 2534 |
| 94 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 95 | Ga0068861_100152617 | 3300005719 | Bacteria | 1897 |
| 96 | Ga0068851_10001260 | 3300005834 | Bacteria | 11027 |
| 97 | Ga0068863_100000022 | 3300005841 | Bacteria | 188278 |
| 98 | Ga0068858_100093657 | 3300005842 | Bacteria | 2797 |
| 99 | Ga0068860_100011591 | 3300005843 | Bacteria | 8694 |
| 100 | Ga0068860_100085754 | 3300005843 | Bacteria | 2996 |
| 101 | Ga0068862_100002782 | 3300005844 | Bacteria | 15329 |
| 102 | Ga0081455_10005716 | 3300005937 | Bacteria | 13558 |
| 103 | Ga0081455_10010756 | 3300005937 | Bacteria | 9252 |
| 104 | Ga0081455_10021412 | 3300005937 | Bacteria | 6064 |
| 105 | Ga0081455_10049005 | 3300005937 | Bacteria | 3644 |
| 106 | Ga0081455_10059195 | 3300005937 | Bacteria | 3236 |
| 107 | Ga0081455_10067266 | 3300005937 | Bacteria | 2986 |
| 108 | Ga0081455_10164809 | 3300005937 | Bacteria | 1695 |
| 109 | Ga0081538_10000020 | 3300005981 | Bacteria | 139567 |
| 110 | Ga0081538_10000316 | 3300005981 | Bacteria | 55223 |
| 111 | Ga0081538_10000486 | 3300005981 | Bacteria | 44589 |
| 112 | Ga0081538_10000526 | 3300005981 | Bacteria | 42457 |
| 113 | Ga0081538_10000796 | 3300005981 | Bacteria | 34251 |
| 114 | Ga0081538_10000812 | 3300005981 | Bacteria | 33866 |
| 115 | Ga0081538_10008324 | 3300005981 | Bacteria | 8829 |
| 116 | Ga0081538_10018966 | 3300005981 | Bacteria | 5138 |
| 117 | Ga0081538_10025117 | 3300005981 | Bacteria | 4215 |
| 118 | Ga0081538_10030544 | 3300005981 | Bacteria | 3655 |
| 119 | Ga0081538_10089786 | 3300005981 | Bacteria | 1593 |
| 120 | Ga0081540_1000100 | 3300005983 | Bacteria | 91640 |
| 121 | Ga0081540_1000706 | 3300005983 | Bacteria | 30972 |
| 122 | Ga0081540_1046023 | 3300005983 | Bacteria | 2207 |
| 123 | Ga0081539_10000740 | 3300005985 | Bacteria | 65387 |
| 124 | Ga0081539_10000878 | 3300005985 | Bacteria | 57633 |
| 125 | Ga0081539_10003483 | 3300005985 | Bacteria | 19226 |
| 126 | Ga0081539_10008209 | 3300005985 | Bacteria | 9191 |
| 127 | Ga0081539_10024074 | 3300005985 | Bacteria | 3963 |
| 128 | Ga0075365_10007560 | 3300006038 | Bacteria | 6100 |
| 129 | Ga0075365_10018720 | 3300006038 | Bacteria | 4264 |
| 130 | Ga0075365_10116029 | 3300006038 | Bacteria | 1844 |
| 131 | Ga0075365_10230635 | 3300006038 | Bacteria | 1299 |
| 132 | Ga0075364_10107249 | 3300006051 | Bacteria | 1862 |
| 133 | Ga0070715_10000021 | 3300006163 | Bacteria | 119283 |
| 134 | Ga0075428_100082957 | 3300006844 | Bacteria | 3497 |
| 135 | Ga0075428_100208639 | 3300006844 | Bacteria | 2111 |
| 136 | Ga0075428_100278885 | 3300006844 | Bacteria | 1798 |
| 137 | Ga0075430_100002367 | 3300006846 | Bacteria | 15665 |
| 138 | Ga0075430_100053196 | 3300006846 | Bacteria | 3410 |
| 139 | Ga0075430_100394196 | 3300006846 | Bacteria | 1143 |
| 140 | Ga0075431_100008439 | 3300006847 | Bacteria | 10315 |
| 141 | Ga0075431_100018318 | 3300006847 | Bacteria | 7128 |
| 142 | Ga0075431_100023074 | 3300006847 | Bacteria | 6362 |
| 143 | Ga0075431_100036502 | 3300006847 | Bacteria | 5061 |
| 144 | Ga0075431_100072846 | 3300006847 | Bacteria | 3544 |
| 145 | Ga0075431_100163972 | 3300006847 | Bacteria | 2285 |
| 146 | Ga0075433_10000897 | 3300006852 | Bacteria | 20988 |
| 147 | Ga0075433_10004260 | 3300006852 | Bacteria | 11112 |
| 148 | Ga0075433_10033900 | 3300006852 | Bacteria | 4381 |
| 149 | Ga0075433_10131035 | 3300006852 | Bacteria | 2228 |
| 150 | Ga0075434_100027126 | 3300006871 | Bacteria | 5621 |
| 151 | Ga0075434_100043274 | 3300006871 | Bacteria | 4465 |
| 152 | Ga0075429_100028882 | 3300006880 | Bacteria | 4817 |
| 153 | Ga0068865_100000082 | 3300006881 | Bacteria | 50913 |
| 154 | Ga0068865_100092346 | 3300006881 | Bacteria | 2199 |
| 155 | Ga0075436_100079950 | 3300006914 | Bacteria | 2265 |
| 156 | Ga0105240_10042151 | 3300009093 | Bacteria | 5819 |
| 157 | Ga0111539_10070367 | 3300009094 | Bacteria | 4131 |
| 158 | Ga0111539_10100345 | 3300009094 | Bacteria | 3399 |
| 159 | Ga0105245_10000278 | 3300009098 | Bacteria | 48473 |
| 160 | Ga0105245_10000415 | 3300009098 | Bacteria | 39764 |
| 161 | Ga0105245_10001311 | 3300009098 | Bacteria | 22474 |
| 162 | Ga0105245_10011891 | 3300009098 | Bacteria | 7568 |
| 163 | Ga0105245_10180209 | 3300009098 | Bacteria | 2018 |
| 164 | Ga0105247_10001706 | 3300009101 | Bacteria | 15492 |
| 165 | Ga0105247_10155661 | 3300009101 | Bacteria | 1509 |
| 166 | Ga0114129_10001353 | 3300009147 | Bacteria | 32898 |
| 167 | Ga0114129_10012393 | 3300009147 | Bacteria | 12136 |
| 168 | Ga0114129_10032936 | 3300009147 | Bacteria | 7323 |
| 169 | Ga0114129_10112386 | 3300009147 | Bacteria | 3756 |
| 170 | Ga0114129_10251406 | 3300009147 | Bacteria | 2373 |
| 171 | Ga0114129_10692375 | 3300009147 | Bacteria | 1311 |
| 172 | Ga0105243_10007118 | 3300009148 | Bacteria | 8605 |
| 173 | Ga0105242_10000449 | 3300009176 | Bacteria | 32713 |
| 174 | Ga0105242_10000653 | 3300009176 | Bacteria | 27161 |
| 175 | Ga0105242_10417403 | 3300009176 | Bacteria | 1256 |
| 176 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 177 | Ga0105237_10408162 | 3300009545 | Bacteria | 1363 |
| 178 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 179 | Ga0105238_10006420 | 3300009551 | Bacteria | 11698 |
| 180 | Ga0105249_10000143 | 3300009553 | Bacteria | 92539 |
| 181 | Ga0105249_10003360 | 3300009553 | Bacteria | 13850 |
| 182 | Ga0105249_10007747 | 3300009553 | Bacteria | 9358 |
| 183 | Ga0105239_10036088 | 3300010375 | Bacteria | 5428 |
| 184 | Ga0105246_10037640 | 3300011119 | Bacteria | 3247 |
| 185 | Ga0105246_10107799 | 3300011119 | Bacteria | 2041 |
| 186 | Ga0157371_10001577 | 3300013102 | Bacteria | 23401 |
| 187 | Ga0157370_10003254 | 3300013104 | Bacteria | 19142 |
| 188 | Ga0157370_10047400 | 3300013104 | Bacteria | 4120 |
| 189 | Ga0157370_10269346 | 3300013104 | Bacteria | 1574 |
| 190 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 191 | Ga0157369_10083922 | 3300013105 | Bacteria | 3406 |
| 192 | Ga0157369_10215970 | 3300013105 | Bacteria | 2009 |
| 193 | Ga0157369_10276762 | 3300013105 | Bacteria | 1748 |
| 194 | Ga0157374_10000486 | 3300013296 | Bacteria | 35981 |
| 195 | Ga0157374_10004880 | 3300013296 | Bacteria | 11252 |
| 196 | Ga0157378_10003241 | 3300013297 | Bacteria | 14481 |
| 197 | Ga0157378_10040737 | 3300013297 | Bacteria | 4120 |
| 198 | Ga0163162_10034394 | 3300013306 | Bacteria | 5043 |
| 199 | Ga0163162_10120085 | 3300013306 | Bacteria | 2732 |
| 200 | Ga0157372_10000053 | 3300013307 | Bacteria | 128824 |
| 201 | Ga0157372_10148694 | 3300013307 | Bacteria | 2702 |
| 202 | Ga0157372_10323196 | 3300013307 | Bacteria | 1796 |
| 203 | Ga0157375_10436619 | 3300013308 | Bacteria | 1475 |
| 204 | Ga0163163_10113198 | 3300014325 | Bacteria | 2743 |
| 205 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 206 | Ga0157380_10000236 | 3300014326 | Bacteria | 33220 |
| 207 | Ga0157377_10017479 | 3300014745 | Bacteria | 3710 |
| 208 | Ga0157379_10030707 | 3300014968 | Bacteria | 4785 |
| 209 | Ga0157379_10148336 | 3300014968 | Bacteria | 2115 |
| 210 | Ga0157376_10027214 | 3300014969 | Bacteria | 4530 |
| 211 | Ga0157376_10153677 | 3300014969 | Bacteria | 2078 |
| 212 | Ga0163161_10000053 | 3300017792 | Bacteria | 117408 |
| 213 | Ga0206353_10154608 | 3300020082 | Bacteria | 3058 |
| 214 | Ga0207656_10000226 | 3300025321 | Bacteria | 20150 |
| 215 | Ga0207656_10027875 | 3300025321 | Bacteria | 2314 |
| 216 | Ga0207682_10010613 | 3300025893 | Bacteria | 3606 |
| 217 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 218 | Ga0207642_10000080 | 3300025899 | Bacteria | 25169 |
| 219 | Ga0207710_10000157 | 3300025900 | Bacteria | 72764 |
| 220 | Ga0207688_10004162 | 3300025901 | Bacteria | 7882 |
| 221 | Ga0207688_10027092 | 3300025901 | Bacteria | 3152 |
| 222 | Ga0207685_10000054 | 3300025905 | Bacteria | 35900 |
| 223 | Ga0207705_10290817 | 3300025909 | Bacteria | 1252 |
| 224 | Ga0207654_10057938 | 3300025911 | Bacteria | 2253 |
| 225 | Ga0207707_10164307 | 3300025912 | Bacteria | 1940 |
| 226 | Ga0207695_10104584 | 3300025913 | Bacteria | 2820 |
| 227 | Ga0207693_10103235 | 3300025915 | Bacteria | 2236 |
| 228 | Ga0207660_10013331 | 3300025917 | Bacteria | 5386 |
| 229 | Ga0207657_10004340 | 3300025919 | Bacteria | 15020 |
| 230 | Ga0207657_10015215 | 3300025919 | Bacteria | 7463 |
| 231 | Ga0207649_10000127 | 3300025920 | Bacteria | 64603 |
| 232 | Ga0207652_10000321 | 3300025921 | Bacteria | 49720 |
| 233 | Ga0207652_10001733 | 3300025921 | Bacteria | 19037 |
| 234 | Ga0207652_10009748 | 3300025921 | Bacteria | 7728 |
| 235 | Ga0207652_10312844 | 3300025921 | Bacteria | 1418 |
| 236 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 237 | Ga0207650_10091138 | 3300025925 | Bacteria | 2329 |
| 238 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 239 | Ga0207687_10000032 | 3300025927 | Bacteria | 143196 |
| 240 | Ga0207687_10000036 | 3300025927 | Bacteria | 121934 |
| 241 | Ga0207687_10000460 | 3300025927 | Bacteria | 27723 |
| 242 | Ga0207687_10003112 | 3300025927 | Bacteria | 11249 |
| 243 | Ga0207687_10049514 | 3300025927 | Bacteria | 2922 |
| 244 | Ga0207690_10023856 | 3300025932 | Bacteria | 3825 |
| 245 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 246 | Ga0207686_10000097 | 3300025934 | Bacteria | 72219 |
| 247 | Ga0207686_10000921 | 3300025934 | Bacteria | 17629 |
| 248 | Ga0207709_10005457 | 3300025935 | Bacteria | 7225 |
| 249 | Ga0207669_10000017 | 3300025937 | Bacteria | 119878 |
| 250 | Ga0207669_10000026 | 3300025937 | Bacteria | 92199 |
| 251 | Ga0207669_10178961 | 3300025937 | Bacteria | 1518 |
| 252 | Ga0207704_10000184 | 3300025938 | Bacteria | 32775 |
| 253 | Ga0207704_10028503 | 3300025938 | Bacteria | 3099 |
| 254 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 255 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 256 | Ga0207711_10101111 | 3300025941 | Bacteria | 2551 |
| 257 | Ga0207661_10001690 | 3300025944 | Bacteria | 15057 |
| 258 | Ga0207661_10002110 | 3300025944 | Bacteria | 13678 |
| 259 | Ga0207661_10004460 | 3300025944 | Bacteria | 9836 |
| 260 | Ga0207661_10039531 | 3300025944 | Bacteria | 3702 |
| 261 | Ga0207661_10083801 | 3300025944 | Bacteria | 2639 |
| 262 | Ga0207679_10215838 | 3300025945 | Bacteria | 1612 |
| 263 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 264 | Ga0207712_10075298 | 3300025961 | Bacteria | 2440 |
| 265 | Ga0207712_10277264 | 3300025961 | Bacteria | 1367 |
| 266 | Ga0207668_10071280 | 3300025972 | Bacteria | 2481 |
| 267 | Ga0207640_10000093 | 3300025981 | Bacteria | 70374 |
| 268 | Ga0207640_10034577 | 3300025981 | Bacteria | 3155 |
| 269 | Ga0207640_10061908 | 3300025981 | Bacteria | 2481 |
| 270 | Ga0207640_10171236 | 3300025981 | Bacteria | 1618 |
| 271 | Ga0207640_10228930 | 3300025981 | Bacteria | 1429 |
| 272 | Ga0207658_10003551 | 3300025986 | Bacteria | 11011 |
| 273 | Ga0207658_10023672 | 3300025986 | Bacteria | 4289 |
| 274 | Ga0207658_10137457 | 3300025986 | Bacteria | 1973 |
| 275 | Ga0207677_10001038 | 3300026023 | Bacteria | 15272 |
| 276 | Ga0207677_10031049 | 3300026023 | Bacteria | 3419 |
| 277 | Ga0207639_10005999 | 3300026041 | Bacteria | 8242 |
| 278 | Ga0207678_10002224 | 3300026067 | Bacteria | 17527 |
| 279 | Ga0207678_10016375 | 3300026067 | Bacteria | 6509 |
| 280 | Ga0207678_10125666 | 3300026067 | Bacteria | 2188 |
| 281 | Ga0207678_10228064 | 3300026067 | Bacteria | 1595 |
| 282 | Ga0207708_10014443 | 3300026075 | Bacteria | 5910 |
| 283 | Ga0207708_10018028 | 3300026075 | Bacteria | 5313 |
| 284 | Ga0207702_10000637 | 3300026078 | Bacteria | 38379 |
| 285 | Ga0207702_10047334 | 3300026078 | Bacteria | 3624 |
| 286 | Ga0207702_10223666 | 3300026078 | Bacteria | 1755 |
| 287 | Ga0207702_10426774 | 3300026078 | Bacteria | 1283 |
| 288 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 289 | Ga0207648_10100881 | 3300026089 | Bacteria | 2529 |
