F478133

General Info

Members Datasets Scaffolds Average Seq Length
734 329 734 327

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10007560|Ga0075365_100075603
Length 341
Sequence MPNLPKPRLRRAGRARQLVAPAPEPQRKPNVETITAEGLRWVNIERPSPLEAAWLEEQFGFHALDLEDVMSRNQRPKIDEYPEYLFIVLHFPVFDRSVGRLNAGELDMFVGPDYLVTIPNQPLQPVAYLFERCRQKEELREQLFSKGSGFLLYRIIDDAFDYCFPMLRKIGNKLDALEEDIFSGRSEEVVRDIFNVKQEIINFRKISRPQRPVLRDLERTKHRYLVASEGEDLEIYFDDIVDAHERIWDMLENYKEVVEALEETNESVISHRVNDILRVLTSISVIVLPLTLIASIFGMNAGLPGGGDPASASLTTFAIVVGVMFALLVGMVAYFRHRDWL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
324 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.45
Nodule 0
Rhizoplane 9.13
Rhizosphere 86.65
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1005351 3300000546 Bacteria 1403
2 JGI24746J21847_1000760 3300001977 Bacteria 4956
3 JGI24740J21852_10010068 3300001979 Bacteria 3662
4 JGI24748J21848_1000727 3300002074 Bacteria 3562
5 JGI24034J26672_10001507 3300002239 Bacteria 3096
6 JGI24742J22300_10001453 3300002244 Bacteria 3736
7 rootH1_10002124 3300003323 Bacteria 3554
8 JGI25407J50210_10002254 3300003373 Bacteria 4519
9 JGI25407J50210_10007507 3300003373 Bacteria 2732
10 JGI25407J50210_10019542 3300003373 Bacteria 1761
11 Ga0070658_10159858 3300005327 Bacteria 1890
12 Ga0070658_10270672 3300005327 Bacteria 1445
13 Ga0070683_100000404 3300005329 Bacteria 29752
14 Ga0070683_100023077 3300005329 Bacteria 5564
15 Ga0070670_100073330 3300005331 Bacteria 2940
16 Ga0070677_10000008 3300005333 Bacteria 74027
17 Ga0070666_10005854 3300005335 Bacteria 7552
18 Ga0070680_100003235 3300005336 Bacteria 12123
19 Ga0070682_100245968 3300005337 Bacteria 1286
20 Ga0068868_100000141 3300005338 Bacteria 46406
21 Ga0068868_100002016 3300005338 Bacteria 13976
22 Ga0068868_100021155 3300005338 Bacteria 4898
23 Ga0070660_100003750 3300005339 Bacteria 10505
24 Ga0070660_100144134 3300005339 Bacteria 1913
25 Ga0070691_10000044 3300005341 Bacteria 36029
26 Ga0070691_10000524 3300005341 Bacteria 14453
27 Ga0070661_100000099 3300005344 Bacteria 71115
28 Ga0070668_100012531 3300005347 Bacteria 6315
29 Ga0070668_100014733 3300005347 Bacteria 5843
30 Ga0070668_100035872 3300005347 Bacteria 3784
31 Ga0070669_100145838 3300005353 Bacteria 1829
32 Ga0070675_100000036 3300005354 Bacteria 85959
33 Ga0070674_100000012 3300005356 Bacteria 130773
34 Ga0070674_100124738 3300005356 Bacteria 1911
35 Ga0070673_100006402 3300005364 Bacteria 7653
36 Ga0070688_100000071 3300005365 Bacteria 50564
37 Ga0070659_100004223 3300005366 Bacteria 10260
38 Ga0070659_100057747 3300005366 Bacteria 3061
39 Ga0070667_100000603 3300005367 Bacteria 35115
40 Ga0070711_100008252 3300005439 Bacteria 6371
41 Ga0070705_100122056 3300005440 Bacteria 1684
42 Ga0070700_100005895 3300005441 Bacteria 6511
43 Ga0070700_100063907 3300005441 Bacteria 2329
44 Ga0070700_100283756 3300005441 Bacteria 1202
45 Ga0070663_100001716 3300005455 Bacteria 12160
46 Ga0070663_100022099 3300005455 Bacteria 4246
47 Ga0070663_100084612 3300005455 Bacteria 2338
48 Ga0070678_100061536 3300005456 Bacteria 2768
49 Ga0070662_100000002 3300005457 Bacteria 253208
50 Ga0070681_10013391 3300005458 Bacteria 8148
51 Ga0070681_10084184 3300005458 Bacteria 3133
52 Ga0068867_100005480 3300005459 Bacteria 8981
53 Ga0070685_10000020 3300005466 Bacteria 104332
54 Ga0070685_10000674 3300005466 Bacteria 18541
55 Ga0070685_10035279 3300005466 Bacteria 2821
56 Ga0070679_100005826 3300005530 Bacteria 11429
57 Ga0070679_100021006 3300005530 Bacteria 6371
58 Ga0070679_100023402 3300005530 Bacteria 6046
59 Ga0070684_100042488 3300005535 Bacteria 3924
60 Ga0070684_100043406 3300005535 Bacteria 3882
61 Ga0070684_100052595 3300005535 Bacteria 3542
62 Ga0070684_100143253 3300005535 Bacteria 2162
63 Ga0068853_100083524 3300005539 Bacteria 2798
64 Ga0070672_100000001 3300005543 Bacteria 204624
65 Ga0070672_100059780 3300005543 Bacteria 2999
66 Ga0070693_100003731 3300005547 Bacteria 7127
67 Ga0070693_100167441 3300005547 Bacteria 1405
68 Ga0070665_100000135 3300005548 Bacteria 138925
69 Ga0070665_100005405 3300005548 Bacteria 13178
70 Ga0070665_100081770 3300005548 Bacteria 3235
71 Ga0070704_100062477 3300005549 Bacteria 2670
72 Ga0070704_100146231 3300005549 Bacteria 1852
73 Ga0070704_100216168 3300005549 Bacteria 1556
74 Ga0068855_100294366 3300005563 Bacteria 1799
75 Ga0070664_100013275 3300005564 Bacteria 6709
76 Ga0070664_100058703 3300005564 Bacteria 3273
77 Ga0070664_100144185 3300005564 Bacteria 2099
78 Ga0070664_100214497 3300005564 Bacteria 1720
79 Ga0068857_100065380 3300005577 Bacteria 3234
80 Ga0068854_100001203 3300005578 Bacteria 15515
81 Ga0068854_100056337 3300005578 Bacteria 2833
82 Ga0068854_100070238 3300005578 Bacteria 2559
83 Ga0068856_100004032 3300005614 Bacteria 14706
84 Ga0068856_100026571 3300005614 Bacteria 5645
85 Ga0068856_100157815 3300005614 Bacteria 2278
86 Ga0068856_100250189 3300005614 Bacteria 1787
87 Ga0068856_100266325 3300005614 Bacteria 1729
88 Ga0070702_100013201 3300005615 Bacteria 4164
89 Ga0068852_100000002 3300005616 Bacteria 268221
90 Ga0068852_100007835 3300005616 Bacteria 7819
91 Ga0068864_100000015 3300005618 Bacteria 303368
92 Ga0068864_100043739 3300005618 Bacteria 3836
93 Ga0068864_100103015 3300005618 Bacteria 2534
94 Ga0068866_10000008 3300005718 Bacteria 117658
95 Ga0068861_100152617 3300005719 Bacteria 1897
96 Ga0068851_10001260 3300005834 Bacteria 11027
97 Ga0068863_100000022 3300005841 Bacteria 188278
98 Ga0068858_100093657 3300005842 Bacteria 2797
99 Ga0068860_100011591 3300005843 Bacteria 8694
100 Ga0068860_100085754 3300005843 Bacteria 2996
101 Ga0068862_100002782 3300005844 Bacteria 15329
102 Ga0081455_10005716 3300005937 Bacteria 13558
103 Ga0081455_10010756 3300005937 Bacteria 9252
104 Ga0081455_10021412 3300005937 Bacteria 6064
105 Ga0081455_10049005 3300005937 Bacteria 3644
106 Ga0081455_10059195 3300005937 Bacteria 3236
107 Ga0081455_10067266 3300005937 Bacteria 2986
108 Ga0081455_10164809 3300005937 Bacteria 1695
109 Ga0081538_10000020 3300005981 Bacteria 139567
110 Ga0081538_10000316 3300005981 Bacteria 55223
111 Ga0081538_10000486 3300005981 Bacteria 44589
112 Ga0081538_10000526 3300005981 Bacteria 42457
113 Ga0081538_10000796 3300005981 Bacteria 34251
114 Ga0081538_10000812 3300005981 Bacteria 33866
115 Ga0081538_10008324 3300005981 Bacteria 8829
116 Ga0081538_10018966 3300005981 Bacteria 5138
117 Ga0081538_10025117 3300005981 Bacteria 4215
118 Ga0081538_10030544 3300005981 Bacteria 3655
119 Ga0081538_10089786 3300005981 Bacteria 1593
120 Ga0081540_1000100 3300005983 Bacteria 91640
121 Ga0081540_1000706 3300005983 Bacteria 30972
122 Ga0081540_1046023 3300005983 Bacteria 2207
123 Ga0081539_10000740 3300005985 Bacteria 65387
124 Ga0081539_10000878 3300005985 Bacteria 57633
125 Ga0081539_10003483 3300005985 Bacteria 19226
126 Ga0081539_10008209 3300005985 Bacteria 9191
127 Ga0081539_10024074 3300005985 Bacteria 3963
128 Ga0075365_10007560 3300006038 Bacteria 6100
129 Ga0075365_10018720 3300006038 Bacteria 4264
130 Ga0075365_10116029 3300006038 Bacteria 1844
131 Ga0075365_10230635 3300006038 Bacteria 1299
132 Ga0075364_10107249 3300006051 Bacteria 1862
133 Ga0070715_10000021 3300006163 Bacteria 119283
134 Ga0075428_100082957 3300006844 Bacteria 3497
135 Ga0075428_100208639 3300006844 Bacteria 2111
136 Ga0075428_100278885 3300006844 Bacteria 1798
137 Ga0075430_100002367 3300006846 Bacteria 15665
138 Ga0075430_100053196 3300006846 Bacteria 3410
139 Ga0075430_100394196 3300006846 Bacteria 1143
140 Ga0075431_100008439 3300006847 Bacteria 10315
141 Ga0075431_100018318 3300006847 Bacteria 7128
142 Ga0075431_100023074 3300006847 Bacteria 6362
143 Ga0075431_100036502 3300006847 Bacteria 5061
144 Ga0075431_100072846 3300006847 Bacteria 3544
145 Ga0075431_100163972 3300006847 Bacteria 2285
146 Ga0075433_10000897 3300006852 Bacteria 20988
147 Ga0075433_10004260 3300006852 Bacteria 11112
148 Ga0075433_10033900 3300006852 Bacteria 4381
149 Ga0075433_10131035 3300006852 Bacteria 2228
150 Ga0075434_100027126 3300006871 Bacteria 5621
151 Ga0075434_100043274 3300006871 Bacteria 4465
152 Ga0075429_100028882 3300006880 Bacteria 4817
153 Ga0068865_100000082 3300006881 Bacteria 50913
154 Ga0068865_100092346 3300006881 Bacteria 2199
155 Ga0075436_100079950 3300006914 Bacteria 2265
156 Ga0105240_10042151 3300009093 Bacteria 5819
157 Ga0111539_10070367 3300009094 Bacteria 4131
158 Ga0111539_10100345 3300009094 Bacteria 3399
159 Ga0105245_10000278 3300009098 Bacteria 48473
160 Ga0105245_10000415 3300009098 Bacteria 39764
161 Ga0105245_10001311 3300009098 Bacteria 22474
162 Ga0105245_10011891 3300009098 Bacteria 7568
163 Ga0105245_10180209 3300009098 Bacteria 2018
164 Ga0105247_10001706 3300009101 Bacteria 15492
165 Ga0105247_10155661 3300009101 Bacteria 1509
166 Ga0114129_10001353 3300009147 Bacteria 32898
167 Ga0114129_10012393 3300009147 Bacteria 12136
168 Ga0114129_10032936 3300009147 Bacteria 7323
169 Ga0114129_10112386 3300009147 Bacteria 3756
170 Ga0114129_10251406 3300009147 Bacteria 2373
171 Ga0114129_10692375 3300009147 Bacteria 1311
172 Ga0105243_10007118 3300009148 Bacteria 8605
173 Ga0105242_10000449 3300009176 Bacteria 32713
174 Ga0105242_10000653 3300009176 Bacteria 27161
175 Ga0105242_10417403 3300009176 Bacteria 1256
176 Ga0105248_10000020 3300009177 Bacteria 284637
177 Ga0105237_10408162 3300009545 Bacteria 1363
178 Ga0105238_10000055 3300009551 Bacteria 139232
179 Ga0105238_10006420 3300009551 Bacteria 11698
180 Ga0105249_10000143 3300009553 Bacteria 92539
181 Ga0105249_10003360 3300009553 Bacteria 13850
182 Ga0105249_10007747 3300009553 Bacteria 9358
183 Ga0105239_10036088 3300010375 Bacteria 5428
184 Ga0105246_10037640 3300011119 Bacteria 3247
185 Ga0105246_10107799 3300011119 Bacteria 2041
186 Ga0157371_10001577 3300013102 Bacteria 23401
187 Ga0157370_10003254 3300013104 Bacteria 19142
188 Ga0157370_10047400 3300013104 Bacteria 4120
189 Ga0157370_10269346 3300013104 Bacteria 1574
190 Ga0157369_10000074 3300013105 Bacteria 136668
191 Ga0157369_10083922 3300013105 Bacteria 3406
192 Ga0157369_10215970 3300013105 Bacteria 2009
193 Ga0157369_10276762 3300013105 Bacteria 1748
194 Ga0157374_10000486 3300013296 Bacteria 35981
195 Ga0157374_10004880 3300013296 Bacteria 11252
196 Ga0157378_10003241 3300013297 Bacteria 14481
197 Ga0157378_10040737 3300013297 Bacteria 4120
198 Ga0163162_10034394 3300013306 Bacteria 5043
199 Ga0163162_10120085 3300013306 Bacteria 2732
200 Ga0157372_10000053 3300013307 Bacteria 128824
201 Ga0157372_10148694 3300013307 Bacteria 2702
202 Ga0157372_10323196 3300013307 Bacteria 1796
203 Ga0157375_10436619 3300013308 Bacteria 1475