| 290 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 291 | Ga0207674_10035565 | 3300026116 | Bacteria | 5198 |
| 292 | Ga0207674_10054549 | 3300026116 | Bacteria | 4068 |
| 293 | Ga0207675_100043378 | 3300026118 | Bacteria | 4200 |
| 294 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 295 | Ga0207698_10013220 | 3300026142 | Bacteria | 5437 |
| 296 | Ga0207698_10191136 | 3300026142 | Bacteria | 1823 |
| 297 | Ga0207698_10305362 | 3300026142 | Bacteria | 1483 |
| 298 | Ga0207428_10065295 | 3300027907 | Bacteria | 2871 |
| 299 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 300 | Ga0268266_10001254 | 3300028379 | Bacteria | 31003 |
| 301 | Ga0268266_10006356 | 3300028379 | Bacteria | 10831 |
| 302 | Ga0268266_10184601 | 3300028379 | Bacteria | 1901 |
| 303 | Ga0268265_10002889 | 3300028380 | Bacteria | 12617 |
| 304 | Ga0268264_10016645 | 3300028381 | Bacteria | 6021 |
| 305 | Ga0268264_10059027 | 3300028381 | Bacteria | 3214 |
| 306 | Ga0268264_10222234 | 3300028381 | Bacteria | 1739 |
| 307 | Ga0265337_1000066 | 3300028556 | Bacteria | 48673 |
| 308 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 309 | Ga0265319_1000469 | 3300028563 | Bacteria | 28589 |
| 310 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 311 | Ga0265338_10000244 | 3300028800 | Bacteria | 100528 |
| 312 | Ga0265324_10000283 | 3300029957 | Bacteria | 37587 |
| 313 | Ga0265332_10061866 | 3300031238 | Bacteria | 1600 |
| 314 | Ga0265328_10000737 | 3300031239 | Bacteria | 15188 |
| 315 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 316 | Ga0265329_10016232 | 3300031242 | Bacteria | 2585 |
| 317 | Ga0265331_10000858 | 3300031250 | Bacteria | 24739 |
| 318 | Ga0265331_10047145 | 3300031250 | Bacteria | 2074 |
| 319 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 320 | Ga0265316_10047188 | 3300031344 | Bacteria | 3408 |
| 321 | Ga0265316_10050858 | 3300031344 | Unclassified | 3258 |
| 322 | Ga0307408_100103118 | 3300031548 | Bacteria | 2177 |
| 323 | Ga0307408_100140389 | 3300031548 | Bacteria | 1896 |
| 324 | Ga0265314_10000640 | 3300031711 | Bacteria | 42944 |
| 325 | Ga0316576_10015088 | 3300031727 | Bacteria | 5176 |
| 326 | Ga0307405_10080241 | 3300031731 | Bacteria | 2130 |
| 327 | Ga0307405_10089558 | 3300031731 | Bacteria | 2033 |
| 328 | Ga0307413_10187315 | 3300031824 | Bacteria | 1482 |
| 329 | Ga0307410_10045879 | 3300031852 | Bacteria | 2913 |
| 330 | Ga0307410_10068378 | 3300031852 | Bacteria | 2453 |
| 331 | Ga0307410_10069885 | 3300031852 | Bacteria | 2430 |
| 332 | Ga0307410_10166615 | 3300031852 | Bacteria | 1656 |
| 333 | Ga0307406_10014323 | 3300031901 | Bacteria | 4561 |
| 334 | Ga0307406_10049495 | 3300031901 | Bacteria | 2660 |
| 335 | Ga0307406_10113558 | 3300031901 | Bacteria | 1869 |
| 336 | Ga0307406_10270804 | 3300031901 | Bacteria | 1290 |
| 337 | Ga0307407_10038141 | 3300031903 | Bacteria | 2661 |
| 338 | Ga0307407_10250570 | 3300031903 | Bacteria | 1213 |
| 339 | Ga0307412_10140447 | 3300031911 | Bacteria | 1768 |
| 340 | Ga0307409_100003645 | 3300031995 | Bacteria | 8425 |
| 341 | Ga0307409_100123747 | 3300031995 | Bacteria | 2195 |
| 342 | Ga0307409_100141139 | 3300031995 | Bacteria | 2076 |
| 343 | Ga0307416_100007153 | 3300032002 | Bacteria | 7060 |
| 344 | Ga0307416_100054463 | 3300032002 | Bacteria | 3216 |
| 345 | Ga0307416_100073654 | 3300032002 | Bacteria | 2849 |
| 346 | Ga0307416_100102545 | 3300032002 | Bacteria | 2495 |
| 347 | Ga0307416_100380160 | 3300032002 | Bacteria | 1442 |
| 348 | Ga0307414_10041832 | 3300032004 | Bacteria | 3108 |
| 349 | Ga0307414_10202999 | 3300032004 | Bacteria | 1614 |
| 350 | Ga0307414_10291312 | 3300032004 | Bacteria | 1376 |
| 351 | Ga0307414_10398784 | 3300032004 | Bacteria | 1194 |
| 352 | Ga0307411_10050006 | 3300032005 | Bacteria | 2720 |
| 353 | Ga0307415_100004435 | 3300032126 | Bacteria | 7279 |
| 354 | Ga0307415_100023008 | 3300032126 | Bacteria | 3860 |
| 355 | Ga0307415_100027919 | 3300032126 | Bacteria | 3583 |
| 356 | Ga0307415_100077824 | 3300032126 | Bacteria | 2356 |
| 357 | Ga0307415_100095665 | 3300032126 | Bacteria | 2163 |
| 358 | Ga0307415_100144164 | 3300032126 | Bacteria | 1823 |
| 359 | Ga0373949_0009952 | 3300035090 | Bacteria | 2080 |
| 360 | Ga0373955_0147652 | 3300035172 | Bacteria | 1382 |
| 361 | Ga0316584_0001782 | 3300036712 | Bacteria | 13265 |
| 362 | Ga0373925_0118482 | 3300037068 | Bacteria | 2053 |
| 363 | Ga0395900_0105892 | 3300037418 | Bacteria | 2889 |
| 364 | Ga0395900_0223900 | 3300037418 | Bacteria | 1895 |
| 365 | Ga0395900_0346516 | 3300037418 | Bacteria | 1460 |
| 366 | Ga0395898_0026411 | 3300037466 | Bacteria | 5842 |
| 367 | Ga0395898_0092869 | 3300037466 | Bacteria | 2902 |
| 368 | Ga0395898_0235746 | 3300037466 | Bacteria | 1745 |
| 369 | Ga0395905_0246814 | 3300037471 | Bacteria | 1668 |
| 370 | Ga0395901_0004095 | 3300038443 | Bacteria | 14694 |
| 371 | Ga0395901_0053141 | 3300038443 | Bacteria | 4210 |
| 372 | Ga0439463_010194 | 3300042016 | Bacteria | 2310 |
| 373 | Ga0439444_0016827 | 3300042437 | Bacteria | 1249 |
| 374 | Ga0466961_0114035 | 3300044693 | Bacteria | 1699 |
| 375 | Ga0466963_0000017 | 3300044694 | Bacteria | 58283 |
| 376 | Ga0466963_0070730 | 3300044694 | Bacteria | 2347 |
| 377 | Ga0466963_0285886 | 3300044694 | Bacteria | 1159 |
| 378 | Ga0466971_0012957 | 3300044719 | Bacteria | 3658 |
| 379 | Ga0466968_0074169 | 3300044735 | Bacteria | 1485 |
| 380 | Ga0466957_0001414 | 3300044842 | Bacteria | 12517 |
| 381 | Ga0466957_0074080 | 3300044842 | Bacteria | 2111 |
| 382 | Ga0466957_0125696 | 3300044842 | Bacteria | 1638 |
| 383 | Ga0466960_0074615 | 3300044901 | Bacteria | 1695 |
| 384 | Ga0466958_0010414 | 3300045836 | Bacteria | 5207 |
| 385 | Ga0466967_0000001 | 3300045976 | Bacteria | 229823 |
| 386 | Ga0466967_0007296 | 3300045976 | Bacteria | 7958 |
| 387 | Ga0466967_0010090 | 3300045976 | Bacteria | 7059 |
| 388 | Ga0466967_0025483 | 3300045976 | Bacteria | 4878 |
| 389 | Ga0495592_0000607 | 3300046454 | Bacteria | 25304 |
| 390 | Ga0495603_0000286 | 3300046455 | Bacteria | 26902 |
| 391 | Ga0495603_0001350 | 3300046455 | Bacteria | 14245 |
| 392 | Ga0495603_0122584 | 3300046455 | Bacteria | 1514 |
| 393 | Ga0495629_0000245 | 3300046459 | Bacteria | 47272 |
| 394 | Ga0495629_0005286 | 3300046459 | Bacteria | 9650 |
| 395 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 396 | Ga0495641_0056121 | 3300046461 | Bacteria | 1786 |
| 397 | Ga0495650_0000054 | 3300046471 | Bacteria | 313631 |
| 398 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 399 | Ga0495582_0098596 | 3300046473 | Bacteria | 1635 |
| 400 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 401 | Ga0495662_0000848 | 3300046476 | Bacteria | 14886 |
| 402 | Ga0495594_0000089 | 3300046499 | Bacteria | 41876 |
| 403 | Ga0495596_0086850 | 3300046500 | Bacteria | 1214 |
| 404 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 405 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 406 | Ga0495608_0094331 | 3300046511 | Bacteria | 1933 |
| 407 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 408 | Ga0495618_0167218 | 3300046514 | Bacteria | 1400 |
| 409 | Ga0495620_0000784 | 3300046515 | Bacteria | 19458 |
| 410 | Ga0495628_0023790 | 3300046516 | Bacteria | 5023 |
| 411 | Ga0495628_0066303 | 3300046516 | Bacteria | 2822 |
| 412 | Ga0495628_0251803 | 3300046516 | Bacteria | 1318 |
| 413 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 414 | Ga0495630_0000533 | 3300046517 | Bacteria | 27959 |
| 415 | Ga0495630_0003407 | 3300046517 | Bacteria | 11078 |
| 416 | Ga0495630_0058778 | 3300046517 | Bacteria | 2883 |
| 417 | Ga0495630_0198928 | 3300046517 | Bacteria | 1529 |
| 418 | Ga0495644_0001871 | 3300046523 | Bacteria | 8485 |
| 419 | Ga0495642_0081004 | 3300046528 | Bacteria | 1367 |
| 420 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 421 | Ga0495652_0011995 | 3300046529 | Bacteria | 7834 |
| 422 | Ga0495640_0091728 | 3300046533 | Bacteria | 2004 |
| 423 | Ga0495586_0003054 | 3300046535 | Bacteria | 9025 |
| 424 | Ga0495587_0003966 | 3300046536 | Bacteria | 9814 |
| 425 | Ga0495609_0091426 | 3300046538 | Bacteria | 1324 |
| 426 | Ga0495645_0027447 | 3300046543 | Bacteria | 4137 |
| 427 | Ga0495622_0000080 | 3300046557 | Bacteria | 85557 |
| 428 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 429 | Ga0495656_0000465 | 3300046615 | Bacteria | 13215 |
| 430 | Ga0495656_0077512 | 3300046615 | Bacteria | 1492 |
| 431 | Ga0495668_0041252 | 3300046616 | Bacteria | 2572 |
| 432 | Ga0495634_0000028 | 3300046642 | Bacteria | 114075 |
| 433 | Ga0495634_0001744 | 3300046642 | Bacteria | 18826 |
| 434 | Ga0495634_0113592 | 3300046642 | Bacteria | 1739 |
| 435 | Ga0495625_0000349 | 3300046660 | Bacteria | 70631 |
| 436 | Ga0495625_0076676 | 3300046660 | Bacteria | 2337 |
| 437 | Ga0495635_0000076 | 3300046663 | Bacteria | 61665 |
| 438 | Ga0495588_0000362 | 3300046674 | Bacteria | 28212 |
| 439 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 440 | Ga0495657_0017364 | 3300046675 | Bacteria | 5226 |
| 441 | Ga0495599_0036072 | 3300046678 | Bacteria | 3104 |
| 442 | Ga0495646_0106600 | 3300046680 | Bacteria | 1600 |
| 443 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 444 | Ga0495647_0008133 | 3300046681 | Bacteria | 3524 |
| 445 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 446 | Ga0495658_0019725 | 3300046683 | Bacteria | 3524 |
| 447 | Ga0495669_0000113 | 3300046684 | Bacteria | 52780 |
| 448 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 449 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 450 | Ga0495624_0000019 | 3300046690 | Bacteria | 102237 |
| 451 | Ga0495624_0000417 | 3300046690 | Bacteria | 33743 |
| 452 | Ga0495624_0033290 | 3300046690 | Bacteria | 3338 |
| 453 | Ga0495649_0002403 | 3300046694 | Bacteria | 13212 |
| 454 | Ga0495600_0011717 | 3300046809 | Bacteria | 5472 |
| 455 | Ga0495604_0000239 | 3300047317 | Bacteria | 49113 |
| 456 | Ga0495604_0001251 | 3300047317 | Bacteria | 20805 |
| 457 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 458 | Ga0495672_0068475 | 3300047320 | Bacteria | 2018 |
| 459 | Ga0495676_0000827 | 3300047321 | Bacteria | 25944 |
| 460 | Ga0495676_0012579 | 3300047321 | Bacteria | 7619 |
| 461 | Ga0495676_0057606 | 3300047321 | Bacteria | 3063 |
| 462 | Ga0495680_0000143 | 3300047322 | Bacteria | 71946 |
| 463 | Ga0495680_0001430 | 3300047322 | Bacteria | 25733 |
| 464 | Ga0495680_0022126 | 3300047322 | Bacteria | 5308 |
| 465 | Ga0495675_0001421 | 3300047444 | Bacteria | 14505 |
| 466 | Ga0495673_0072568 | 3300047469 | Bacteria | 1444 |
| 467 | Ga0495686_0097769 | 3300047472 | Bacteria | 1774 |
| 468 | Ga0495593_0039645 | 3300047673 | Bacteria | 2539 |
| 469 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 470 | Ga0495602_0001031 | 3300048088 | Bacteria | 27141 |
| 471 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 472 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 473 | Ga0496100_0080822 | 3300048903 | Bacteria | 2194 |
| 474 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 475 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 476 | Ga0496101_0211132 | 3300048904 | Bacteria | 1504 |
| 477 | Ga0496102_0000211 | 3300048905 | Bacteria | 77793 |
| 478 | Ga0496102_0010565 | 3300048905 | Bacteria | 7951 |
| 479 | Ga0496102_0058720 | 3300048905 | Bacteria | 3516 |
| 480 | Ga0496102_0098230 | 3300048905 | Bacteria | 2717 |
| 481 | Ga0496102_0109368 | 3300048905 | Bacteria | 2575 |
| 482 | Ga0496102_0145284 | 3300048905 | Bacteria | 2226 |
| 483 | Ga0496102_0279465 | 3300048905 | Bacteria | 1574 |
| 484 | Ga0496102_0340303 | 3300048905 | Bacteria | 1413 |
| 485 | Ga0496103_0000083 | 3300048906 | Bacteria | 108615 |
| 486 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 487 | Ga0496104_0000052 | 3300048907 | Bacteria | 137286 |
| 488 | Ga0496104_0000765 | 3300048907 | Bacteria | 27516 |
| 489 | Ga0496104_0017182 | 3300048907 | Bacteria | 6581 |