204 Ga0163163_10113198 3300014325 Bacteria 2743
205 Ga0157380_10000016 3300014326 Bacteria 126029
206 Ga0157380_10000236 3300014326 Bacteria 33220
207 Ga0157377_10017479 3300014745 Bacteria 3710
208 Ga0157379_10030707 3300014968 Bacteria 4785
209 Ga0157379_10148336 3300014968 Bacteria 2115
210 Ga0157376_10027214 3300014969 Bacteria 4530
211 Ga0157376_10153677 3300014969 Bacteria 2078
212 Ga0163161_10000053 3300017792 Bacteria 117408
213 Ga0206353_10154608 3300020082 Bacteria 3058
214 Ga0207656_10000226 3300025321 Bacteria 20150
215 Ga0207656_10027875 3300025321 Bacteria 2314
216 Ga0207682_10010613 3300025893 Bacteria 3606
217 Ga0207642_10000002 3300025899 Bacteria 658166
218 Ga0207642_10000080 3300025899 Bacteria 25169
219 Ga0207710_10000157 3300025900 Bacteria 72764
220 Ga0207688_10004162 3300025901 Bacteria 7882
221 Ga0207688_10027092 3300025901 Bacteria 3152
222 Ga0207685_10000054 3300025905 Bacteria 35900
223 Ga0207705_10290817 3300025909 Bacteria 1252
224 Ga0207654_10057938 3300025911 Bacteria 2253
225 Ga0207707_10164307 3300025912 Bacteria 1940
226 Ga0207695_10104584 3300025913 Bacteria 2820
227 Ga0207693_10103235 3300025915 Bacteria 2236
228 Ga0207660_10013331 3300025917 Bacteria 5386
229 Ga0207657_10004340 3300025919 Bacteria 15020
230 Ga0207657_10015215 3300025919 Bacteria 7463
231 Ga0207649_10000127 3300025920 Bacteria 64603
232 Ga0207652_10000321 3300025921 Bacteria 49720
233 Ga0207652_10001733 3300025921 Bacteria 19037
234 Ga0207652_10009748 3300025921 Bacteria 7728
235 Ga0207652_10312844 3300025921 Bacteria 1418
236 Ga0207694_10000063 3300025924 Bacteria 139700
237 Ga0207650_10091138 3300025925 Bacteria 2329
238 Ga0207659_10000013 3300025926 Bacteria 172742
239 Ga0207687_10000032 3300025927 Bacteria 143196
240 Ga0207687_10000036 3300025927 Bacteria 121934
241 Ga0207687_10000460 3300025927 Bacteria 27723
242 Ga0207687_10003112 3300025927 Bacteria 11249
243 Ga0207687_10049514 3300025927 Bacteria 2922
244 Ga0207690_10023856 3300025932 Bacteria 3825
245 Ga0207706_10000001 3300025933 Bacteria 423014
246 Ga0207686_10000097 3300025934 Bacteria 72219
247 Ga0207686_10000921 3300025934 Bacteria 17629
248 Ga0207709_10005457 3300025935 Bacteria 7225
249 Ga0207669_10000017 3300025937 Bacteria 119878
250 Ga0207669_10000026 3300025937 Bacteria 92199
251 Ga0207669_10178961 3300025937 Bacteria 1518
252 Ga0207704_10000184 3300025938 Bacteria 32775
253 Ga0207704_10028503 3300025938 Bacteria 3099
254 Ga0207691_10000017 3300025940 Bacteria 134441
255 Ga0207711_10000006 3300025941 Bacteria 792692
256 Ga0207711_10101111 3300025941 Bacteria 2551
257 Ga0207661_10001690 3300025944 Bacteria 15057
258 Ga0207661_10002110 3300025944 Bacteria 13678
259 Ga0207661_10004460 3300025944 Bacteria 9836
260 Ga0207661_10039531 3300025944 Bacteria 3702
261 Ga0207661_10083801 3300025944 Bacteria 2639
262 Ga0207679_10215838 3300025945 Bacteria 1612
263 Ga0207712_10000058 3300025961 Bacteria 140948
264 Ga0207712_10075298 3300025961 Bacteria 2440
265 Ga0207712_10277264 3300025961 Bacteria 1367
266 Ga0207668_10071280 3300025972 Bacteria 2481
267 Ga0207640_10000093 3300025981 Bacteria 70374
268 Ga0207640_10034577 3300025981 Bacteria 3155
269 Ga0207640_10061908 3300025981 Bacteria 2481
270 Ga0207640_10171236 3300025981 Bacteria 1618
271 Ga0207640_10228930 3300025981 Bacteria 1429
272 Ga0207658_10003551 3300025986 Bacteria 11011
273 Ga0207658_10023672 3300025986 Bacteria 4289
274 Ga0207658_10137457 3300025986 Bacteria 1973
275 Ga0207677_10001038 3300026023 Bacteria 15272
276 Ga0207677_10031049 3300026023 Bacteria 3419
277 Ga0207639_10005999 3300026041 Bacteria 8242
278 Ga0207678_10002224 3300026067 Bacteria 17527
279 Ga0207678_10016375 3300026067 Bacteria 6509
280 Ga0207678_10125666 3300026067 Bacteria 2188
281 Ga0207678_10228064 3300026067 Bacteria 1595
282 Ga0207708_10014443 3300026075 Bacteria 5910
283 Ga0207708_10018028 3300026075 Bacteria 5313
284 Ga0207702_10000637 3300026078 Bacteria 38379
285 Ga0207702_10047334 3300026078 Bacteria 3624
286 Ga0207702_10223666 3300026078 Bacteria 1755
287 Ga0207702_10426774 3300026078 Bacteria 1283
288 Ga0207641_10000016 3300026088 Bacteria 307363
289 Ga0207648_10100881 3300026089 Bacteria 2529
290 Ga0207676_10000018 3300026095 Bacteria 306375
291 Ga0207674_10035565 3300026116 Bacteria 5198
292 Ga0207674_10054549 3300026116 Bacteria 4068
293 Ga0207675_100043378 3300026118 Bacteria 4200
294 Ga0207698_10000004 3300026142 Bacteria 313614
295 Ga0207698_10013220 3300026142 Bacteria 5437
296 Ga0207698_10191136 3300026142 Bacteria 1823
297 Ga0207698_10305362 3300026142 Bacteria 1483
298 Ga0207428_10065295 3300027907 Bacteria 2871
299 Ga0268266_10000056 3300028379 Bacteria 289176
300 Ga0268266_10001254 3300028379 Bacteria 31003
301 Ga0268266_10006356 3300028379 Bacteria 10831
302 Ga0268266_10184601 3300028379 Bacteria 1901
303 Ga0268265_10002889 3300028380 Bacteria 12617
304 Ga0268264_10016645 3300028381 Bacteria 6021
305 Ga0268264_10059027 3300028381 Bacteria 3214
306 Ga0268264_10222234 3300028381 Bacteria 1739
307 Ga0265337_1000066 3300028556 Bacteria 48673
308 Ga0265326_10000019 3300028558 Bacteria 137370
309 Ga0265319_1000469 3300028563 Bacteria 28589
310 Ga0265322_10000011 3300028654 Bacteria 167597
311 Ga0265338_10000244 3300028800 Bacteria 100528
312 Ga0265324_10000283 3300029957 Bacteria 37587
313 Ga0265332_10061866 3300031238 Bacteria 1600
314 Ga0265328_10000737 3300031239 Bacteria 15188
315 Ga0265320_10000011 3300031240 Bacteria 249534
316 Ga0265329_10016232 3300031242 Bacteria 2585
317 Ga0265331_10000858 3300031250 Bacteria 24739
318 Ga0265331_10047145 3300031250 Bacteria 2074
319 Ga0265327_10000015 3300031251 Bacteria 496677
320 Ga0265316_10047188 3300031344 Bacteria 3408
321 Ga0265316_10050858 3300031344 Unclassified 3258
322 Ga0307408_100103118 3300031548 Bacteria 2177
323 Ga0307408_100140389 3300031548 Bacteria 1896
324 Ga0265314_10000640 3300031711 Bacteria 42944
325 Ga0316576_10015088 3300031727 Bacteria 5176
326 Ga0307405_10080241 3300031731 Bacteria 2130
327 Ga0307405_10089558 3300031731 Bacteria 2033
328 Ga0307413_10187315 3300031824 Bacteria 1482
329 Ga0307410_10045879 3300031852 Bacteria 2913
330 Ga0307410_10068378 3300031852 Bacteria 2453
331 Ga0307410_10069885 3300031852 Bacteria 2430
332 Ga0307410_10166615 3300031852 Bacteria 1656
333 Ga0307406_10014323 3300031901 Bacteria 4561
334 Ga0307406_10049495 3300031901 Bacteria 2660
335 Ga0307406_10113558 3300031901 Bacteria 1869
336 Ga0307406_10270804 3300031901 Bacteria 1290
337 Ga0307407_10038141 3300031903 Bacteria 2661
338 Ga0307407_10250570 3300031903 Bacteria 1213
339 Ga0307412_10140447 3300031911 Bacteria 1768
340 Ga0307409_100003645 3300031995 Bacteria 8425
341 Ga0307409_100123747 3300031995 Bacteria 2195
342 Ga0307409_100141139 3300031995 Bacteria 2076
343 Ga0307416_100007153 3300032002 Bacteria 7060
344 Ga0307416_100054463 3300032002 Bacteria 3216
345 Ga0307416_100073654 3300032002 Bacteria 2849
346 Ga0307416_100102545 3300032002 Bacteria 2495
347 Ga0307416_100380160 3300032002 Bacteria 1442
348 Ga0307414_10041832 3300032004 Bacteria 3108
349 Ga0307414_10202999 3300032004 Bacteria 1614
350 Ga0307414_10291312 3300032004 Bacteria 1376
351 Ga0307414_10398784 3300032004 Bacteria 1194
352 Ga0307411_10050006 3300032005 Bacteria 2720
353 Ga0307415_100004435 3300032126 Bacteria 7279
354 Ga0307415_100023008 3300032126 Bacteria 3860
355 Ga0307415_100027919 3300032126 Bacteria 3583
356 Ga0307415_100077824 3300032126 Bacteria 2356
357 Ga0307415_100095665 3300032126 Bacteria 2163
358 Ga0307415_100144164 3300032126 Bacteria 1823
359 Ga0373949_0009952 3300035090 Bacteria 2080
360 Ga0373955_0147652 3300035172 Bacteria 1382
361 Ga0316584_0001782 3300036712 Bacteria 13265
362 Ga0373925_0118482 3300037068 Bacteria 2053
363 Ga0395900_0105892 3300037418 Bacteria 2889
364 Ga0395900_0223900 3300037418 Bacteria 1895
365 Ga0395900_0346516 3300037418 Bacteria 1460
366 Ga0395898_0026411 3300037466 Bacteria 5842
367 Ga0395898_0092869 3300037466 Bacteria 2902
368 Ga0395898_0235746 3300037466 Bacteria 1745
369 Ga0395905_0246814 3300037471 Bacteria 1668
370 Ga0395901_0004095 3300038443 Bacteria 14694
371 Ga0395901_0053141 3300038443 Bacteria 4210
372 Ga0439463_010194 3300042016 Bacteria 2310
373 Ga0439444_0016827 3300042437 Bacteria 1249
374 Ga0466961_0114035 3300044693 Bacteria 1699
375 Ga0466963_0000017 3300044694 Bacteria 58283
376 Ga0466963_0070730 3300044694 Bacteria 2347
377 Ga0466963_0285886 3300044694 Bacteria 1159
378 Ga0466971_0012957 3300044719 Bacteria 3658
379 Ga0466968_0074169 3300044735 Bacteria 1485
380 Ga0466957_0001414 3300044842 Bacteria 12517
381 Ga0466957_0074080 3300044842 Bacteria 2111
382 Ga0466957_0125696 3300044842 Bacteria 1638
383 Ga0466960_0074615 3300044901 Bacteria 1695
384 Ga0466958_0010414 3300045836 Bacteria 5207
385 Ga0466967_0000001 3300045976 Bacteria 229823
386 Ga0466967_0007296 3300045976 Bacteria 7958
387 Ga0466967_0010090 3300045976 Bacteria 7059
388 Ga0466967_0025483 3300045976 Bacteria 4878
389 Ga0495592_0000607 3300046454 Bacteria 25304
390 Ga0495603_0000286 3300046455 Bacteria 26902
391 Ga0495603_0001350 3300046455 Bacteria 14245
392 Ga0495603_0122584 3300046455 Bacteria 1514
393 Ga0495629_0000245 3300046459 Bacteria 47272
394 Ga0495629_0005286 3300046459 Bacteria 9650
395 Ga0495641_0000005 3300046461 Bacteria 206626
396 Ga0495641_0056121 3300046461 Bacteria 1786
397 Ga0495650_0000054 3300046471 Bacteria 313631
398 Ga0495582_0000001 3300046473 Bacteria 252434
399 Ga0495582_0098596 3300046473 Bacteria 1635
400 Ga0495662_0000001 3300046476 Bacteria 179185
401 Ga0495662_0000848 3300046476 Bacteria 14886
402 Ga0495594_0000089 3300046499 Bacteria 41876
403 Ga0495596_0086850 3300046500 Bacteria 1214
404 Ga0495606_0000040 3300046507 Bacteria 223500
405 Ga0495608_0000007 3300046511 Bacteria 313495
406 Ga0495608_0094331 3300046511 Bacteria 1933
407 Ga0495618_0000014 3300046514 Bacteria 163136
408 Ga0495618_0167218 3300046514 Bacteria 1400
409 Ga0495620_0000784 3300046515 Bacteria 19458
410 Ga0495628_0023790 3300046516 Bacteria 5023
411 Ga0495628_0066303 3300046516 Bacteria 2822
412 Ga0495628_0251803 3300046516 Bacteria 1318
413 Ga0495630_0000014 3300046517 Bacteria 217229
414 Ga0495630_0000533 3300046517 Bacteria 27959
415 Ga0495630_0003407 3300046517 Bacteria 11078
416 Ga0495630_0058778 3300046517 Bacteria 2883
417 Ga0495630_0198928 3300046517 Bacteria 1529
418 Ga0495644_0001871 3300046523 Bacteria 8485
419 Ga0495642_0081004 3300046528 Bacteria 1367
420 Ga0495652_0000037 3300046529 Bacteria 133232
421 Ga0495652_0011995 3300046529 Bacteria 7834