| 490 | Ga0496104_0049764 | 3300048907 | Bacteria | 3952 |
| 491 | Ga0496104_0120640 | 3300048907 | Bacteria | 2517 |
| 492 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 493 | Ga0496105_0000030 | 3300048908 | Bacteria | 137325 |
| 494 | Ga0496105_0000409 | 3300048908 | Bacteria | 28168 |
| 495 | Ga0496105_0022580 | 3300048908 | Bacteria | 5096 |
| 496 | Ga0496105_0027673 | 3300048908 | Bacteria | 4634 |
| 497 | Ga0496106_0000076 | 3300048909 | Bacteria | 79088 |
| 498 | Ga0496106_0000121 | 3300048909 | Bacteria | 59910 |
| 499 | Ga0496106_0004512 | 3300048909 | Bacteria | 10312 |
| 500 | Ga0496106_0006748 | 3300048909 | Bacteria | 8500 |
| 501 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 502 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 503 | Ga0496107_0041276 | 3300048910 | Bacteria | 3313 |
| 504 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 505 | Ga0496108_0000063 | 3300048911 | Bacteria | 118950 |
| 506 | Ga0496108_0003280 | 3300048911 | Bacteria | 12999 |
| 507 | Ga0496108_0025146 | 3300048911 | Bacteria | 4906 |
| 508 | Ga0496108_0054035 | 3300048911 | Bacteria | 3370 |
| 509 | Ga0496108_0108936 | 3300048911 | Bacteria | 2366 |
| 510 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 511 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 512 | Ga0496109_0000348 | 3300048912 | Bacteria | 43133 |
| 513 | Ga0496109_0000942 | 3300048912 | Bacteria | 24081 |
| 514 | Ga0496109_0003361 | 3300048912 | Bacteria | 13379 |
| 515 | Ga0496109_0039321 | 3300048912 | Bacteria | 4281 |
| 516 | Ga0496109_0057511 | 3300048912 | Bacteria | 3550 |
| 517 | Ga0496109_0070649 | 3300048912 | Bacteria | 3204 |
| 518 | Ga0496110_0002164 | 3300048913 | Bacteria | 14666 |
| 519 | Ga0496110_0037796 | 3300048913 | Bacteria | 4197 |
| 520 | Ga0496110_0062843 | 3300048913 | Bacteria | 3280 |
| 521 | Ga0496110_0102704 | 3300048913 | Bacteria | 2564 |
| 522 | Ga0496110_0116106 | 3300048913 | Bacteria | 2409 |
| 523 | Ga0496111_0000044 | 3300048914 | Bacteria | 49014 |
| 524 | Ga0496111_0025522 | 3300048914 | Bacteria | 4170 |
| 525 | Ga0496111_0047291 | 3300048914 | Bacteria | 3098 |
| 526 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 527 | Ga0496112_0030187 | 3300048915 | Bacteria | 5245 |
| 528 | Ga0496112_0279281 | 3300048915 | Bacteria | 1617 |
| 529 | Ga0496112_0282194 | 3300048915 | Bacteria | 1608 |
| 530 | Ga0496112_0409451 | 3300048915 | Bacteria | 1295 |
| 531 | Ga0496113_0000013 | 3300048916 | Bacteria | 81224 |
| 532 | Ga0496113_0020234 | 3300048916 | Bacteria | 4675 |
| 533 | Ga0496113_0024871 | 3300048916 | Bacteria | 4263 |
| 534 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 535 | Ga0496114_0054866 | 3300048917 | Bacteria | 3323 |
| 536 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 537 | Ga0496115_0000377 | 3300048918 | Bacteria | 36788 |
| 538 | Ga0496116_0000848 | 3300048919 | Bacteria | 38292 |
| 539 | Ga0496117_0009784 | 3300048920 | Bacteria | 8842 |
| 540 | Ga0496119_0066967 | 3300048922 | Bacteria | 2119 |
| 541 | Ga0496119_0104486 | 3300048922 | Bacteria | 1584 |
| 542 | Ga0496120_0024368 | 3300048923 | Bacteria | 3775 |
| 543 | Ga0496121_0013496 | 3300048924 | Bacteria | 8770 |
| 544 | Ga0496122_0041994 | 3300048925 | Bacteria | 3605 |
| 545 | Ga0496124_0051640 | 3300048927 | Bacteria | 3497 |
| 546 | Ga0496124_0159321 | 3300048927 | Bacteria | 1761 |
| 547 | Ga0496124_0183177 | 3300048927 | Bacteria | 1610 |
| 548 | Ga0496125_0071032 | 3300048928 | Bacteria | 2722 |
| 549 | Ga0496126_0019594 | 3300048929 | Bacteria | 6660 |
| 550 | Ga0501031_0000523 | 3300049568 | Bacteria | 22416 |
| 551 | Ga0501031_0002175 | 3300049568 | Bacteria | 12379 |
| 552 | Ga0501031_0032359 | 3300049568 | Bacteria | 3409 |
| 553 | Ga0501031_0192515 | 3300049568 | Unclassified | 1331 |
| 554 | Ga0501032_0011222 | 3300049569 | Bacteria | 6435 |
| 555 | Ga0501032_0026816 | 3300049569 | Bacteria | 3960 |
| 556 | Ga0501033_0003689 | 3300049570 | Bacteria | 12454 |
| 557 | Ga0501033_0022701 | 3300049570 | Bacteria | 4732 |
| 558 | Ga0501033_0077057 | 3300049570 | Bacteria | 2447 |
| 559 | Ga0501034_0016227 | 3300049571 | Bacteria | 7642 |
| 560 | Ga0501034_0016892 | 3300049571 | Bacteria | 7482 |
| 561 | Ga0501034_0200589 | 3300049571 | Bacteria | 1953 |
| 562 | Ga0501036_0022928 | 3300049572 | Bacteria | 5257 |
| 563 | Ga0501036_0030691 | 3300049572 | Bacteria | 4539 |
| 564 | Ga0501036_0114656 | 3300049572 | Bacteria | 2277 |
| 565 | Ga0501036_0158395 | 3300049572 | Bacteria | 1909 |
| 566 | Ga0501037_0002926 | 3300049573 | Bacteria | 12385 |
| 567 | Ga0501037_0007442 | 3300049573 | Bacteria | 8008 |
| 568 | Ga0501037_0160448 | 3300049573 | Bacteria | 1603 |
| 569 | Ga0501037_0214085 | 3300049573 | Bacteria | 1358 |
| 570 | Ga0501038_0005058 | 3300049574 | Bacteria | 12248 |
| 571 | Ga0501038_0044559 | 3300049574 | Bacteria | 3852 |
| 572 | Ga0501038_0120415 | 3300049574 | Bacteria | 2165 |
| 573 | Ga0501039_0009178 | 3300049575 | Bacteria | 7536 |
| 574 | Ga0501039_0013344 | 3300049575 | Bacteria | 6281 |
| 575 | Ga0501039_0013502 | 3300049575 | Bacteria | 6246 |
| 576 | Ga0501039_0126956 | 3300049575 | Bacteria | 2001 |
| 577 | Ga0501039_0152073 | 3300049575 | Bacteria | 1818 |
| 578 | Ga0501039_0173382 | 3300049575 | Bacteria | 1696 |
| 579 | Ga0501039_0355897 | 3300049575 | Bacteria | 1150 |
| 580 | Ga0501040_0002372 | 3300049576 | Bacteria | 12097 |
| 581 | Ga0501040_0002837 | 3300049576 | Bacteria | 11185 |
| 582 | Ga0501040_0090694 | 3300049576 | Bacteria | 2124 |
| 583 | Ga0501040_0153891 | 3300049576 | Bacteria | 1623 |
| 584 | Ga0501040_0283912 | 3300049576 | Bacteria | 1182 |
| 585 | Ga0501041_0016084 | 3300049577 | Bacteria | 4443 |
| 586 | Ga0501041_0017928 | 3300049577 | Bacteria | 4214 |
| 587 | Ga0501041_0027445 | 3300049577 | Bacteria | 3431 |
| 588 | Ga0501041_0063221 | 3300049577 | Bacteria | 2266 |
| 589 | Ga0501041_0227064 | 3300049577 | Unclassified | 1172 |
| 590 | Ga0501042_0011612 | 3300049578 | Bacteria | 5949 |
| 591 | Ga0501042_0012872 | 3300049578 | Bacteria | 5681 |
| 592 | Ga0501042_0018999 | 3300049578 | Bacteria | 4768 |
| 593 | Ga0501042_0252330 | 3300049578 | Bacteria | 1273 |
| 594 | Ga0501043_0090962 | 3300049579 | Bacteria | 2399 |
| 595 | Ga0501043_0159126 | 3300049579 | Bacteria | 1765 |
| 596 | Ga0501046_0004559 | 3300049580 | Bacteria | 12539 |
| 597 | Ga0501046_0006008 | 3300049580 | Bacteria | 10802 |
| 598 | Ga0501046_0079832 | 3300049580 | Bacteria | 2529 |
| 599 | Ga0501046_0084957 | 3300049580 | Bacteria | 2440 |
| 600 | Ga0501047_0004952 | 3300049581 | Bacteria | 12510 |
| 601 | Ga0501047_0010850 | 3300049581 | Bacteria | 8610 |
| 602 | Ga0501047_0047006 | 3300049581 | Bacteria | 4170 |
| 603 | Ga0501047_0148155 | 3300049581 | Bacteria | 2223 |
| 604 | Ga0501047_0176579 | 3300049581 | Bacteria | 2003 |
| 605 | Ga0501048_0003128 | 3300049582 | Bacteria | 12640 |
| 606 | Ga0501048_0009218 | 3300049582 | Bacteria | 7414 |
| 607 | Ga0501048_0058171 | 3300049582 | Bacteria | 2740 |
| 608 | Ga0501068_0002345 | 3300049584 | Bacteria | 10082 |
| 609 | Ga0501068_0135433 | 3300049584 | Bacteria | 1542 |
| 610 | Ga0501069_0003466 | 3300049585 | Bacteria | 8121 |
| 611 | Ga0501069_0006694 | 3300049585 | Bacteria | 6033 |
| 612 | Ga0501069_0075472 | 3300049585 | Bacteria | 1893 |
| 613 | Ga0501070_0004064 | 3300049586 | Bacteria | 12575 |
| 614 | Ga0501070_0028642 | 3300049586 | Bacteria | 4671 |
| 615 | Ga0501071_0000721 | 3300049587 | Bacteria | 17421 |
| 616 | Ga0501071_0006091 | 3300049587 | Bacteria | 7819 |
| 617 | Ga0501071_0010365 | 3300049587 | Bacteria | 6243 |
| 618 | Ga0501071_0056805 | 3300049587 | Bacteria | 2828 |
| 619 | Ga0501071_0132089 | 3300049587 | Bacteria | 1855 |
| 620 | Ga0501071_0169999 | 3300049587 | Bacteria | 1632 |
| 621 | Ga0501072_0000861 | 3300049588 | Bacteria | 22285 |
| 622 | Ga0501072_0017464 | 3300049588 | Bacteria | 5513 |
| 623 | Ga0501072_0019616 | 3300049588 | Bacteria | 5229 |
| 624 | Ga0501072_0030329 | 3300049588 | Bacteria | 4229 |
| 625 | Ga0501072_0043596 | 3300049588 | Bacteria | 3526 |
| 626 | Ga0501072_0116154 | 3300049588 | Bacteria | 2131 |
| 627 | Ga0501072_0306943 | 3300049588 | Bacteria | 1261 |
| 628 | Ga0501073_0007894 | 3300049589 | Bacteria | 7897 |
| 629 | Ga0501073_0012127 | 3300049589 | Bacteria | 6294 |
| 630 | Ga0501074_0018921 | 3300049590 | Bacteria | 5002 |
| 631 | Ga0501074_0034411 | 3300049590 | Bacteria | 3672 |
| 632 | Ga0501074_0113146 | 3300049590 | Bacteria | 1942 |
| 633 | Ga0501075_0007586 | 3300049591 | Bacteria | 7528 |
| 634 | Ga0501075_0045069 | 3300049591 | Bacteria | 3310 |
| 635 | Ga0501075_0133564 | 3300049591 | Bacteria | 1891 |
| 636 | Ga0501075_0369303 | 3300049591 | Bacteria | 1093 |
| 637 | Ga0501075_0492152 | 3300049591 | Bacteria | 935 |
| 638 | Ga0501076_0001451 | 3300049592 | Bacteria | 15944 |
| 639 | Ga0501076_0003612 | 3300049592 | Bacteria | 10866 |
| 640 | Ga0501076_0029982 | 3300049592 | Bacteria | 4235 |
| 641 | Ga0501076_0048517 | 3300049592 | Bacteria | 3356 |
| 642 | Ga0501076_0180083 | 3300049592 | Bacteria | 1723 |
| 643 | Ga0501076_0180966 | 3300049592 | Bacteria | 1718 |
| 644 | Ga0501077_0030258 | 3300049593 | Bacteria | 3445 |
| 645 | Ga0501077_0083461 | 3300049593 | Bacteria | 2024 |
| 646 | Ga0501079_0004891 | 3300049741 | Bacteria | 9931 |
| 647 | Ga0501079_0080440 | 3300049741 | Bacteria | 2519 |
| 648 | Ga0501080_0006646 | 3300049742 | Bacteria | 10402 |
| 649 | Ga0501080_0030783 | 3300049742 | Bacteria | 5000 |
| 650 | Ga0501080_0062326 | 3300049742 | Bacteria | 3471 |
| 651 | Ga0501080_0117493 | 3300049742 | Bacteria | 2465 |
| 652 | Ga0501081_0014926 | 3300049743 | Bacteria | 5124 |
| 653 | Ga0501081_0025371 | 3300049743 | Bacteria | 3987 |
| 654 | Ga0501083_0002614 | 3300049744 | Bacteria | 12402 |
| 655 | Ga0501083_0003895 | 3300049744 | Bacteria | 10485 |
| 656 | Ga0501083_0007495 | 3300049744 | Bacteria | 7730 |
| 657 | Ga0501083_0043053 | 3300049744 | Bacteria | 3060 |
| 658 | Ga0501035_0005116 | 3300049822 | Bacteria | 12420 |
| 659 | Ga0501035_0016708 | 3300049822 | Bacteria | 6766 |
| 660 | Ga0501035_0079660 | 3300049822 | Bacteria | 2893 |
| 661 | Ga0501035_0119818 | 3300049822 | Bacteria | 2301 |
| 662 | Ga0501035_0192751 | 3300049822 | Bacteria | 1752 |
| 663 | Ga0501044_0006919 | 3300049823 | Bacteria | 12483 |
| 664 | Ga0501044_0171526 | 3300049823 | Bacteria | 2140 |
| 665 | Ga0501045_0011031 | 3300049824 | Bacteria | 6334 |
| 666 | Ga0501045_0011542 | 3300049824 | Bacteria | 6204 |
| 667 | Ga0501045_0135648 | 3300049824 | Bacteria | 1830 |
| 668 | nmdc:mga03n38_41860_c1 | 3300050490 | Bacteria | 1999 |
| 669 | nmdc:mga00v17_51630_c2 | 3300050491 | Bacteria | 1890 |
| 670 | nmdc:mga00v17_71968_c2 | 3300050491 | Bacteria | 1322 |
| 671 | nmdc:mga0yw44_589_c1 | 3300050492 | Bacteria | 13169 |
| 672 | nmdc:mga0yw44_97687_c1 | 3300050492 | Bacteria | 1866 |
| 673 | nmdc:mga06z11_63651_c1 | 3300050494 | Bacteria | 1930 |
| 674 | nmdc:mga05p37_114066_c1 | 3300050507 | Bacteria | 3322 |
| 675 | nmdc:mga05p37_38150_c1 | 3300050507 | Bacteria | 5891 |
| 676 | nmdc:mga05p37_51957_c1 | 3300050507 | Bacteria | 5040 |
| 677 | nmdc:mga05p37_69258_c1 | 3300050507 | Bacteria | 4339 |
| 678 | nmdc:mga05p37_70480_c1 | 3300050507 | Bacteria | 4299 |
| 679 | nmdc:mga09592_93327_c1 | 3300050508 | Bacteria | 2574 |
| 680 | nmdc:mga0qj67_170565_c1 | 3300050509 | Bacteria | 1767 |
| 681 | nmdc:mga0qj67_26043_c1 | 3300050509 | Bacteria | 4526 |
| 682 | nmdc:mga0qj67_6768_c1 | 3300050509 | Bacteria | 8427 |
| 683 | nmdc:mga06r32_180923_c1 | 3300050510 | Bacteria | 2094 |
| 684 | nmdc:mga06r32_20441_c1 | 3300050510 | Bacteria | 6097 |
| 685 | nmdc:mga06r32_51501_c1 | 3300050510 | Bacteria | 3941 |
| 686 | nmdc:mga08y16_130720_c1 | 3300050511 | Bacteria | 2611 |
| 687 | nmdc:mga08y16_454811_c1 | 3300050511 | Bacteria | 1305 |
| 688 | nmdc:mga08y16_94149_c1 | 3300050511 | Bacteria | 3121 |
| 689 | nmdc:mga0n895_209759_c1 | 3300050512 | Bacteria | 1978 |
| 690 | nmdc:mga0n895_326505_c1 | 3300050512 | Bacteria | 1555 |
| 691 | nmdc:mga08x19_126213_c1 | 3300050514 | Bacteria | 1718 |
| 692 | nmdc:mga0a205_142921_c1 | 3300050515 | Bacteria | 2293 |
| 693 | nmdc:mga0a205_15449_c1 | 3300050515 | Bacteria | 7136 |
| 694 | nmdc:mga0a205_43_c1 | 3300050515 | Bacteria | 51209 |
| 695 | nmdc:mga0a205_53_c2 | 3300050515 | Bacteria | 54696 |
| 696 | Ga0495601_0000060 | 3300053077 | Bacteria | 60600 |
| 697 | Ga0495601_0000165 | 3300053077 | Bacteria | 35521 |
| 698 | Ga0495601_0025379 | 3300053077 | Bacteria | 3654 |
| 699 | Ga0495601_0057074 | 3300053077 | Bacteria | 2473 |
| 700 | Ga0495601_0200353 | 3300053077 | Bacteria | 1304 |
| 701 | Ga0495612_0000210 | 3300053078 | Bacteria | 24800 |
| 702 | Ga0495612_0003484 | 3300053078 | Bacteria | 6518 |
| 703 | Ga0495612_0005082 | 3300053078 | Bacteria | 5449 |
| 704 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 705 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 706 | Ga0495595_0000045 | 3300053084 | Bacteria | 63054 |
| 707 | Ga0495619_0000008 | 3300053085 | Bacteria | 305999 |
| 708 | Ga0495619_0000095 | 3300053085 | Bacteria | 66204 |
| 709 | Ga0495619_0000102 | 3300053085 | Bacteria | 64345 |
| 710 | Ga0495619_0000155 | 3300053085 | Bacteria | 50682 |
| 711 | Ga0495619_0000195 | 3300053085 | Bacteria | 44602 |
| 712 | Ga0495619_0000320 | 3300053085 | Bacteria | 33623 |
| 713 | Ga0495619_0010358 | 3300053085 | Bacteria | 5869 |
| 714 | Ga0495619_0053306 | 3300053085 | Bacteria | 2675 |
| 715 | Ga0500566_0001093 | 3300053094 | Bacteria | 15689 |
| 716 | Ga0500641_0001622 | 3300053096 | Bacteria | 8015 |
| 717 | Ga0500556_0000723 | 3300053104 | Bacteria | 19906 |
| 718 | Ga0500614_001424 | 3300053123 | Bacteria | 5734 |
| 719 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 720 | Ga0500616_0003272 | 3300053153 | Bacteria | 12504 |
| 721 | Ga0500616_0016529 | 3300053153 | Bacteria | 4197 |
| 722 | Ga0501084_0014280 | 3300054114 | Bacteria | 6577 |
| 723 | Ga0501084_0044771 | 3300054114 | Bacteria | 3705 |
| 724 | Ga0501084_0046476 | 3300054114 | Bacteria | 3637 |
| 725 | Ga0501082_0004774 | 3300060353 | Bacteria | 11825 |
| 726 | Ga0501082_0006568 | 3300060353 | Bacteria | 10073 |
| 727 | Ga0501082_0081193 | 3300060353 | Bacteria | 2798 |
| 728 | Ga0501082_0091634 | 3300060353 | Unclassified | 2625 |
| 729 | Ga0501082_0122044 | 3300060353 | Bacteria | 2259 |
| 730 | Ga0501082_0297438 | 3300060353 | Bacteria | 1405 |
| 731 | Ga0501082_0355486 | 3300060353 | Bacteria | 1278 |
| 732 | Ga0466962_0028029 | 3300061719 | Bacteria | 2700 |
| 733 | Ga0530510_0009466 | 3300061734 | Bacteria | 6831 |
| 734 | Ga0530510_0050397 | 3300061734 | Bacteria | 3007 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049591 | Ga0501075_0492152 | Ga0501075_0492152_63_902 | 278 |
| 2 | 3300031852 | Ga0307410_10045879 | Ga0307410_100458793 | 283 |
| 3 | 3300005329 | Ga0070683_100000404 | Ga0070683_10000040417 | 295 |
| 4 | 3300005535 | Ga0070684_100143253 | Ga0070684_1001432532 | 295 |
| 5 | 3300025944 | Ga0207661_10001690 | Ga0207661_100016902 | 295 |
| 6 | 3300048911 | Ga0496108_0000063 | Ga0496108_0000063_87244_88251 | 296 |
| 7 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_24496_25503 | 296 |
| 8 | 3300049569 | Ga0501032_0026816 | Ga0501032_0026816_2390_3379 | 300 |
| 9 | 3300049570 | Ga0501033_0022701 | Ga0501033_0022701_2090_3079 | 300 |
| 10 | 3300049572 | Ga0501036_0030691 | Ga0501036_0030691_1905_2894 | 300 |
| 11 | 3300049573 | Ga0501037_0007442 | Ga0501037_0007442_4903_5892 | 300 |
| 12 | 3300049574 | Ga0501038_0044559 | Ga0501038_0044559_2114_3103 | 300 |
| 13 | 3300049575 | Ga0501039_0009178 | Ga0501039_0009178_6130_7119 | 300 |
| 14 | 3300049580 | Ga0501046_0084957 | Ga0501046_0084957_426_1415 | 300 |
| 15 | 3300049581 | Ga0501047_0047006 | Ga0501047_0047006_1138_2127 | 300 |
| 16 | 3300049585 | Ga0501069_0003466 | Ga0501069_0003466_6332_7321 | 300 |
| 17 | 3300049588 | Ga0501072_0116154 | Ga0501072_0116154_305_1294 | 300 |
| 18 | 3300049589 | Ga0501073_0007894 | Ga0501073_0007894_6483_7472 | 300 |
| 19 | 3300049742 | Ga0501080_0117493 | Ga0501080_0117493_861_1850 | 300 |
| 20 | 3300049744 | Ga0501083_0007495 | Ga0501083_0007495_5532_6521 | 300 |
| 21 | 3300049822 | Ga0501035_0119818 | Ga0501035_0119818_312_1301 | 300 |
| 22 | 3300049823 | Ga0501044_0171526 | Ga0501044_0171526_873_1862 | 300 |
| 23 | 3300049824 | Ga0501045_0135648 | Ga0501045_0135648_639_1628 | 300 |
| 24 | 3300054114 | Ga0501084_0046476 | Ga0501084_0046476_1380_2369 | 300 |
| 25 | 3300060353 | Ga0501082_0004774 | Ga0501082_0004774_4791_5780 | 300 |
| 26 | 3300005981 | Ga0081538_10000316 | Ga0081538_100003168 | 301 |
| 27 | 3300032002 | Ga0307416_100007153 | Ga0307416_1000071534 | 301 |
| 28 | 3300031344 | Ga0265316_10050858 | Ga0265316_100508583 | 302 |
| 29 | 3300031901 | Ga0307406_10049495 | Ga0307406_100494952 | 302 |
| 30 | 3300032126 | Ga0307415_100023008 | Ga0307415_1000230082 | 302 |
| 31 | 3300044694 | Ga0466963_0070730 | Ga0466963_0070730_298_1305 | 302 |
| 32 | 3300049568 | Ga0501031_0000523 | Ga0501031_0000523_18012_18920 | 302 |
| 33 | 3300049570 | Ga0501033_0077057 | Ga0501033_0077057_1310_2218 | 302 |
| 34 | 3300049572 | Ga0501036_0158395 | Ga0501036_0158395_374_1282 | 302 |
| 35 | 3300049574 | Ga0501038_0120415 | Ga0501038_0120415_988_1896 | 302 |
| 36 | 3300049575 | Ga0501039_0013502 | Ga0501039_0013502_1998_2906 | 302 |
| 37 | 3300049576 | Ga0501040_0002372 | Ga0501040_0002372_1182_2090 | 302 |
| 38 | 3300049577 | Ga0501041_0016084 | Ga0501041_0016084_196_1104 | 302 |
| 39 | 3300049578 | Ga0501042_0011612 | Ga0501042_0011612_3965_4873 | 302 |
| 40 | 3300049579 | Ga0501043_0090962 | Ga0501043_0090962_1045_1953 | 302 |
| 41 | 3300049580 | Ga0501046_0006008 | Ga0501046_0006008_9527_10435 | 302 |
| 42 | 3300049582 | Ga0501048_0058171 | Ga0501048_0058171_357_1265 | 302 |
| 43 | 3300049585 | Ga0501069_0006694 | Ga0501069_0006694_1745_2653 | 302 |
| 44 | 3300049586 | Ga0501070_0028642 | Ga0501070_0028642_3549_4457 | 302 |
| 45 | 3300049587 | Ga0501071_0000721 | Ga0501071_0000721_923_1831 | 302 |
| 46 | 3300049588 | Ga0501072_0000861 | Ga0501072_0000861_17274_18182 | 302 |
| 47 | 3300049592 | Ga0501076_0001451 | Ga0501076_0001451_10838_11746 | 302 |
| 48 | 3300049593 | Ga0501077_0083461 | Ga0501077_0083461_987_1895 | 302 |
| 49 | 3300049741 | Ga0501079_0004891 | Ga0501079_0004891_3411_4319 | 302 |
| 50 | 3300049742 | Ga0501080_0006646 | Ga0501080_0006646_5530_6438 | 302 |
| 51 | 3300049743 | Ga0501081_0014926 | Ga0501081_0014926_641_1549 | 302 |
| 52 | 3300049744 | Ga0501083_0043053 | Ga0501083_0043053_1428_2336 | 302 |
| 53 | 3300049822 | Ga0501035_0016708 | Ga0501035_0016708_2321_3229 | 302 |
| 54 | 3300054114 | Ga0501084_0014280 | Ga0501084_0014280_4174_5082 | 302 |
| 55 | 3300060353 | Ga0501082_0006568 | Ga0501082_0006568_3576_4484 | 302 |
| 56 | 3300061734 | Ga0530510_0009466 | Ga0530510_0009466_5495_6403 | 302 |
| 57 | 3300005577 | Ga0068857_100065380 | Ga0068857_1000653802 | 303 |
| 58 | 3300026116 | Ga0207674_10054549 | Ga0207674_100545494 | 303 |
| 59 | 3300044842 | Ga0466957_0074080 | Ga0466957_0074080_17_1021 | 303 |
| 60 | 3300046690 | Ga0495624_0000417 | Ga0495624_0000417_20431_21441 | 303 |
| 61 | 3300048923 | Ga0496120_0024368 | Ga0496120_0024368_2390_3394 | 303 |
| 62 | 3300005614 | Ga0068856_100004032 | Ga0068856_1000040322 | 304 |
| 63 | 3300026078 | Ga0207702_10000637 | Ga0207702_1000063717 | 304 |
| 64 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_257281_258288 | 304 |
| 65 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_217511_218518 | 304 |
| 66 | 3300005564 | Ga0070664_100214497 | Ga0070664_1002144972 | 305 |
| 67 | 3300009101 | Ga0105247_10155661 | Ga0105247_101556612 | 305 |
| 68 | 3300025944 | Ga0207661_10002110 | Ga0207661_1000211011 | 305 |
| 69 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_185868_186878 | 305 |
| 70 | 3300046681 | Ga0495647_0008133 | Ga0495647_0008133_19_1029 | 305 |
| 71 | 3300048905 | Ga0496102_0058720 | Ga0496102_0058720_1354_2361 | 305 |
| 72 | 3300048911 | Ga0496108_0003280 | Ga0496108_0003280_6452_7462 | 305 |
| 73 | 3300048912 | Ga0496109_0000348 | Ga0496109_0000348_26097_27107 | 305 |
| 74 | 3300005338 | Ga0068868_100002016 | Ga0068868_10000201611 | 306 |
| 75 | 3300005347 | Ga0070668_100014733 | Ga0070668_1000147338 | 306 |
| 76 | 3300013297 | Ga0157378_10003241 | Ga0157378_100032413 | 306 |
| 77 | 3300026023 | Ga0207677_10001038 | Ga0207677_1000103814 | 306 |
| 78 | 3300045976 | Ga0466967_0007296 | Ga0466967_0007296_2760_3764 | 306 |
| 79 | 3300005347 | Ga0070668_100012531 | Ga0070668_1000125316 | 307 |
| 80 | 3300005367 | Ga0070667_100000603 | Ga0070667_10000060316 | 307 |
| 81 | 3300005843 | Ga0068860_100085754 | Ga0068860_1000857542 | 307 |
| 82 | 3300005844 | Ga0068862_100002782 | Ga0068862_1000027825 | 307 |
| 83 | 3300005937 | Ga0081455_10010756 | Ga0081455_100107567 | 307 |
| 84 | 3300009553 | Ga0105249_10003360 | Ga0105249_100033603 | 307 |
| 85 | 3300014968 | Ga0157379_10148336 | Ga0157379_101483362 | 307 |
| 86 | 3300025961 | Ga0207712_10075298 | Ga0207712_100752982 | 307 |
| 87 | 3300025986 | Ga0207658_10003551 | Ga0207658_100035515 | 307 |
| 88 | 3300026067 | Ga0207678_10228064 | Ga0207678_102280641 | 307 |
| 89 | 3300028380 | Ga0268265_10002889 | Ga0268265_1000288915 | 307 |
| 90 | 3300028381 | Ga0268264_10222234 | Ga0268264_102222342 | 307 |
| 91 | 3300048905 | Ga0496102_0279465 | Ga0496102_0279465_184_1185 | 307 |
| 92 | 3300049584 | Ga0501068_0135433 | Ga0501068_0135433_148_1125 | 307 |
| 93 | 3300049591 | Ga0501075_0369303 | Ga0501075_0369303_13_990 | 307 |
| 94 | 3300060353 | Ga0501082_0122044 | Ga0501082_0122044_432_1409 | 307 |
| 95 | 3300009148 | Ga0105243_10007118 | Ga0105243_100071189 | 308 |
| 96 | 3300025935 | Ga0207709_10005457 | Ga0207709_100054571 | 308 |
| 97 | 3300046536 | Ga0495587_0003966 | Ga0495587_0003966_840_1847 | 308 |
| 98 | 3300005985 | Ga0081539_10003483 | Ga0081539_1000348316 | 309 |
| 99 | 3300049588 | Ga0501072_0030329 | Ga0501072_0030329_625_1638 | 309 |
| 100 | 3300005335 | Ga0070666_10005854 | Ga0070666_100058542 | 311 |
| 101 | 3300028379 | Ga0268266_10001254 | Ga0268266_1000125428 | 311 |
| 102 | 3300046543 | Ga0495645_0027447 | Ga0495645_0027447_2590_3597 | 311 |
| 103 | 3300048927 | Ga0496124_0051640 | Ga0496124_0051640_2305_3309 | 311 |
| 104 | 3300005549 | Ga0070704_100062477 | Ga0070704_1000624773 | 312 |
| 105 | 3300048922 | Ga0496119_0104486 | Ga0496119_0104486_212_1219 | 312 |
| 106 | 3300050490 | nmdc:mga03n38_41860_c1 | nmdc:mga03n38_41860_c1_492_1481 | 312 |
| 107 | 3300005356 | Ga0070674_100124738 | Ga0070674_1001247382 | 313 |
| 108 | 3300009147 | Ga0114129_10001353 | Ga0114129_1000135322 | 313 |
| 109 | 3300013308 | Ga0157375_10436619 | Ga0157375_104366192 | 313 |
| 110 | 3300025937 | Ga0207669_10178961 | Ga0207669_101789612 | 313 |
| 111 | 3300025945 | Ga0207679_10215838 | Ga0207679_102158382 | 313 |
| 112 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_111627_112634 | 313 |
| 113 | 3300047469 | Ga0495673_0072568 | Ga0495673_0072568_90_1091 | 313 |
| 114 | 3300003323 | rootH1_10002124 | rootH1_100021244 | 314 |
| 115 | 3300005364 | Ga0070673_100006402 | Ga0070673_1000064025 | 314 |
| 116 | 3300005985 | Ga0081539_10000878 | Ga0081539_100008788 | 314 |
| 117 | 3300013104 | Ga0157370_10047400 | Ga0157370_100474004 | 314 |
| 118 | 3300049575 | Ga0501039_0173382 | Ga0501039_0173382_148_1101 | 314 |
| 119 | 3300060353 | Ga0501082_0091634 | Ga0501082_0091634_1273_2265 | 314 |
| 120 | 3300048907 | Ga0496104_0049764 | Ga0496104_0049764_1654_2658 | 315 |
| 121 | 3300048922 | Ga0496119_0066967 | Ga0496119_0066967_671_1675 | 315 |
| 122 | 3300005354 | Ga0070675_100000036 | Ga0070675_10000003671 | 316 |
| 123 | 3300005981 | Ga0081538_10000812 | Ga0081538_1000081236 | 316 |