422 Ga0495640_0091728 3300046533 Bacteria 2004
423 Ga0495586_0003054 3300046535 Bacteria 9025
424 Ga0495587_0003966 3300046536 Bacteria 9814
425 Ga0495609_0091426 3300046538 Bacteria 1324
426 Ga0495645_0027447 3300046543 Bacteria 4137
427 Ga0495622_0000080 3300046557 Bacteria 85557
428 Ga0495667_0000020 3300046559 Bacteria 180876
429 Ga0495656_0000465 3300046615 Bacteria 13215
430 Ga0495656_0077512 3300046615 Bacteria 1492
431 Ga0495668_0041252 3300046616 Bacteria 2572
432 Ga0495634_0000028 3300046642 Bacteria 114075
433 Ga0495634_0001744 3300046642 Bacteria 18826
434 Ga0495634_0113592 3300046642 Bacteria 1739
435 Ga0495625_0000349 3300046660 Bacteria 70631
436 Ga0495625_0076676 3300046660 Bacteria 2337
437 Ga0495635_0000076 3300046663 Bacteria 61665
438 Ga0495588_0000362 3300046674 Bacteria 28212
439 Ga0495657_0000001 3300046675 Bacteria 445641
440 Ga0495657_0017364 3300046675 Bacteria 5226
441 Ga0495599_0036072 3300046678 Bacteria 3104
442 Ga0495646_0106600 3300046680 Bacteria 1600
443 Ga0495647_0000001 3300046681 Bacteria 222371
444 Ga0495647_0008133 3300046681 Bacteria 3524
445 Ga0495658_0000002 3300046683 Bacteria 309651
446 Ga0495658_0019725 3300046683 Bacteria 3524
447 Ga0495669_0000113 3300046684 Bacteria 52780
448 Ga0495613_0000005 3300046689 Bacteria 222558
449 Ga0495613_0000041 3300046689 Bacteria 130784
450 Ga0495624_0000019 3300046690 Bacteria 102237
451 Ga0495624_0000417 3300046690 Bacteria 33743
452 Ga0495624_0033290 3300046690 Bacteria 3338
453 Ga0495649_0002403 3300046694 Bacteria 13212
454 Ga0495600_0011717 3300046809 Bacteria 5472
455 Ga0495604_0000239 3300047317 Bacteria 49113
456 Ga0495604_0001251 3300047317 Bacteria 20805
457 Ga0495674_0000030 3300047319 Bacteria 115975
458 Ga0495672_0068475 3300047320 Bacteria 2018
459 Ga0495676_0000827 3300047321 Bacteria 25944
460 Ga0495676_0012579 3300047321 Bacteria 7619
461 Ga0495676_0057606 3300047321 Bacteria 3063
462 Ga0495680_0000143 3300047322 Bacteria 71946
463 Ga0495680_0001430 3300047322 Bacteria 25733
464 Ga0495680_0022126 3300047322 Bacteria 5308
465 Ga0495675_0001421 3300047444 Bacteria 14505
466 Ga0495673_0072568 3300047469 Bacteria 1444
467 Ga0495686_0097769 3300047472 Bacteria 1774
468 Ga0495593_0039645 3300047673 Bacteria 2539
469 Ga0495602_0000007 3300048088 Bacteria 273212
470 Ga0495602_0001031 3300048088 Bacteria 27141
471 Ga0496100_0000001 3300048903 Bacteria 530179
472 Ga0496100_0000013 3300048903 Bacteria 177476
473 Ga0496100_0080822 3300048903 Bacteria 2194
474 Ga0496101_0000004 3300048904 Bacteria 331599
475 Ga0496101_0000035 3300048904 Bacteria 177237
476 Ga0496101_0211132 3300048904 Bacteria 1504
477 Ga0496102_0000211 3300048905 Bacteria 77793
478 Ga0496102_0010565 3300048905 Bacteria 7951
479 Ga0496102_0058720 3300048905 Bacteria 3516
480 Ga0496102_0098230 3300048905 Bacteria 2717
481 Ga0496102_0109368 3300048905 Bacteria 2575
482 Ga0496102_0145284 3300048905 Bacteria 2226
483 Ga0496102_0279465 3300048905 Bacteria 1574
484 Ga0496102_0340303 3300048905 Bacteria 1413
485 Ga0496103_0000083 3300048906 Bacteria 108615
486 Ga0496104_0000015 3300048907 Bacteria 374530
487 Ga0496104_0000052 3300048907 Bacteria 137286
488 Ga0496104_0000765 3300048907 Bacteria 27516
489 Ga0496104_0017182 3300048907 Bacteria 6581
490 Ga0496104_0049764 3300048907 Bacteria 3952
491 Ga0496104_0120640 3300048907 Bacteria 2517
492 Ga0496105_0000004 3300048908 Bacteria 475798
493 Ga0496105_0000030 3300048908 Bacteria 137325
494 Ga0496105_0000409 3300048908 Bacteria 28168
495 Ga0496105_0022580 3300048908 Bacteria 5096
496 Ga0496105_0027673 3300048908 Bacteria 4634
497 Ga0496106_0000076 3300048909 Bacteria 79088
498 Ga0496106_0000121 3300048909 Bacteria 59910
499 Ga0496106_0004512 3300048909 Bacteria 10312
500 Ga0496106_0006748 3300048909 Bacteria 8500
501 Ga0496107_0000005 3300048910 Bacteria 281747
502 Ga0496107_0000020 3300048910 Bacteria 148990
503 Ga0496107_0041276 3300048910 Bacteria 3313
504 Ga0496108_0000006 3300048911 Bacteria 469473
505 Ga0496108_0000063 3300048911 Bacteria 118950
506 Ga0496108_0003280 3300048911 Bacteria 12999
507 Ga0496108_0025146 3300048911 Bacteria 4906
508 Ga0496108_0054035 3300048911 Bacteria 3370
509 Ga0496108_0108936 3300048911 Bacteria 2366
510 Ga0496109_0000009 3300048912 Bacteria 236561
511 Ga0496109_0000012 3300048912 Bacteria 229699
512 Ga0496109_0000348 3300048912 Bacteria 43133
513 Ga0496109_0000942 3300048912 Bacteria 24081
514 Ga0496109_0003361 3300048912 Bacteria 13379
515 Ga0496109_0039321 3300048912 Bacteria 4281
516 Ga0496109_0057511 3300048912 Bacteria 3550
517 Ga0496109_0070649 3300048912 Bacteria 3204
518 Ga0496110_0002164 3300048913 Bacteria 14666
519 Ga0496110_0037796 3300048913 Bacteria 4197
520 Ga0496110_0062843 3300048913 Bacteria 3280
521 Ga0496110_0102704 3300048913 Bacteria 2564
522 Ga0496110_0116106 3300048913 Bacteria 2409
523 Ga0496111_0000044 3300048914 Bacteria 49014
524 Ga0496111_0025522 3300048914 Bacteria 4170
525 Ga0496111_0047291 3300048914 Bacteria 3098
526 Ga0496112_0000025 3300048915 Bacteria 146197
527 Ga0496112_0030187 3300048915 Bacteria 5245
528 Ga0496112_0279281 3300048915 Bacteria 1617
529 Ga0496112_0282194 3300048915 Bacteria 1608
530 Ga0496112_0409451 3300048915 Bacteria 1295
531 Ga0496113_0000013 3300048916 Bacteria 81224
532 Ga0496113_0020234 3300048916 Bacteria 4675