| 124 | 3300009147 | Ga0114129_10112386 | Ga0114129_101123864 | 316 |
| 125 | 3300025926 | Ga0207659_10000013 | Ga0207659_1000001389 | 316 |
| 126 | 3300046533 | Ga0495640_0091728 | Ga0495640_0091728_266_1273 | 316 |
| 127 | 3300046660 | Ga0495625_0076676 | Ga0495625_0076676_956_1960 | 316 |
| 128 | 3300047319 | Ga0495674_0000030 | Ga0495674_0000030_9983_10990 | 316 |
| 129 | 3300047472 | Ga0495686_0097769 | Ga0495686_0097769_433_1440 | 316 |
| 130 | 3300048925 | Ga0496122_0041994 | Ga0496122_0041994_109_1098 | 316 |
| 131 | 3300050507 | nmdc:mga05p37_70480_c1 | nmdc:mga05p37_70480_c1_1091_2092 | 316 |
| 132 | 3300053104 | Ga0500556_0000723 | Ga0500556_0000723_11186_12175 | 316 |
| 133 | 3300053153 | Ga0500616_0003272 | Ga0500616_0003272_7617_8606 | 316 |
| 134 | 3300001979 | JGI24740J21852_10010068 | JGI24740J21852_100100684 | 317 |
| 135 | 3300006847 | Ga0075431_100072846 | Ga0075431_1000728462 | 317 |
| 136 | 3300006871 | Ga0075434_100027126 | Ga0075434_1000271264 | 317 |
| 137 | 3300006914 | Ga0075436_100079950 | Ga0075436_1000799502 | 317 |
| 138 | 3300009094 | Ga0111539_10070367 | Ga0111539_100703672 | 317 |
| 139 | 3300013297 | Ga0157378_10040737 | Ga0157378_100407374 | 317 |
| 140 | 3300038443 | Ga0395901_0053141 | Ga0395901_0053141_2525_3526 | 317 |
| 141 | 3300049575 | Ga0501039_0355897 | Ga0501039_0355897_61_1062 | 317 |
| 142 | 3300050511 | nmdc:mga08y16_94149_c1 | nmdc:mga08y16_94149_c1_1261_2259 | 317 |
| 143 | 3300050515 | nmdc:mga0a205_15449_c1 | nmdc:mga0a205_15449_c1_1958_2956 | 317 |
| 144 | 3300011119 | Ga0105246_10107799 | Ga0105246_101077993 | 318 |
| 145 | 3300031727 | Ga0316576_10015088 | Ga0316576_100150885 | 318 |
| 146 | 3300036712 | Ga0316584_0001782 | Ga0316584_0001782_1606_2616 | 318 |
| 147 | 3300006038 | Ga0075365_10230635 | Ga0075365_102306351 | 319 |
| 148 | 3300005985 | Ga0081539_10024074 | Ga0081539_100240744 | 320 |
| 149 | 3300006871 | Ga0075434_100043274 | Ga0075434_1000432742 | 320 |
| 150 | 3300048904 | Ga0496101_0211132 | Ga0496101_0211132_333_1340 | 320 |
| 151 | 3300048905 | Ga0496102_0340303 | Ga0496102_0340303_361_1368 | 320 |
| 152 | 3300048912 | Ga0496109_0000942 | Ga0496109_0000942_14962_15963 | 320 |
| 153 | 3300048912 | Ga0496109_0039321 | Ga0496109_0039321_2841_3809 | 320 |
| 154 | 3300048913 | Ga0496110_0102704 | Ga0496110_0102704_221_1189 | 320 |
| 155 | 3300048915 | Ga0496112_0409451 | Ga0496112_0409451_302_1270 | 320 |
| 156 | 3300050512 | nmdc:mga0n895_326505_c1 | nmdc:mga0n895_326505_c1_79_1086 | 320 |
| 157 | 3300050515 | nmdc:mga0a205_142921_c1 | nmdc:mga0a205_142921_c1_195_1202 | 320 |
| 158 | 3300005341 | Ga0070691_10000524 | Ga0070691_1000052411 | 321 |
| 159 | 3300005356 | Ga0070674_100000012 | Ga0070674_10000001232 | 321 |
| 160 | 3300005547 | Ga0070693_100003731 | Ga0070693_1000037315 | 321 |
| 161 | 3300009098 | Ga0105245_10001311 | Ga0105245_1000131123 | 321 |
| 162 | 3300009147 | Ga0114129_10692375 | Ga0114129_106923751 | 321 |
| 163 | 3300025899 | Ga0207642_10000080 | Ga0207642_1000008014 | 321 |
| 164 | 3300025927 | Ga0207687_10000032 | Ga0207687_1000003218 | 321 |
| 165 | 3300025937 | Ga0207669_10000017 | Ga0207669_1000001717 | 321 |
| 166 | 3300031903 | Ga0307407_10038141 | Ga0307407_100381412 | 321 |
| 167 | 3300046511 | Ga0495608_0094331 | Ga0495608_0094331_778_1779 | 321 |
| 168 | 3300046684 | Ga0495669_0000113 | Ga0495669_0000113_27747_28748 | 321 |
| 169 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_62778_63779 | 321 |
| 170 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_62778_63779 | 321 |
| 171 | 3300048909 | Ga0496106_0000121 | Ga0496106_0000121_32679_33680 | 321 |
| 172 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_33927_34928 | 321 |
| 173 | 3300048915 | Ga0496112_0282194 | Ga0496112_0282194_41_1012 | 321 |
| 174 | 3300049592 | Ga0501076_0029982 | Ga0501076_0029982_946_1953 | 321 |
| 175 | 3300005535 | Ga0070684_100052595 | Ga0070684_1000525954 | 322 |
| 176 | 3300005578 | Ga0068854_100001203 | Ga0068854_10000120316 | 322 |
| 177 | 3300005614 | Ga0068856_100250189 | Ga0068856_1002501892 | 322 |
| 178 | 3300005834 | Ga0068851_10001260 | Ga0068851_100012602 | 322 |
| 179 | 3300005937 | Ga0081455_10049005 | Ga0081455_100490053 | 322 |
| 180 | 3300009553 | Ga0105249_10000143 | Ga0105249_1000014372 | 322 |
| 181 | 3300025321 | Ga0207656_10000226 | Ga0207656_1000022613 | 322 |
| 182 | 3300025961 | Ga0207712_10000058 | Ga0207712_10000058122 | 322 |
| 183 | 3300025981 | Ga0207640_10000093 | Ga0207640_1000009327 | 322 |
| 184 | 3300044694 | Ga0466963_0000017 | Ga0466963_0000017_22897_23901 | 322 |
| 185 | 3300046455 | Ga0495603_0001350 | Ga0495603_0001350_10178_11173 | 322 |
| 186 | 3300046683 | Ga0495658_0019725 | Ga0495658_0019725_2373_3380 | 322 |
| 187 | 3300048907 | Ga0496104_0000052 | Ga0496104_0000052_26777_27781 | 322 |
| 188 | 3300048908 | Ga0496105_0000030 | Ga0496105_0000030_109545_110549 | 322 |
| 189 | 3300048908 | Ga0496105_0027673 | Ga0496105_0027673_159_1166 | 322 |
| 190 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_344519_345523 | 322 |
| 191 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_111607_112611 | 322 |
| 192 | 3300048913 | Ga0496110_0002164 | Ga0496110_0002164_6227_7234 | 322 |
| 193 | 3300048914 | Ga0496111_0000044 | Ga0496111_0000044_30153_31160 | 322 |
| 194 | 3300050514 | nmdc:mga08x19_126213_c1 | nmdc:mga08x19_126213_c1_410_1414 | 322 |
| 195 | 3300053085 | Ga0495619_0000102 | Ga0495619_0000102_46070_47077 | 322 |
| 196 | 3300005333 | Ga0070677_10000008 | Ga0070677_1000000877 | 323 |
| 197 | 3300005338 | Ga0068868_100000141 | Ga0068868_10000014139 | 323 |
| 198 | 3300005344 | Ga0070661_100000099 | Ga0070661_1000000998 | 323 |
| 199 | 3300005441 | Ga0070700_100283756 | Ga0070700_1002837561 | 323 |
| 200 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002227 | 323 |
| 201 | 3300005458 | Ga0070681_10084184 | Ga0070681_100841842 | 323 |
| 202 | 3300005466 | Ga0070685_10000674 | Ga0070685_1000067411 | 323 |
| 203 | 3300005530 | Ga0070679_100005826 | Ga0070679_10000582611 | 323 |
| 204 | 3300005539 | Ga0068853_100083524 | Ga0068853_1000835241 | 323 |
| 205 | 3300005548 | Ga0070665_100000135 | Ga0070665_10000013521 | 323 |
| 206 | 3300005548 | Ga0070665_100081770 | Ga0070665_1000817703 | 323 |
| 207 | 3300005578 | Ga0068854_100056337 | Ga0068854_1000563373 | 323 |
| 208 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015197 | 323 |
| 209 | 3300005841 | Ga0068863_100000022 | Ga0068863_10000002269 | 323 |
| 210 | 3300006852 | Ga0075433_10033900 | Ga0075433_100339002 | 323 |
| 211 | 3300009098 | Ga0105245_10000415 | Ga0105245_100004156 | 323 |
| 212 | 3300009101 | Ga0105247_10001706 | Ga0105247_1000170613 | 323 |
| 213 | 3300009176 | Ga0105242_10000653 | Ga0105242_1000065317 | 323 |
| 214 | 3300013104 | Ga0157370_10003254 | Ga0157370_1000325414 | 323 |
| 215 | 3300014325 | Ga0163163_10113198 | Ga0163163_101131983 | 323 |
| 216 | 3300014326 | Ga0157380_10000236 | Ga0157380_100002362 | 323 |
| 217 | 3300017792 | Ga0163161_10000053 | Ga0163161_10000053121 | 323 |
| 218 | 3300025893 | Ga0207682_10010613 | Ga0207682_100106132 | 323 |
| 219 | 3300025900 | Ga0207710_10000157 | Ga0207710_1000015766 | 323 |
| 220 | 3300025915 | Ga0207693_10103235 | Ga0207693_101032353 | 323 |
| 221 | 3300025920 | Ga0207649_10000127 | Ga0207649_1000012763 | 323 |
| 222 | 3300025921 | Ga0207652_10001733 | Ga0207652_1000173311 | 323 |
| 223 | 3300025927 | Ga0207687_10000460 | Ga0207687_100004603 | 323 |
| 224 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001408 | 323 |
| 225 | 3300025934 | Ga0207686_10000921 | Ga0207686_100009218 | 323 |
| 226 | 3300025944 | Ga0207661_10004460 | Ga0207661_100044603 | 323 |
| 227 | 3300025981 | Ga0207640_10034577 | Ga0207640_100345773 | 323 |
| 228 | 3300026041 | Ga0207639_10005999 | Ga0207639_100059993 | 323 |
| 229 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016190 | 323 |
| 230 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018103 | 323 |
| 231 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056170 | 323 |
| 232 | 3300035172 | Ga0373955_0147652 | Ga0373955_0147652_59_1066 | 323 |
| 233 | 3300046454 | Ga0495592_0000607 | Ga0495592_0000607_21106_22113 | 323 |
| 234 | 3300046455 | Ga0495603_0000286 | Ga0495603_0000286_17885_18892 | 323 |
| 235 | 3300046459 | Ga0495629_0000245 | Ga0495629_0000245_36167_37177 | 323 |
| 236 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_181447_182454 | 323 |
| 237 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_22578_23585 | 323 |
| 238 | 3300046514 | Ga0495618_0167218 | Ga0495618_0167218_161_1168 | 323 |
| 239 | 3300046515 | Ga0495620_0000784 | Ga0495620_0000784_2265_3272 | 323 |
| 240 | 3300046516 | Ga0495628_0023790 | Ga0495628_0023790_174_1181 | 323 |
| 241 | 3300046523 | Ga0495644_0001871 | Ga0495644_0001871_1816_2823 | 323 |
| 242 | 3300046535 | Ga0495586_0003054 | Ga0495586_0003054_7869_8876 | 323 |
| 243 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_64176_65183 | 323 |
| 244 | 3300046615 | Ga0495656_0000465 | Ga0495656_0000465_5817_6824 | 323 |
| 245 | 3300046616 | Ga0495668_0041252 | Ga0495668_0041252_1043_2050 | 323 |
| 246 | 3300046642 | Ga0495634_0000028 | Ga0495634_0000028_7487_8494 | 323 |
| 247 | 3300046660 | Ga0495625_0000349 | Ga0495625_0000349_52013_53020 | 323 |
| 248 | 3300046663 | Ga0495635_0000076 | Ga0495635_0000076_3435_4442 | 323 |
| 249 | 3300046675 | Ga0495657_0017364 | Ga0495657_0017364_2974_3981 | 323 |
| 250 | 3300046678 | Ga0495599_0036072 | Ga0495599_0036072_557_1564 | 323 |
| 251 | 3300046680 | Ga0495646_0106600 | Ga0495646_0106600_197_1204 | 323 |
| 252 | 3300046690 | Ga0495624_0033290 | Ga0495624_0033290_879_1886 | 323 |
| 253 | 3300046694 | Ga0495649_0002403 | Ga0495649_0002403_4163_5170 | 323 |
| 254 | 3300047322 | Ga0495680_0000143 | Ga0495680_0000143_7551_8558 | 323 |
| 255 | 3300047322 | Ga0495680_0001430 | Ga0495680_0001430_4113_5120 | 323 |
| 256 | 3300048088 | Ga0495602_0001031 | Ga0495602_0001031_16550_17557 | 323 |
| 257 | 3300048909 | Ga0496106_0004512 | Ga0496106_0004512_8063_9070 | 323 |
| 258 | 3300048912 | Ga0496109_0003361 | Ga0496109_0003361_7884_8891 | 323 |
| 259 | 3300049578 | Ga0501042_0252330 | Ga0501042_0252330_186_1193 | 323 |
| 260 | 3300050515 | nmdc:mga0a205_43_c1 | nmdc:mga0a205_43_c1_44367_45374 | 323 |
| 261 | 3300053077 | Ga0495601_0000060 | Ga0495601_0000060_29428_30435 | 323 |
| 262 | 3300053077 | Ga0495601_0200353 | Ga0495601_0200353_74_1081 | 323 |
| 263 | 3300053078 | Ga0495612_0003484 | Ga0495612_0003484_3636_4646 | 323 |
| 264 | 3300053078 | Ga0495612_0005082 | Ga0495612_0005082_373_1383 | 323 |
| 265 | 3300053084 | Ga0495595_0000045 | Ga0495595_0000045_24003_25010 | 323 |
| 266 | 3300053085 | Ga0495619_0000008 | Ga0495619_0000008_190230_191237 | 323 |
| 267 | 3300053096 | Ga0500641_0001622 | Ga0500641_0001622_6129_7136 | 323 |
| 268 | 3300053123 | Ga0500614_001424 | Ga0500614_001424_346_1353 | 323 |
| 269 | 3300001977 | JGI24746J21847_1000760 | JGI24746J21847_10007605 | 324 |
| 270 | 3300005331 | Ga0070670_100073330 | Ga0070670_1000733302 | 324 |
| 271 | 3300005365 | Ga0070688_100000071 | Ga0070688_10000007139 | 324 |
| 272 | 3300005439 | Ga0070711_100008252 | Ga0070711_1000082524 | 324 |
| 273 | 3300005466 | Ga0070685_10000020 | Ga0070685_1000002074 | 324 |
| 274 | 3300005543 | Ga0070672_100000001 | Ga0070672_10000000199 | 324 |
| 275 | 3300005614 | Ga0068856_100266325 | Ga0068856_1002663252 | 324 |
| 276 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002247 | 324 |
| 277 | 3300009098 | Ga0105245_10000278 | Ga0105245_100002789 | 324 |
| 278 | 3300009551 | Ga0105238_10000055 | Ga0105238_1000005519 | 324 |
| 279 | 3300013102 | Ga0157371_10001577 | Ga0157371_100015772 | 324 |
| 280 | 3300013104 | Ga0157370_10269346 | Ga0157370_102693462 | 324 |
| 281 | 3300013105 | Ga0157369_10000074 | Ga0157369_1000007428 | 324 |
| 282 | 3300013105 | Ga0157369_10276762 | Ga0157369_102767622 | 324 |
| 283 | 3300013296 | Ga0157374_10000486 | Ga0157374_1000048617 | 324 |
| 284 | 3300013307 | Ga0157372_10000053 | Ga0157372_1000005327 | 324 |
| 285 | 3300014969 | Ga0157376_10027214 | Ga0157376_100272144 | 324 |
| 286 | 3300025924 | Ga0207694_10000063 | Ga0207694_10000063122 | 324 |
| 287 | 3300025925 | Ga0207650_10091138 | Ga0207650_100911382 | 324 |
| 288 | 3300025927 | Ga0207687_10000036 | Ga0207687_10000036122 | 324 |
| 289 | 3300025927 | Ga0207687_10003112 | Ga0207687_100031123 | 324 |
| 290 | 3300025940 | Ga0207691_10000017 | Ga0207691_1000001726 | 324 |
| 291 | 3300026078 | Ga0207702_10223666 | Ga0207702_102236662 | 324 |
| 292 | 3300026142 | Ga0207698_10000004 | Ga0207698_1000000438 | 324 |
| 293 | 3300028556 | Ga0265337_1000066 | Ga0265337_100006619 | 324 |
| 294 | 3300028558 | Ga0265326_10000019 | Ga0265326_10000019139 | 324 |
| 295 | 3300028563 | Ga0265319_1000469 | Ga0265319_100046921 | 324 |
| 296 | 3300028654 | Ga0265322_10000011 | Ga0265322_10000011139 | 324 |
| 297 | 3300028800 | Ga0265338_10000244 | Ga0265338_1000024489 | 324 |
| 298 | 3300029957 | Ga0265324_10000283 | Ga0265324_1000028321 | 324 |
| 299 | 3300031238 | Ga0265332_10061866 | Ga0265332_100618662 | 324 |
| 300 | 3300031239 | Ga0265328_10000737 | Ga0265328_1000073716 | 324 |
| 301 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011139 | 324 |
| 302 | 3300031242 | Ga0265329_10016232 | Ga0265329_100162322 | 324 |
| 303 | 3300031250 | Ga0265331_10000858 | Ga0265331_1000085817 | 324 |
| 304 | 3300031250 | Ga0265331_10047145 | Ga0265331_100471451 | 324 |
| 305 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015247 | 324 |
| 306 | 3300031344 | Ga0265316_10047188 | Ga0265316_100471882 | 324 |
| 307 | 3300031711 | Ga0265314_10000640 | Ga0265314_1000064038 | 324 |
| 308 | 3300037466 | Ga0395898_0235746 | Ga0395898_0235746_272_1270 | 324 |
| 309 | 3300044842 | Ga0466957_0001414 | Ga0466957_0001414_7153_8160 | 324 |
| 310 | 3300045836 | Ga0466958_0010414 | Ga0466958_0010414_590_1597 | 324 |
| 311 | 3300045976 | Ga0466967_0000001 | Ga0466967_0000001_116642_117649 | 324 |
| 312 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_74697_75704 | 324 |
| 313 | 3300046476 | Ga0495662_0000848 | Ga0495662_0000848_10763_11770 | 324 |
| 314 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_123886_124893 | 324 |
| 315 | 3300046517 | Ga0495630_0000533 | Ga0495630_0000533_5691_6698 | 324 |
| 316 | 3300046517 | Ga0495630_0003407 | Ga0495630_0003407_6317_7324 | 324 |
| 317 | 3300046642 | Ga0495634_0113592 | Ga0495634_0113592_473_1480 | 324 |
| 318 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_256032_257039 | 324 |
| 319 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_107067_108074 | 324 |
| 320 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_198303_199310 | 324 |
| 321 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_103457_104464 | 324 |
| 322 | 3300046690 | Ga0495624_0000019 | Ga0495624_0000019_101179_102186 | 324 |
| 323 | 3300047317 | Ga0495604_0001251 | Ga0495604_0001251_8221_9231 | 324 |
| 324 | 3300047320 | Ga0495672_0068475 | Ga0495672_0068475_167_1177 | 324 |
| 325 | 3300047444 | Ga0495675_0001421 | Ga0495675_0001421_7661_8668 | 324 |
| 326 | 3300048907 | Ga0496104_0000765 | Ga0496104_0000765_24586_25593 | 324 |
| 327 | 3300048908 | Ga0496105_0000409 | Ga0496105_0000409_11726_12733 | 324 |
| 328 | 3300053077 | Ga0495601_0025379 | Ga0495601_0025379_391_1398 | 324 |
| 329 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_188603_189610 | 324 |
| 330 | 3300053085 | Ga0495619_0000095 | Ga0495619_0000095_5843_6850 | 324 |
| 331 | 3300053085 | Ga0495619_0000195 | Ga0495619_0000195_293_1300 | 324 |
| 332 | 3300053085 | Ga0495619_0000320 | Ga0495619_0000320_13012_14019 | 324 |
| 333 | 3300053085 | Ga0495619_0010358 | Ga0495619_0010358_1816_2823 | 324 |
| 334 | 3300005459 | Ga0068867_100005480 | Ga0068867_10000548011 | 325 |
| 335 | 3300006852 | Ga0075433_10000897 | Ga0075433_100008979 | 325 |
| 336 | 3300006881 | Ga0068865_100000082 | Ga0068865_10000008227 | 325 |
| 337 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020124 | 325 |
| 338 | 3300025938 | Ga0207704_10000184 | Ga0207704_1000018421 | 325 |
| 339 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006252 | 325 |
| 340 | 3300026089 | Ga0207648_10100881 | Ga0207648_101008812 | 325 |
| 341 | 3300049568 | Ga0501031_0192515 | Ga0501031_0192515_247_1239 | 325 |
| 342 | 3300049571 | Ga0501034_0016892 | Ga0501034_0016892_6269_7285 | 325 |
| 343 | 3300049571 | Ga0501034_0200589 | Ga0501034_0200589_185_1201 | 325 |
| 344 | 3300049573 | Ga0501037_0160448 | Ga0501037_0160448_238_1230 | 325 |
| 345 | 3300049575 | Ga0501039_0013344 | Ga0501039_0013344_586_1578 | 325 |
| 346 | 3300049575 | Ga0501039_0152073 | Ga0501039_0152073_254_1246 | 325 |
| 347 | 3300049576 | Ga0501040_0002837 | Ga0501040_0002837_3379_4371 | 325 |
| 348 | 3300049576 | Ga0501040_0090694 | Ga0501040_0090694_697_1692 | 325 |
| 349 | 3300049577 | Ga0501041_0017928 | Ga0501041_0017928_2388_3380 | 325 |
| 350 | 3300049577 | Ga0501041_0227064 | Ga0501041_0227064_14_1006 | 325 |
| 351 | 3300049578 | Ga0501042_0018999 | Ga0501042_0018999_703_1695 | 325 |
| 352 | 3300049579 | Ga0501043_0159126 | Ga0501043_0159126_13_1029 | 325 |
| 353 | 3300049580 | Ga0501046_0079832 | Ga0501046_0079832_1300_2292 | 325 |
| 354 | 3300049582 | Ga0501048_0009218 | Ga0501048_0009218_5941_6933 | 325 |
| 355 | 3300049587 | Ga0501071_0010365 | Ga0501071_0010365_946_1938 | 325 |
| 356 | 3300049588 | Ga0501072_0019616 | Ga0501072_0019616_3382_4374 | 325 |
| 357 | 3300049590 | Ga0501074_0034411 | Ga0501074_0034411_269_1261 | 325 |
| 358 | 3300049590 | Ga0501074_0113146 | Ga0501074_0113146_183_1178 | 325 |
| 359 | 3300049591 | Ga0501075_0007586 | Ga0501075_0007586_3670_4662 | 325 |
| 360 | 3300049591 | Ga0501075_0133564 | Ga0501075_0133564_461_1453 | 325 |
| 361 | 3300049592 | Ga0501076_0003612 | Ga0501076_0003612_1672_2664 | 325 |
| 362 | 3300049592 | Ga0501076_0180083 | Ga0501076_0180083_441_1436 | 325 |
| 363 | 3300049593 | Ga0501077_0030258 | Ga0501077_0030258_1354_2346 | 325 |
| 364 | 3300049742 | Ga0501080_0062326 | Ga0501080_0062326_948_1940 | 325 |
| 365 | 3300049822 | Ga0501035_0079660 | Ga0501035_0079660_1627_2619 | 325 |
| 366 | 3300049822 | Ga0501035_0192751 | Ga0501035_0192751_27_1043 | 325 |
| 367 | 3300049824 | Ga0501045_0011542 | Ga0501045_0011542_3673_4665 | 325 |
| 368 | 3300050507 | nmdc:mga05p37_69258_c1 | nmdc:mga05p37_69258_c1_1615_2607 | 325 |
| 369 | 3300050515 | nmdc:mga0a205_53_c2 | nmdc:mga0a205_53_c2_11357_12364 | 325 |
| 370 | 3300054114 | Ga0501084_0044771 | Ga0501084_0044771_1846_2841 | 325 |
| 371 | 3300060353 | Ga0501082_0297438 | Ga0501082_0297438_101_1093 | 325 |
| 372 | 3300061734 | Ga0530510_0050397 | Ga0530510_0050397_273_1265 | 325 |
| 373 | 3300005937 | Ga0081455_10021412 | Ga0081455_100214124 | 326 |
| 374 | 3300005981 | Ga0081538_10030544 | Ga0081538_100305441 | 326 |
| 375 | 3300006038 | Ga0075365_10018720 | Ga0075365_100187203 | 326 |
| 376 | 3300006038 | Ga0075365_10116029 | Ga0075365_101160292 | 326 |
| 377 | 3300006844 | Ga0075428_100082957 | Ga0075428_1000829572 | 326 |
| 378 | 3300006846 | Ga0075430_100053196 | Ga0075430_1000531964 | 326 |
| 379 | 3300006847 | Ga0075431_100018318 | Ga0075431_10001831810 | 326 |
| 380 | 3300009147 | Ga0114129_10251406 | Ga0114129_102514062 | 326 |
| 381 | 3300049587 | Ga0501071_0169999 | Ga0501071_0169999_560_1567 | 326 |
| 382 | 3300050491 | nmdc:mga00v17_51630_c2 | nmdc:mga00v17_51630_c2_685_1701 | 326 |
| 383 | 3300050492 | nmdc:mga0yw44_97687_c1 | nmdc:mga0yw44_97687_c1_396_1412 | 326 |
| 384 | 3300044693 | Ga0466961_0114035 | Ga0466961_0114035_24_1013 | 327 |
| 385 | 3300044842 | Ga0466957_0125696 | Ga0466957_0125696_50_1039 | 327 |
| 386 | 3300005937 | Ga0081455_10005716 | Ga0081455_100057162 | 328 |
| 387 | 3300005981 | Ga0081538_10008324 | Ga0081538_100083243 | 328 |
| 388 | 3300005981 | Ga0081538_10089786 | Ga0081538_100897861 | 328 |
| 389 | 3300006038 | Ga0075365_10007560 | Ga0075365_100075603 | 328 |
| 390 | 3300009176 | Ga0105242_10417403 | Ga0105242_104174031 | 328 |
| 391 | 3300013306 | Ga0163162_10120085 | Ga0163162_101200852 | 328 |
| 392 | 3300014968 | Ga0157379_10030707 | Ga0157379_100307074 | 328 |
| 393 | 3300044694 | Ga0466963_0285886 | Ga0466963_0285886_65_1063 | 328 |
| 394 | 3300045976 | Ga0466967_0025483 | Ga0466967_0025483_3379_4374 | 328 |
| 395 | 3300046471 | Ga0495650_0000054 | Ga0495650_0000054_124483_125481 | 328 |
| 396 | 3300046516 | Ga0495628_0066303 | Ga0495628_0066303_1763_2776 | 328 |
| 397 | 3300046538 | Ga0495609_0091426 | Ga0495609_0091426_13_1005 | 328 |
| 398 | 3300047673 | Ga0495593_0039645 | Ga0495593_0039645_503_1519 | 328 |
| 399 | 3300048905 | Ga0496102_0010565 | Ga0496102_0010565_1410_2411 | 328 |
| 400 | 3300048919 | Ga0496116_0000848 | Ga0496116_0000848_9741_10742 | 328 |
| 401 | 3300048920 | Ga0496117_0009784 | Ga0496117_0009784_5182_6183 | 328 |
| 402 | 3300048924 | Ga0496121_0013496 | Ga0496121_0013496_4973_5971 | 328 |
| 403 | 3300048927 | Ga0496124_0183177 | Ga0496124_0183177_41_1039 | 328 |
| 404 | 3300048928 | Ga0496125_0071032 | Ga0496125_0071032_491_1492 | 328 |
| 405 | 3300049572 | Ga0501036_0022928 | Ga0501036_0022928_1239_2231 | 328 |
| 406 | 3300049581 | Ga0501047_0010850 | Ga0501047_0010850_5211_6212 | 328 |
| 407 | 3300049744 | Ga0501083_0003895 | Ga0501083_0003895_5619_6620 | 328 |
| 408 | 3300050491 | nmdc:mga00v17_71968_c2 | nmdc:mga00v17_71968_c2_53_1078 | 328 |
| 409 | 3300050492 | nmdc:mga0yw44_589_c1 | nmdc:mga0yw44_589_c1_8953_9978 | 328 |
| 410 | 3300053078 | Ga0495612_0000210 | Ga0495612_0000210_9272_10285 | 328 |
| 411 | 3300053085 | Ga0495619_0053306 | Ga0495619_0053306_1332_2348 | 328 |
| 412 | 3300053153 | Ga0500616_0016529 | Ga0500616_0016529_2091_3089 | 328 |
| 413 | 3300003373 | JGI25407J50210_10007507 | JGI25407J50210_100075072 | 329 |
| 414 | 3300005327 | Ga0070658_10270672 | Ga0070658_102706721 | 329 |
| 415 | 3300005339 | Ga0070660_100003750 | Ga0070660_1000037507 | 329 |
| 416 | 3300005347 | Ga0070668_100035872 | Ga0070668_1000358724 | 329 |
| 417 | 3300005455 | Ga0070663_100001716 | Ga0070663_1000017161 | 329 |
| 418 | 3300005456 | Ga0070678_100061536 | Ga0070678_1000615362 | 329 |
| 419 | 3300005530 | Ga0070679_100021006 | Ga0070679_1000210067 | 329 |
| 420 | 3300005547 | Ga0070693_100167441 | Ga0070693_1001674411 | 329 |
| 421 | 3300005548 | Ga0070665_100005405 | Ga0070665_1000054053 | 329 |
| 422 | 3300005549 | Ga0070704_100146231 | Ga0070704_1001462311 | 329 |
| 423 | 3300005614 | Ga0068856_100157815 | Ga0068856_1001578152 | 329 |
| 424 | 3300005981 | Ga0081538_10000486 | Ga0081538_1000048632 | 329 |
| 425 | 3300005981 | Ga0081538_10025117 | Ga0081538_100251172 | 329 |
| 426 | 3300005983 | Ga0081540_1000706 | Ga0081540_100070626 | 329 |
| 427 | 3300005983 | Ga0081540_1046023 | Ga0081540_10460232 | 329 |
| 428 | 3300005985 | Ga0081539_10008209 | Ga0081539_100082095 | 329 |
| 429 | 3300006163 | Ga0070715_10000021 | Ga0070715_100000215 | 329 |
| 430 | 3300006846 | Ga0075430_100002367 | Ga0075430_10000236710 | 329 |
| 431 | 3300006847 | Ga0075431_100023074 | Ga0075431_1000230743 | 329 |
| 432 | 3300006847 | Ga0075431_100163972 | Ga0075431_1001639722 | 329 |
| 433 | 3300006852 | Ga0075433_10131035 | Ga0075433_101310352 | 329 |
| 434 | 3300009094 | Ga0111539_10100345 | Ga0111539_101003453 | 329 |
| 435 | 3300009098 | Ga0105245_10011891 | Ga0105245_100118914 | 329 |
| 436 | 3300009147 | Ga0114129_10032936 | Ga0114129_100329362 | 329 |
| 437 | 3300009545 | Ga0105237_10408162 | Ga0105237_104081621 | 329 |
| 438 | 3300009553 | Ga0105249_10007747 | Ga0105249_100077472 | 329 |
| 439 | 3300013306 | Ga0163162_10034394 | Ga0163162_100343943 | 329 |
| 440 | 3300013307 | Ga0157372_10148694 | Ga0157372_101486943 | 329 |
| 441 | 3300014326 | Ga0157380_10000016 | Ga0157380_10000016101 | 329 |