533 Ga0496113_0024871 3300048916 Bacteria 4263
534 Ga0496114_0000039 3300048917 Bacteria 138486
535 Ga0496114_0054866 3300048917 Bacteria 3323
536 Ga0496115_0000011 3300048918 Bacteria 222529
537 Ga0496115_0000377 3300048918 Bacteria 36788
538 Ga0496116_0000848 3300048919 Bacteria 38292
539 Ga0496117_0009784 3300048920 Bacteria 8842
540 Ga0496119_0066967 3300048922 Bacteria 2119
541 Ga0496119_0104486 3300048922 Bacteria 1584
542 Ga0496120_0024368 3300048923 Bacteria 3775
543 Ga0496121_0013496 3300048924 Bacteria 8770
544 Ga0496122_0041994 3300048925 Bacteria 3605
545 Ga0496124_0051640 3300048927 Bacteria 3497
546 Ga0496124_0159321 3300048927 Bacteria 1761
547 Ga0496124_0183177 3300048927 Bacteria 1610
548 Ga0496125_0071032 3300048928 Bacteria 2722
549 Ga0496126_0019594 3300048929 Bacteria 6660
550 Ga0501031_0000523 3300049568 Bacteria 22416
551 Ga0501031_0002175 3300049568 Bacteria 12379
552 Ga0501031_0032359 3300049568 Bacteria 3409
553 Ga0501031_0192515 3300049568 Unclassified 1331
554 Ga0501032_0011222 3300049569 Bacteria 6435
555 Ga0501032_0026816 3300049569 Bacteria 3960
556 Ga0501033_0003689 3300049570 Bacteria 12454
557 Ga0501033_0022701 3300049570 Bacteria 4732
558 Ga0501033_0077057 3300049570 Bacteria 2447
559 Ga0501034_0016227 3300049571 Bacteria 7642
560 Ga0501034_0016892 3300049571 Bacteria 7482
561 Ga0501034_0200589 3300049571 Bacteria 1953
562 Ga0501036_0022928 3300049572 Bacteria 5257
563 Ga0501036_0030691 3300049572 Bacteria 4539
564 Ga0501036_0114656 3300049572 Bacteria 2277
565 Ga0501036_0158395 3300049572 Bacteria 1909
566 Ga0501037_0002926 3300049573 Bacteria 12385
567 Ga0501037_0007442 3300049573 Bacteria 8008
568 Ga0501037_0160448 3300049573 Bacteria 1603
569 Ga0501037_0214085 3300049573 Bacteria 1358
570 Ga0501038_0005058 3300049574 Bacteria 12248
571 Ga0501038_0044559 3300049574 Bacteria 3852
572 Ga0501038_0120415 3300049574 Bacteria 2165
573 Ga0501039_0009178 3300049575 Bacteria 7536
574 Ga0501039_0013344 3300049575 Bacteria 6281
575 Ga0501039_0013502 3300049575 Bacteria 6246
576 Ga0501039_0126956 3300049575 Bacteria 2001
577 Ga0501039_0152073 3300049575 Bacteria 1818
578 Ga0501039_0173382 3300049575 Bacteria 1696
579 Ga0501039_0355897 3300049575 Bacteria 1150
580 Ga0501040_0002372 3300049576 Bacteria 12097
581 Ga0501040_0002837 3300049576 Bacteria 11185
582 Ga0501040_0090694 3300049576 Bacteria 2124
583 Ga0501040_0153891 3300049576 Bacteria 1623
584 Ga0501040_0283912 3300049576 Bacteria 1182
585 Ga0501041_0016084 3300049577 Bacteria 4443
586 Ga0501041_0017928 3300049577 Bacteria 4214
587 Ga0501041_0027445 3300049577 Bacteria 3431
588 Ga0501041_0063221 3300049577 Bacteria 2266
589 Ga0501041_0227064 3300049577 Unclassified 1172
590 Ga0501042_0011612 3300049578 Bacteria 5949
591 Ga0501042_0012872 3300049578 Bacteria 5681
592 Ga0501042_0018999 3300049578 Bacteria 4768
593 Ga0501042_0252330 3300049578 Bacteria 1273
594 Ga0501043_0090962 3300049579 Bacteria 2399
595 Ga0501043_0159126 3300049579 Bacteria 1765
596 Ga0501046_0004559 3300049580 Bacteria 12539
597 Ga0501046_0006008 3300049580 Bacteria 10802
598 Ga0501046_0079832 3300049580 Bacteria 2529
599 Ga0501046_0084957 3300049580 Bacteria 2440
600 Ga0501047_0004952 3300049581 Bacteria 12510
601 Ga0501047_0010850 3300049581 Bacteria 8610
602 Ga0501047_0047006 3300049581 Bacteria 4170
603 Ga0501047_0148155 3300049581 Bacteria 2223
604 Ga0501047_0176579 3300049581 Bacteria 2003
605 Ga0501048_0003128 3300049582 Bacteria 12640
606 Ga0501048_0009218 3300049582 Bacteria 7414
607 Ga0501048_0058171 3300049582 Bacteria 2740
608 Ga0501068_0002345 3300049584 Bacteria 10082
609 Ga0501068_0135433 3300049584 Bacteria 1542
610 Ga0501069_0003466 3300049585 Bacteria 8121
611 Ga0501069_0006694 3300049585 Bacteria 6033
612 Ga0501069_0075472 3300049585 Bacteria 1893
613 Ga0501070_0004064 3300049586 Bacteria 12575
614 Ga0501070_0028642 3300049586 Bacteria 4671
615 Ga0501071_0000721 3300049587 Bacteria 17421
616 Ga0501071_0006091 3300049587 Bacteria 7819
617 Ga0501071_0010365 3300049587 Bacteria 6243
618 Ga0501071_0056805 3300049587 Bacteria 2828
619 Ga0501071_0132089 3300049587 Bacteria 1855
620 Ga0501071_0169999 3300049587 Bacteria 1632
621 Ga0501072_0000861 3300049588 Bacteria 22285
622 Ga0501072_0017464 3300049588 Bacteria 5513
623 Ga0501072_0019616 3300049588 Bacteria 5229
624 Ga0501072_0030329 3300049588 Bacteria 4229
625 Ga0501072_0043596 3300049588 Bacteria 3526
626 Ga0501072_0116154 3300049588 Bacteria 2131
627 Ga0501072_0306943 3300049588 Bacteria 1261
628 Ga0501073_0007894 3300049589 Bacteria 7897
629 Ga0501073_0012127 3300049589 Bacteria 6294
630 Ga0501074_0018921 3300049590 Bacteria 5002
631 Ga0501074_0034411 3300049590 Bacteria 3672
632 Ga0501074_0113146 3300049590 Bacteria 1942
633 Ga0501075_0007586 3300049591 Bacteria 7528
634 Ga0501075_0045069 3300049591 Bacteria 3310
635 Ga0501075_0133564 3300049591 Bacteria 1891
636 Ga0501075_0369303 3300049591 Bacteria 1093
637 Ga0501075_0492152 3300049591 Bacteria 935
638 Ga0501076_0001451 3300049592 Bacteria 15944
639 Ga0501076_0003612 3300049592 Bacteria 10866
640 Ga0501076_0029982 3300049592 Bacteria 4235
641 Ga0501076_0048517 3300049592 Bacteria 3356
642 Ga0501076_0180083 3300049592 Bacteria 1723
643 Ga0501076_0180966 3300049592 Bacteria 1718
644 Ga0501077_0030258 3300049593 Bacteria 3445
645 Ga0501077_0083461 3300049593 Bacteria 2024
646 Ga0501079_0004891 3300049741 Bacteria 9931
647 Ga0501079_0080440 3300049741 Bacteria 2519
648 Ga0501080_0006646 3300049742 Bacteria 10402
649 Ga0501080_0030783 3300049742 Bacteria 5000
650 Ga0501080_0062326 3300049742 Bacteria 3471
651 Ga0501080_0117493 3300049742 Bacteria 2465
652 Ga0501081_0014926 3300049743 Bacteria 5124
653 Ga0501081_0025371 3300049743 Bacteria 3987
654 Ga0501083_0002614 3300049744 Bacteria 12402
655 Ga0501083_0003895 3300049744 Bacteria 10485
656 Ga0501083_0007495 3300049744 Bacteria 7730
657 Ga0501083_0043053 3300049744 Bacteria 3060
658 Ga0501035_0005116 3300049822 Bacteria 12420
659 Ga0501035_0016708 3300049822 Bacteria 6766
660 Ga0501035_0079660 3300049822 Bacteria 2893
661 Ga0501035_0119818 3300049822 Bacteria 2301
662 Ga0501035_0192751 3300049822 Bacteria 1752
663 Ga0501044_0006919 3300049823 Bacteria 12483
664 Ga0501044_0171526 3300049823 Bacteria 2140
665 Ga0501045_0011031 3300049824 Bacteria 6334
666 Ga0501045_0011542 3300049824 Bacteria 6204
667 Ga0501045_0135648 3300049824 Bacteria 1830
668 nmdc:mga03n38_41860_c1 3300050490 Bacteria 1999
669 nmdc:mga00v17_51630_c2 3300050491 Bacteria 1890
670 nmdc:mga00v17_71968_c2 3300050491 Bacteria 1322
671 nmdc:mga0yw44_589_c1 3300050492 Bacteria 13169
672 nmdc:mga0yw44_97687_c1 3300050492 Bacteria 1866
673 nmdc:mga06z11_63651_c1 3300050494 Bacteria 1930
674 nmdc:mga05p37_114066_c1 3300050507 Bacteria 3322
675 nmdc:mga05p37_38150_c1 3300050507 Bacteria 5891
676 nmdc:mga05p37_51957_c1 3300050507 Bacteria 5040
677 nmdc:mga05p37_69258_c1 3300050507 Bacteria 4339
678 nmdc:mga05p37_70480_c1 3300050507 Bacteria 4299
679 nmdc:mga09592_93327_c1 3300050508 Bacteria 2574
680 nmdc:mga0qj67_170565_c1 3300050509 Bacteria 1767
681 nmdc:mga0qj67_26043_c1 3300050509 Bacteria 4526
682 nmdc:mga0qj67_6768_c1 3300050509 Bacteria 8427
683 nmdc:mga06r32_180923_c1 3300050510 Bacteria 2094
684 nmdc:mga06r32_20441_c1 3300050510 Bacteria 6097
685 nmdc:mga06r32_51501_c1 3300050510 Bacteria 3941
686 nmdc:mga08y16_130720_c1 3300050511 Bacteria 2611
687 nmdc:mga08y16_454811_c1 3300050511 Bacteria 1305
688 nmdc:mga08y16_94149_c1 3300050511 Bacteria 3121
689 nmdc:mga0n895_209759_c1 3300050512 Bacteria 1978
690 nmdc:mga0n895_326505_c1 3300050512 Bacteria 1555
691 nmdc:mga08x19_126213_c1 3300050514 Bacteria 1718
692 nmdc:mga0a205_142921_c1 3300050515 Bacteria 2293
693 nmdc:mga0a205_15449_c1 3300050515 Bacteria 7136
694 nmdc:mga0a205_43_c1 3300050515 Bacteria 51209
695 nmdc:mga0a205_53_c2 3300050515 Bacteria 54696
696 Ga0495601_0000060 3300053077 Bacteria 60600
697 Ga0495601_0000165 3300053077 Bacteria 35521
698 Ga0495601_0025379 3300053077 Bacteria 3654
699 Ga0495601_0057074 3300053077 Bacteria 2473
700 Ga0495601_0200353 3300053077 Bacteria 1304
701 Ga0495612_0000210 3300053078 Bacteria 24800
702 Ga0495612_0003484 3300053078 Bacteria 6518
703 Ga0495612_0005082 3300053078 Bacteria 5449
704 Ga0495655_0000002 3300053083 Bacteria 312752
705 Ga0495595_0000002 3300053084 Bacteria 445641
706 Ga0495595_0000045 3300053084 Bacteria 63054
707 Ga0495619_0000008 3300053085 Bacteria 305999
708 Ga0495619_0000095 3300053085 Bacteria 66204
709 Ga0495619_0000102 3300053085 Bacteria 64345
710 Ga0495619_0000155 3300053085 Bacteria 50682
711 Ga0495619_0000195 3300053085 Bacteria 44602
712 Ga0495619_0000320 3300053085 Bacteria 33623
713 Ga0495619_0010358 3300053085 Bacteria 5869
714 Ga0495619_0053306 3300053085 Bacteria 2675
715 Ga0500566_0001093 3300053094 Bacteria 15689
716 Ga0500641_0001622 3300053096 Bacteria 8015
717 Ga0500556_0000723 3300053104 Bacteria 19906
718 Ga0500614_001424 3300053123 Bacteria 5734
719 Ga0500628_000001 3300053129 Bacteria 564074
720 Ga0500616_0003272 3300053153 Bacteria 12504
721 Ga0500616_0016529 3300053153 Bacteria 4197
722 Ga0501084_0014280 3300054114 Bacteria 6577
723 Ga0501084_0044771 3300054114 Bacteria 3705
724 Ga0501084_0046476 3300054114 Bacteria 3637
725 Ga0501082_0004774 3300060353 Bacteria 11825
726 Ga0501082_0006568 3300060353 Bacteria 10073
727 Ga0501082_0081193 3300060353 Bacteria 2798
728 Ga0501082_0091634 3300060353 Unclassified 2625
729 Ga0501082_0122044 3300060353 Bacteria 2259
730 Ga0501082_0297438 3300060353 Bacteria 1405
731 Ga0501082_0355486 3300060353 Bacteria 1278
732 Ga0466962_0028029 3300061719 Bacteria 2700
733 Ga0530510_0009466 3300061734 Bacteria 6831
734 Ga0530510_0050397 3300061734 Bacteria 3007

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049591 Ga0501075_0492152 Ga0501075_0492152_63_902 278
2 3300031852 Ga0307410_10045879 Ga0307410_100458793 283
3 3300005329 Ga0070683_100000404 Ga0070683_10000040417 295
4 3300005535 Ga0070684_100143253 Ga0070684_1001432532 295
5 3300025944 Ga0207661_10001690 Ga0207661_100016902 295
6 3300048911 Ga0496108_0000063 Ga0496108_0000063_87244_88251 296
7 3300048912 Ga0496109_0000012 Ga0496109_0000012_24496_25503 296
8 3300049569 Ga0501032_0026816 Ga0501032_0026816_2390_3379 300
9 3300049570 Ga0501033_0022701 Ga0501033_0022701_2090_3079 300
10 3300049572 Ga0501036_0030691 Ga0501036_0030691_1905_2894 300
11 3300049573 Ga0501037_0007442 Ga0501037_0007442_4903_5892 300
12 3300049574 Ga0501038_0044559 Ga0501038_0044559_2114_3103 300
13 3300049575 Ga0501039_0009178 Ga0501039_0009178_6130_7119 300
14 3300049580 Ga0501046_0084957 Ga0501046_0084957_426_1415 300
15 3300049581 Ga0501047_0047006 Ga0501047_0047006_1138_2127 300
16 3300049585 Ga0501069_0003466 Ga0501069_0003466_6332_7321 300
17 3300049588 Ga0501072_0116154 Ga0501072_0116154_305_1294 300
18 3300049589 Ga0501073_0007894 Ga0501073_0007894_6483_7472 300
19 3300049742 Ga0501080_0117493 Ga0501080_0117493_861_1850 300
20 3300049744 Ga0501083_0007495 Ga0501083_0007495_5532_6521 300
21 3300049822 Ga0501035_0119818 Ga0501035_0119818_312_1301 300
22 3300049823 Ga0501044_0171526 Ga0501044_0171526_873_1862 300
23 3300049824 Ga0501045_0135648 Ga0501045_0135648_639_1628 300
24 3300054114 Ga0501084_0046476 Ga0501084_0046476_1380_2369 300
25 3300060353 Ga0501082_0004774 Ga0501082_0004774_4791_5780 300
26 3300005981 Ga0081538_10000316 Ga0081538_100003168 301
27 3300032002 Ga0307416_100007153 Ga0307416_1000071534 301
28 3300031344 Ga0265316_10050858 Ga0265316_100508583 302
29 3300031901 Ga0307406_10049495 Ga0307406_100494952 302
30 3300032126 Ga0307415_100023008 Ga0307415_1000230082 302
31 3300044694 Ga0466963_0070730 Ga0466963_0070730_298_1305 302
32 3300049568 Ga0501031_0000523 Ga0501031_0000523_18012_18920 302
33 3300049570 Ga0501033_0077057 Ga0501033_0077057_1310_2218 302
34 3300049572 Ga0501036_0158395 Ga0501036_0158395_374_1282 302
35 3300049574 Ga0501038_0120415 Ga0501038_0120415_988_1896 302
36 3300049575 Ga0501039_0013502 Ga0501039_0013502_1998_2906 302
37 3300049576 Ga0501040_0002372 Ga0501040_0002372_1182_2090 302
38 3300049577 Ga0501041_0016084 Ga0501041_0016084_196_1104 302
39 3300049578 Ga0501042_0011612 Ga0501042_0011612_3965_4873 302
40 3300049579 Ga0501043_0090962 Ga0501043_0090962_1045_1953 302
41 3300049580 Ga0501046_0006008 Ga0501046_0006008_9527_10435 302
42 3300049582 Ga0501048_0058171 Ga0501048_0058171_357_1265 302
43 3300049585 Ga0501069_0006694 Ga0501069_0006694_1745_2653 302
44 3300049586 Ga0501070_0028642 Ga0501070_0028642_3549_4457 302
45 3300049587 Ga0501071_0000721 Ga0501071_0000721_923_1831 302
46 3300049588 Ga0501072_0000861 Ga0501072_0000861_17274_18182 302
47 3300049592 Ga0501076_0001451 Ga0501076_0001451_10838_11746 302
48 3300049593 Ga0501077_0083461 Ga0501077_0083461_987_1895 302
49 3300049741 Ga0501079_0004891 Ga0501079_0004891_3411_4319 302
50 3300049742 Ga0501080_0006646 Ga0501080_0006646_5530_6438 302
51 3300049743 Ga0501081_0014926 Ga0501081_0014926_641_1549 302
52 3300049744 Ga0501083_0043053 Ga0501083_0043053_1428_2336 302
53 3300049822 Ga0501035_0016708 Ga0501035_0016708_2321_3229 302
54 3300054114 Ga0501084_0014280 Ga0501084_0014280_4174_5082 302
55 3300060353 Ga0501082_0006568 Ga0501082_0006568_3576_4484 302
56 3300061734 Ga0530510_0009466 Ga0530510_0009466_5495_6403 302
57 3300005577 Ga0068857_100065380 Ga0068857_1000653802 303
58 3300026116 Ga0207674_10054549 Ga0207674_100545494 303
59 3300044842 Ga0466957_0074080 Ga0466957_0074080_17_1021 303
60 3300046690 Ga0495624_0000417 Ga0495624_0000417_20431_21441 303
61 3300048923 Ga0496120_0024368 Ga0496120_0024368_2390_3394 303
62 3300005614 Ga0068856_100004032 Ga0068856_1000040322 304
63 3300026078 Ga0207702_10000637 Ga0207702_1000063717 304
64 3300048907 Ga0496104_0000015 Ga0496104_0000015_257281_258288 304
65 3300048908 Ga0496105_0000004 Ga0496105_0000004_217511_218518 304
66 3300005564 Ga0070664_100214497 Ga0070664_1002144972 305
67 3300009101 Ga0105247_10155661 Ga0105247_101556612 305
68 3300025944 Ga0207661_10002110 Ga0207661_1000211011 305
69 3300046517 Ga0495630_0000014 Ga0495630_0000014_185868_186878 305
70 3300046681 Ga0495647_0008133 Ga0495647_0008133_19_1029 305
71 3300048905 Ga0496102_0058720 Ga0496102_0058720_1354_2361 305
72 3300048911 Ga0496108_0003280 Ga0496108_0003280_6452_7462 305
73 3300048912 Ga0496109_0000348 Ga0496109_0000348_26097_27107 305
74 3300005338 Ga0068868_100002016 Ga0068868_10000201611 306
75 3300005347 Ga0070668_100014733 Ga0070668_1000147338 306
76 3300013297 Ga0157378_10003241 Ga0157378_100032413 306
77 3300026023 Ga0207677_10001038 Ga0207677_1000103814 306
78 3300045976 Ga0466967_0007296 Ga0466967_0007296_2760_3764 306
79 3300005347 Ga0070668_100012531 Ga0070668_1000125316 307
80 3300005367 Ga0070667_100000603 Ga0070667_10000060316 307
81 3300005843 Ga0068860_100085754 Ga0068860_1000857542 307
82 3300005844 Ga0068862_100002782 Ga0068862_1000027825 307
83 3300005937 Ga0081455_10010756 Ga0081455_100107567 307
84 3300009553 Ga0105249_10003360 Ga0105249_100033603 307
85 3300014968 Ga0157379_10148336 Ga0157379_101483362 307
86 3300025961 Ga0207712_10075298 Ga0207712_100752982 307
87 3300025986 Ga0207658_10003551 Ga0207658_100035515 307
88 3300026067 Ga0207678_10228064 Ga0207678_102280641 307
89 3300028380 Ga0268265_10002889 Ga0268265_1000288915 307
90 3300028381 Ga0268264_10222234 Ga0268264_102222342 307
91 3300048905 Ga0496102_0279465 Ga0496102_0279465_184_1185 307
92 3300049584 Ga0501068_0135433 Ga0501068_0135433_148_1125 307
93 3300049591 Ga0501075_0369303 Ga0501075_0369303_13_990 307
94 3300060353 Ga0501082_0122044 Ga0501082_0122044_432_1409 307
95 3300009148 Ga0105243_10007118 Ga0105243_100071189 308
96 3300025935 Ga0207709_10005457 Ga0207709_100054571 308
97 3300046536 Ga0495587_0003966 Ga0495587_0003966_840_1847 308
98 3300005985 Ga0081539_10003483 Ga0081539_1000348316 309
99 3300049588 