| 442 | 3300025905 | Ga0207685_10000054 | Ga0207685_1000005415 | 329 |
| 443 | 3300025909 | Ga0207705_10290817 | Ga0207705_102908171 | 329 |
| 444 | 3300025911 | Ga0207654_10057938 | Ga0207654_100579383 | 329 |
| 445 | 3300025919 | Ga0207657_10004340 | Ga0207657_1000434011 | 329 |
| 446 | 3300025919 | Ga0207657_10015215 | Ga0207657_100152154 | 329 |
| 447 | 3300025921 | Ga0207652_10000321 | Ga0207652_1000032137 | 329 |
| 448 | 3300025921 | Ga0207652_10312844 | Ga0207652_103128442 | 329 |
| 449 | 3300025961 | Ga0207712_10277264 | Ga0207712_102772642 | 329 |
| 450 | 3300025972 | Ga0207668_10071280 | Ga0207668_100712802 | 329 |
| 451 | 3300025981 | Ga0207640_10171236 | Ga0207640_101712361 | 329 |
| 452 | 3300025981 | Ga0207640_10228930 | Ga0207640_102289301 | 329 |
| 453 | 3300025986 | Ga0207658_10023672 | Ga0207658_100236725 | 329 |
| 454 | 3300026067 | Ga0207678_10002224 | Ga0207678_100022247 | 329 |
| 455 | 3300026078 | Ga0207702_10426774 | Ga0207702_104267741 | 329 |
| 456 | 3300026118 | Ga0207675_100043378 | Ga0207675_1000433782 | 329 |
| 457 | 3300027907 | Ga0207428_10065295 | Ga0207428_100652951 | 329 |
| 458 | 3300031548 | Ga0307408_100103118 | Ga0307408_1001031182 | 329 |
| 459 | 3300031731 | Ga0307405_10080241 | Ga0307405_100802412 | 329 |
| 460 | 3300031852 | Ga0307410_10068378 | Ga0307410_100683782 | 329 |
| 461 | 3300031901 | Ga0307406_10014323 | Ga0307406_100143232 | 329 |
| 462 | 3300031901 | Ga0307406_10270804 | Ga0307406_102708041 | 329 |
| 463 | 3300031995 | Ga0307409_100141139 | Ga0307409_1001411392 | 329 |
| 464 | 3300032002 | Ga0307416_100054463 | Ga0307416_1000544633 | 329 |
| 465 | 3300032002 | Ga0307416_100073654 | Ga0307416_1000736542 | 329 |
| 466 | 3300032002 | Ga0307416_100102545 | Ga0307416_1001025451 | 329 |
| 467 | 3300032002 | Ga0307416_100380160 | Ga0307416_1003801602 | 329 |
| 468 | 3300032004 | Ga0307414_10041832 | Ga0307414_100418323 | 329 |
| 469 | 3300032126 | Ga0307415_100004435 | Ga0307415_1000044354 | 329 |
| 470 | 3300032126 | Ga0307415_100027919 | Ga0307415_1000279192 | 329 |
| 471 | 3300032126 | Ga0307415_100095665 | Ga0307415_1000956654 | 329 |
| 472 | 3300035090 | Ga0373949_0009952 | Ga0373949_0009952_835_1842 | 329 |
| 473 | 3300037068 | Ga0373925_0118482 | Ga0373925_0118482_778_1791 | 329 |
| 474 | 3300037418 | Ga0395900_0105892 | Ga0395900_0105892_976_1971 | 329 |
| 475 | 3300037418 | Ga0395900_0223900 | Ga0395900_0223900_798_1805 | 329 |
| 476 | 3300037466 | Ga0395898_0026411 | Ga0395898_0026411_2990_3985 | 329 |
| 477 | 3300037466 | Ga0395898_0092869 | Ga0395898_0092869_20_1030 | 329 |
| 478 | 3300037471 | Ga0395905_0246814 | Ga0395905_0246814_538_1545 | 329 |
| 479 | 3300038443 | Ga0395901_0004095 | Ga0395901_0004095_5545_6540 | 329 |
| 480 | 3300042016 | Ga0439463_010194 | Ga0439463_010194_896_1891 | 329 |
| 481 | 3300042437 | Ga0439444_0016827 | Ga0439444_0016827_212_1207 | 329 |
| 482 | 3300044735 | Ga0466968_0074169 | Ga0466968_0074169_332_1327 | 329 |
| 483 | 3300044901 | Ga0466960_0074615 | Ga0466960_0074615_644_1651 | 329 |
| 484 | 3300045976 | Ga0466967_0010090 | Ga0466967_0010090_505_1512 | 329 |
| 485 | 3300046455 | Ga0495603_0122584 | Ga0495603_0122584_294_1307 | 329 |
| 486 | 3300046473 | Ga0495582_0098596 | Ga0495582_0098596_226_1239 | 329 |
| 487 | 3300046528 | Ga0495642_0081004 | Ga0495642_0081004_49_1062 | 329 |
| 488 | 3300046615 | Ga0495656_0077512 | Ga0495656_0077512_352_1359 | 329 |
| 489 | 3300047321 | Ga0495676_0057606 | Ga0495676_0057606_697_1710 | 329 |
| 490 | 3300048905 | Ga0496102_0145284 | Ga0496102_0145284_650_1666 | 329 |
| 491 | 3300048907 | Ga0496104_0120640 | Ga0496104_0120640_441_1454 | 329 |
| 492 | 3300048909 | Ga0496106_0006748 | Ga0496106_0006748_1473_2489 | 329 |
| 493 | 3300048911 | Ga0496108_0025146 | Ga0496108_0025146_650_1663 | 329 |
| 494 | 3300048911 | Ga0496108_0108936 | Ga0496108_0108936_455_1465 | 329 |
| 495 | 3300048912 | Ga0496109_0057511 | Ga0496109_0057511_1423_2436 | 329 |
| 496 | 3300048913 | Ga0496110_0037796 | Ga0496110_0037796_3138_4148 | 329 |
| 497 | 3300048913 | Ga0496110_0062843 | Ga0496110_0062843_1777_2790 | 329 |
| 498 | 3300048914 | Ga0496111_0025522 | Ga0496111_0025522_1195_2208 | 329 |
| 499 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_112479_113483 | 329 |
| 500 | 3300048916 | Ga0496113_0020234 | Ga0496113_0020234_936_1946 | 329 |
| 501 | 3300048916 | Ga0496113_0024871 | Ga0496113_0024871_862_1875 | 329 |
| 502 | 3300048927 | Ga0496124_0159321 | Ga0496124_0159321_157_1161 | 329 |
| 503 | 3300048929 | Ga0496126_0019594 | Ga0496126_0019594_1014_2018 | 329 |
| 504 | 3300049568 | Ga0501031_0002175 | Ga0501031_0002175_6519_7523 | 329 |
| 505 | 3300049569 | Ga0501032_0011222 | Ga0501032_0011222_4983_5987 | 329 |
| 506 | 3300049570 | Ga0501033_0003689 | Ga0501033_0003689_6510_7514 | 329 |
| 507 | 3300049571 | Ga0501034_0016227 | Ga0501034_0016227_2448_3449 | 329 |
| 508 | 3300049572 | Ga0501036_0114656 | Ga0501036_0114656_79_1074 | 329 |
| 509 | 3300049573 | Ga0501037_0002926 | Ga0501037_0002926_6519_7523 | 329 |
| 510 | 3300049574 | Ga0501038_0005058 | Ga0501038_0005058_6519_7523 | 329 |
| 511 | 3300049575 | Ga0501039_0126956 | Ga0501039_0126956_575_1570 | 329 |
| 512 | 3300049576 | Ga0501040_0153891 | Ga0501040_0153891_326_1321 | 329 |
| 513 | 3300049577 | Ga0501041_0027445 | Ga0501041_0027445_2199_3194 | 329 |
| 514 | 3300049578 | Ga0501042_0012872 | Ga0501042_0012872_639_1643 | 329 |
| 515 | 3300049580 | Ga0501046_0004559 | Ga0501046_0004559_5037_6041 | 329 |
| 516 | 3300049581 | Ga0501047_0004952 | Ga0501047_0004952_4988_5992 | 329 |
| 517 | 3300049581 | Ga0501047_0148155 | Ga0501047_0148155_159_1163 | 329 |
| 518 | 3300049581 | Ga0501047_0176579 | Ga0501047_0176579_670_1674 | 329 |
| 519 | 3300049582 | Ga0501048_0003128 | Ga0501048_0003128_4914_5918 | 329 |
| 520 | 3300049584 | Ga0501068_0002345 | Ga0501068_0002345_1919_2923 | 329 |
| 521 | 3300049585 | Ga0501069_0075472 | Ga0501069_0075472_195_1199 | 329 |
| 522 | 3300049586 | Ga0501070_0004064 | Ga0501070_0004064_5053_6057 | 329 |
| 523 | 3300049587 | Ga0501071_0056805 | Ga0501071_0056805_556_1551 | 329 |
| 524 | 3300049587 | Ga0501071_0132089 | Ga0501071_0132089_806_1810 | 329 |
| 525 | 3300049588 | Ga0501072_0017464 | Ga0501072_0017464_2139_3143 | 329 |
| 526 | 3300049588 | Ga0501072_0043596 | Ga0501072_0043596_1301_2296 | 329 |
| 527 | 3300049589 | Ga0501073_0012127 | Ga0501073_0012127_4759_5763 | 329 |
| 528 | 3300049590 | Ga0501074_0018921 | Ga0501074_0018921_2672_3676 | 329 |
| 529 | 3300049592 | Ga0501076_0048517 | Ga0501076_0048517_1468_2463 | 329 |
| 530 | 3300049741 | Ga0501079_0080440 | Ga0501079_0080440_1334_2338 | 329 |
| 531 | 3300049742 | Ga0501080_0030783 | Ga0501080_0030783_3457_4461 | 329 |
| 532 | 3300049743 | Ga0501081_0025371 | Ga0501081_0025371_397_1392 | 329 |
| 533 | 3300049744 | Ga0501083_0002614 | Ga0501083_0002614_4890_5894 | 329 |
| 534 | 3300049822 | Ga0501035_0005116 | Ga0501035_0005116_4898_5902 | 329 |
| 535 | 3300049823 | Ga0501044_0006919 | Ga0501044_0006919_4961_5965 | 329 |
| 536 | 3300049824 | Ga0501045_0011031 | Ga0501045_0011031_4764_5759 | 329 |
| 537 | 3300050507 | nmdc:mga05p37_114066_c1 | nmdc:mga05p37_114066_c1_894_1886 | 329 |
| 538 | 3300050507 | nmdc:mga05p37_51957_c1 | nmdc:mga05p37_51957_c1_3488_4480 | 329 |
| 539 | 3300050509 | nmdc:mga0qj67_26043_c1 | nmdc:mga0qj67_26043_c1_2818_3810 | 329 |
| 540 | 3300050509 | nmdc:mga0qj67_6768_c1 | nmdc:mga0qj67_6768_c1_3590_4606 | 329 |
| 541 | 3300050510 | nmdc:mga06r32_20441_c1 | nmdc:mga06r32_20441_c1_3710_4726 | 329 |
| 542 | 3300050511 | nmdc:mga08y16_130720_c1 | nmdc:mga08y16_130720_c1_986_1978 | 329 |
| 543 | 3300050512 | nmdc:mga0n895_209759_c1 | nmdc:mga0n895_209759_c1_627_1634 | 329 |
| 544 | 3300060353 | Ga0501082_0081193 | Ga0501082_0081193_202_1197 | 329 |
| 545 | 3300060353 | Ga0501082_0355486 | Ga0501082_0355486_112_1107 | 329 |
| 546 | 3300002074 | JGI24748J21848_1000727 | JGI24748J21848_10007272 | 330 |
| 547 | 3300002239 | JGI24034J26672_10001507 | JGI24034J26672_100015072 | 330 |
| 548 | 3300002244 | JGI24742J22300_10001453 | JGI24742J22300_100014534 | 330 |
| 549 | 3300003373 | JGI25407J50210_10002254 | JGI25407J50210_100022545 | 330 |
| 550 | 3300005327 | Ga0070658_10159858 | Ga0070658_101598582 | 330 |
| 551 | 3300005329 | Ga0070683_100023077 | Ga0070683_1000230772 | 330 |
| 552 | 3300005336 | Ga0070680_100003235 | Ga0070680_10000323515 | 330 |
| 553 | 3300005337 | Ga0070682_100245968 | Ga0070682_1002459682 | 330 |
| 554 | 3300005338 | Ga0068868_100021155 | Ga0068868_1000211553 | 330 |
| 555 | 3300005339 | Ga0070660_100144134 | Ga0070660_1001441342 | 330 |
| 556 | 3300005341 | Ga0070691_10000044 | Ga0070691_100000448 | 330 |
| 557 | 3300005353 | Ga0070669_100145838 | Ga0070669_1001458382 | 330 |
| 558 | 3300005366 | Ga0070659_100004223 | Ga0070659_1000042233 | 330 |
| 559 | 3300005366 | Ga0070659_100057747 | Ga0070659_1000577473 | 330 |
| 560 | 3300005440 | Ga0070705_100122056 | Ga0070705_1001220561 | 330 |
| 561 | 3300005441 | Ga0070700_100005895 | Ga0070700_1000058954 | 330 |
| 562 | 3300005455 | Ga0070663_100022099 | Ga0070663_1000220992 | 330 |
| 563 | 3300005458 | Ga0070681_10013391 | Ga0070681_1001339111 | 330 |
| 564 | 3300005466 | Ga0070685_10035279 | Ga0070685_100352792 | 330 |
| 565 | 3300005530 | Ga0070679_100023402 | Ga0070679_1000234021 | 330 |
| 566 | 3300005535 | Ga0070684_100042488 | Ga0070684_1000424884 | 330 |
| 567 | 3300005535 | Ga0070684_100043406 | Ga0070684_1000434064 | 330 |
| 568 | 3300005543 | Ga0070672_100059780 | Ga0070672_1000597802 | 330 |
| 569 | 3300005549 | Ga0070704_100216168 | Ga0070704_1002161681 | 330 |
| 570 | 3300005563 | Ga0068855_100294366 | Ga0068855_1002943661 | 330 |
| 571 | 3300005564 | Ga0070664_100013275 | Ga0070664_1000132754 | 330 |
| 572 | 3300005564 | Ga0070664_100058703 | Ga0070664_1000587033 | 330 |
| 573 | 3300005614 | Ga0068856_100026571 | Ga0068856_1000265715 | 330 |
| 574 | 3300005616 | Ga0068852_100007835 | Ga0068852_1000078357 | 330 |
| 575 | 3300005618 | Ga0068864_100043739 | Ga0068864_1000437392 | 330 |
| 576 | 3300005718 | Ga0068866_10000008 | Ga0068866_10000008121 | 330 |
| 577 | 3300005719 | Ga0068861_100152617 | Ga0068861_1001526172 | 330 |
| 578 | 3300005842 | Ga0068858_100093657 | Ga0068858_1000936572 | 330 |
| 579 | 3300005843 | Ga0068860_100011591 | Ga0068860_1000115919 | 330 |
| 580 | 3300005937 | Ga0081455_10059195 | Ga0081455_100591952 | 330 |
| 581 | 3300005937 | Ga0081455_10067266 | Ga0081455_100672661 | 330 |
| 582 | 3300005981 | Ga0081538_10000020 | Ga0081538_10000020100 | 330 |
| 583 | 3300005981 | Ga0081538_10000526 | Ga0081538_1000052636 | 330 |
| 584 | 3300005981 | Ga0081538_10000796 | Ga0081538_1000079626 | 330 |
| 585 | 3300005983 | Ga0081540_1000100 | Ga0081540_10001004 | 330 |
| 586 | 3300006051 | Ga0075364_10107249 | Ga0075364_101072492 | 330 |
| 587 | 3300006844 | Ga0075428_100208639 | Ga0075428_1002086392 | 330 |
| 588 | 3300006844 | Ga0075428_100278885 | Ga0075428_1002788852 | 330 |
| 589 | 3300006846 | Ga0075430_100394196 | Ga0075430_1003941961 | 330 |
| 590 | 3300006847 | Ga0075431_100008439 | Ga0075431_1000084395 | 330 |
| 591 | 3300006847 | Ga0075431_100036502 | Ga0075431_1000365024 | 330 |
| 592 | 3300006852 | Ga0075433_10004260 | Ga0075433_100042607 | 330 |
| 593 | 3300006880 | Ga0075429_100028882 | Ga0075429_1000288825 | 330 |
| 594 | 3300006881 | Ga0068865_100092346 | Ga0068865_1000923462 | 330 |
| 595 | 3300009093 | Ga0105240_10042151 | Ga0105240_100421514 | 330 |
| 596 | 3300009098 | Ga0105245_10180209 | Ga0105245_101802092 | 330 |
| 597 | 3300009147 | Ga0114129_10012393 | Ga0114129_1001239315 | 330 |
| 598 | 3300009176 | Ga0105242_10000449 | Ga0105242_100004492 | 330 |
| 599 | 3300009551 | Ga0105238_10006420 | Ga0105238_1000642012 | 330 |
| 600 | 3300010375 | Ga0105239_10036088 | Ga0105239_100360884 | 330 |
| 601 | 3300011119 | Ga0105246_10037640 | Ga0105246_100376404 | 330 |
| 602 | 3300013105 | Ga0157369_10083922 | Ga0157369_100839222 | 330 |
| 603 | 3300013105 | Ga0157369_10215970 | Ga0157369_102159702 | 330 |
| 604 | 3300013296 | Ga0157374_10004880 | Ga0157374_1000488011 | 330 |
| 605 | 3300013307 | Ga0157372_10323196 | Ga0157372_103231962 | 330 |
| 606 | 3300014745 | Ga0157377_10017479 | Ga0157377_100174792 | 330 |
| 607 | 3300014969 | Ga0157376_10153677 | Ga0157376_101536772 | 330 |
| 608 | 3300020082 | Ga0206353_10154608 | Ga0206353_101546081 | 330 |
| 609 | 3300025321 | Ga0207656_10027875 | Ga0207656_100278753 | 330 |
| 610 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002548 | 330 |
| 611 | 3300025901 | Ga0207688_10004162 | Ga0207688_100041622 | 330 |
| 612 | 3300025912 | Ga0207707_10164307 | Ga0207707_101643072 | 330 |
| 613 | 3300025913 | Ga0207695_10104584 | Ga0207695_101045842 | 330 |
| 614 | 3300025917 | Ga0207660_10013331 | Ga0207660_100133317 | 330 |
| 615 | 3300025921 | Ga0207652_10009748 | Ga0207652_100097482 | 330 |
| 616 | 3300025927 | Ga0207687_10049514 | Ga0207687_100495143 | 330 |
| 617 | 3300025932 | Ga0207690_10023856 | Ga0207690_100238564 | 330 |
| 618 | 3300025934 | Ga0207686_10000097 | Ga0207686_1000009714 | 330 |
| 619 | 3300025937 | Ga0207669_10000026 | Ga0207669_100000268 | 330 |
| 620 | 3300025938 | Ga0207704_10028503 | Ga0207704_100285032 | 330 |
| 621 | 3300025941 | Ga0207711_10101111 | Ga0207711_101011112 | 330 |
| 622 | 3300025944 | Ga0207661_10039531 | Ga0207661_100395311 | 330 |
| 623 | 3300025944 | Ga0207661_10083801 | Ga0207661_100838012 | 330 |
| 624 | 3300025986 | Ga0207658_10137457 | Ga0207658_101374571 | 330 |
| 625 | 3300026023 | Ga0207677_10031049 | Ga0207677_100310492 | 330 |
| 626 | 3300026067 | Ga0207678_10016375 | Ga0207678_100163754 | 330 |
| 627 | 3300026075 | Ga0207708_10014443 | Ga0207708_100144434 | 330 |
| 628 | 3300026078 | Ga0207702_10047334 | Ga0207702_100473345 | 330 |
| 629 | 3300026142 | Ga0207698_10013220 | Ga0207698_100132204 | 330 |
| 630 | 3300026142 | Ga0207698_10191136 | Ga0207698_101911362 | 330 |
| 631 | 3300028379 | Ga0268266_10006356 | Ga0268266_100063563 | 330 |
| 632 | 3300028381 | Ga0268264_10016645 | Ga0268264_100166456 | 330 |
| 633 | 3300028381 | Ga0268264_10059027 | Ga0268264_100590273 | 330 |
| 634 | 3300031731 | Ga0307405_10089558 | Ga0307405_100895582 | 330 |
| 635 | 3300031824 | Ga0307413_10187315 | Ga0307413_101873152 | 330 |
| 636 | 3300031901 | Ga0307406_10113558 | Ga0307406_101135582 | 330 |
| 637 | 3300031911 | Ga0307412_10140447 | Ga0307412_101404472 | 330 |
| 638 | 3300031995 | Ga0307409_100123747 | Ga0307409_1001237472 | 330 |
| 639 | 3300032004 | Ga0307414_10398784 | Ga0307414_103987841 | 330 |
| 640 | 3300032126 | Ga0307415_100144164 | Ga0307415_1001441642 | 330 |
| 641 | 3300037418 | Ga0395900_0346516 | Ga0395900_0346516_261_1259 | 330 |
| 642 | 3300044719 | Ga0466971_0012957 | Ga0466971_0012957_2217_3218 | 330 |
| 643 | 3300046459 | Ga0495629_0005286 | Ga0495629_0005286_6130_7140 | 330 |
| 644 | 3300046461 | Ga0495641_0056121 | Ga0495641_0056121_259_1269 | 330 |
| 645 | 3300046499 | Ga0495594_0000089 | Ga0495594_0000089_32804_33811 | 330 |
| 646 | 3300046500 | Ga0495596_0086850 | Ga0495596_0086850_123_1121 | 330 |
| 647 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_48572_49582 | 330 |
| 648 | 3300046516 | Ga0495628_0251803 | Ga0495628_0251803_13_1035 | 330 |
| 649 | 3300046517 | Ga0495630_0058778 | Ga0495630_0058778_495_1502 | 330 |
| 650 | 3300046517 | Ga0495630_0198928 | Ga0495630_0198928_427_1434 | 330 |
| 651 | 3300046529 | Ga0495652_0000037 | Ga0495652_0000037_19507_20514 | 330 |
| 652 | 3300046529 | Ga0495652_0011995 | Ga0495652_0011995_4051_5061 | 330 |
| 653 | 3300046557 | Ga0495622_0000080 | Ga0495622_0000080_81507_82514 | 330 |
| 654 | 3300046642 | Ga0495634_0001744 | Ga0495634_0001744_10626_11633 | 330 |
| 655 | 3300046674 | Ga0495588_0000362 | Ga0495588_0000362_17901_18911 | 330 |
| 656 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_58435_59442 | 330 |
| 657 | 3300046809 | Ga0495600_0011717 | Ga0495600_0011717_3820_4827 | 330 |
| 658 | 3300047317 | Ga0495604_0000239 | Ga0495604_0000239_6392_7399 | 330 |
| 659 | 3300047321 | Ga0495676_0000827 | Ga0495676_0000827_12268_13290 | 330 |
| 660 | 3300047321 | Ga0495676_0012579 | Ga0495676_0012579_3852_4862 | 330 |
| 661 | 3300047322 | Ga0495680_0022126 | Ga0495680_0022126_2542_3549 | 330 |
| 662 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_148716_149723 | 330 |
| 663 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_421594_422616 | 330 |
| 664 | 3300048903 | Ga0496100_0080822 | Ga0496100_0080822_77_1075 | 330 |
| 665 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_222946_223968 | 330 |
| 666 | 3300048905 | Ga0496102_0000211 | Ga0496102_0000211_7476_8486 | 330 |
| 667 | 3300048905 | Ga0496102_0098230 | Ga0496102_0098230_622_1626 | 330 |
| 668 | 3300048905 | Ga0496102_0109368 | Ga0496102_0109368_324_1322 | 330 |
| 669 | 3300048906 | Ga0496103_0000083 | Ga0496103_0000083_43244_44254 | 330 |
| 670 | 3300048907 | Ga0496104_0017182 | Ga0496104_0017182_3870_4868 | 330 |
| 671 | 3300048908 | Ga0496105_0022580 | Ga0496105_0022580_3498_4496 | 330 |
| 672 | 3300048909 | Ga0496106_0000076 | Ga0496106_0000076_18784_19806 | 330 |
| 673 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_107632_108654 | 330 |
| 674 | 3300048910 | Ga0496107_0041276 | Ga0496107_0041276_2255_3253 | 330 |
| 675 | 3300048911 | Ga0496108_0054035 | Ga0496108_0054035_26_1024 | 330 |
| 676 | 3300048912 | Ga0496109_0070649 | Ga0496109_0070649_45_1043 | 330 |
| 677 | 3300048913 | Ga0496110_0116106 | Ga0496110_0116106_734_1732 | 330 |
| 678 | 3300048914 | Ga0496111_0047291 | Ga0496111_0047291_2056_3054 | 330 |
| 679 | 3300048915 | Ga0496112_0030187 | Ga0496112_0030187_61_1068 | 330 |
| 680 | 3300048915 | Ga0496112_0279281 | Ga0496112_0279281_454_1452 | 330 |
| 681 | 3300048916 | Ga0496113_0000013 | Ga0496113_0000013_25399_26406 | 330 |
| 682 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_27493_28500 | 330 |
| 683 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_106480_107487 | 330 |
| 684 | 3300048918 | Ga0496115_0000377 | Ga0496115_0000377_19613_20620 | 330 |
| 685 | 3300050494 | nmdc:mga06z11_63651_c1 | nmdc:mga06z11_63651_c1_355_1353 | 330 |
| 686 | 3300050507 | nmdc:mga05p37_38150_c1 | nmdc:mga05p37_38150_c1_401_1405 | 330 |
| 687 | 3300050508 | nmdc:mga09592_93327_c1 | nmdc:mga09592_93327_c1_1133_2137 | 330 |
| 688 | 3300050509 | nmdc:mga0qj67_170565_c1 | nmdc:mga0qj67_170565_c1_337_1341 | 330 |
| 689 | 3300050510 | nmdc:mga06r32_180923_c1 | nmdc:mga06r32_180923_c1_237_1235 | 330 |
| 690 | 3300050510 | nmdc:mga06r32_51501_c1 | nmdc:mga06r32_51501_c1_1170_2174 | 330 |
| 691 | 3300050511 | nmdc:mga08y16_454811_c1 | nmdc:mga08y16_454811_c1_127_1119 | 330 |
| 692 | 3300053077 | Ga0495601_0000165 | Ga0495601_0000165_13190_14197 | 330 |
| 693 | 3300053077 | Ga0495601_0057074 | Ga0495601_0057074_62_1069 | 330 |
| 694 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_197651_198661 | 330 |
| 695 | 3300053085 | Ga0495619_0000155 | Ga0495619_0000155_39236_40258 | 330 |
| 696 | 3300053094 | Ga0500566_0001093 | Ga0500566_0001093_7298_8308 | 330 |
| 697 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_286320_287330 | 330 |
| 698 | 3300061719 | Ga0466962_0028029 | Ga0466962_0028029_551_1552 | 330 |
| 699 | 3300000546 | LJNas_1005351 | LJNas_10053512 | 331 |
| 700 | 3300003373 | JGI25407J50210_10019542 | JGI25407J50210_100195422 | 331 |
| 701 | 3300005441 | Ga0070700_100063907 | Ga0070700_1000639072 | 331 |
| 702 | 3300005455 | Ga0070663_100084612 | Ga0070663_1000846122 | 331 |
| 703 | 3300005564 | Ga0070664_100144185 | Ga0070664_1001441852 | 331 |
| 704 | 3300005578 | Ga0068854_100070238 | Ga0068854_1000702381 | 331 |
| 705 | 3300005615 | Ga0070702_100013201 | Ga0070702_1000132011 | 331 |
| 706 | 3300005618 | Ga0068864_100103015 | Ga0068864_1001030152 | 331 |
| 707 | 3300005937 | Ga0081455_10164809 | Ga0081455_101648092 | 331 |
| 708 | 3300005981 | Ga0081538_10018966 | Ga0081538_100189667 | 331 |
| 709 | 3300005985 | Ga0081539_10000740 | Ga0081539_1000074024 | 331 |
| 710 | 3300025901 | Ga0207688_10027092 | Ga0207688_100270922 | 331 |
| 711 | 3300025981 | Ga0207640_10061908 | Ga0207640_100619082 | 331 |
| 712 | 3300026067 | Ga0207678_10125666 | Ga0207678_101256662 | 331 |
| 713 | 3300026075 | Ga0207708_10018028 | Ga0207708_100180282 | 331 |
| 714 | 3300026116 | Ga0207674_10035565 | Ga0207674_100355651 | 331 |
| 715 | 3300026142 | Ga0207698_10305362 | Ga0207698_103053622 | 331 |
| 716 | 3300028379 | Ga0268266_10184601 | Ga0268266_101846011 | 331 |
| 717 | 3300031548 | Ga0307408_100140389 | Ga0307408_1001403892 | 331 |
| 718 | 3300031852 | Ga0307410_10069885 | Ga0307410_100698854 | 331 |
| 719 | 3300031852 | Ga0307410_10166615 | Ga0307410_101666151 | 331 |
| 720 | 3300031903 | Ga0307407_10250570 | Ga0307407_102505701 | 331 |
| 721 | 3300031995 | Ga0307409_100003645 | Ga0307409_1000036453 | 331 |
| 722 | 3300032004 | Ga0307414_10202999 | Ga0307414_102029992 | 331 |
| 723 | 3300032004 | Ga0307414_10291312 | Ga0307414_102913121 | 331 |
| 724 | 3300032005 | Ga0307411_10050006 | Ga0307411_100500063 | 331 |
| 725 | 3300032126 | Ga0307415_100077824 | Ga0307415_1000778243 | 331 |
| 726 | 3300048917 | Ga0496114_0054866 | Ga0496114_0054866_1462_2457 | 331 |
| 727 | 3300049568 | Ga0501031_0032359 | Ga0501031_0032359_1454_2452 | 331 |
| 728 | 3300049573 | Ga0501037_0214085 | Ga0501037_0214085_235_1233 | 331 |
| 729 | 3300049576 | Ga0501040_0283912 | Ga0501040_0283912_31_1029 | 331 |
| 730 | 3300049577 | Ga0501041_0063221 | Ga0501041_0063221_333_1331 | 331 |
| 731 | 3300049587 | Ga0501071_0006091 | Ga0501071_0006091_2450_3448 | 331 |
| 732 | 3300049588 | Ga0501072_0306943 | Ga0501072_0306943_98_1096 | 331 |
| 733 | 3300049591 | Ga0501075_0045069 | Ga0501075_0045069_1506_2504 | 331 |
| 734 | 3300049592 | Ga0501076_0180966 | Ga0501076_0180966_544_1542 | 331 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4egw-assembly1.cif.gz_B | the structure of the soluble domain of cora from methanocaldococcus jannaschii | 0.9016 | 38 | 263 |
| 8slb-assembly1.cif.gz_A | x-ray structure of cora n-terminal domain in complex with conformation-specific synthetic antibody c12 | 0.8567 | 38 | 242 |
| 3nvo-assembly1.cif.gz_A | the soluble domain structure of the zntb zn2+ efflux system | 0.8519 | 38 | 266 |
| 3nvo-assembly2.cif.gz_B-2 | the soluble domain structure of the zntb zn2+ efflux system | 0.8469 | 38 | 262 |
| 5n77-assembly1.cif.gz_E | crystal structure of the cytosolic domain of the cora magnesium channel from escherichia coli in complex with magnesium | 0.8447 | 40 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4i0uJ02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.952 | 147 | 253 | 1.20.58.340 |
| 5jtgD02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9516 | 147 | 253 | 1.20.58.340 |
| 5jtgA02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9509 | 147 | 253 | 1.20.58.340 |
| 2iubA02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9496 | 147 | 253 | 1.20.58.340 |
| 4eebC02 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region | 0.9487 | 147 | 253 | 1.20.58.340 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V5IZC3-F1-model_v4 | Magnesium transporter CorA family protein | 0.9387 | 30 | 259 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A7C0YP30-F1-model_v4 | Magnesium transporter CorA family protein | 0.9225 | 31 | 136 |
GO:0016020
GO:0046873 |
| AF-X1RBR6-F1-model_v4 | Magnesium and cobalt transport protein CorA | 0.9199 | 38 | 182 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A2M6P1Q7-F1-model_v4 | Magnesium transporter CorA | 0.9197 | 30 | 144 |
GO:0000287
GO:0005886 GO:0015087 GO:0015095 GO:0050897 |
| AF-A0A377TWQ5-F1-model_v4 | Mg2+ and Co2+ transporter | 0.9157 | 120 | 269 |
GO:0016020
GO:0046873 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar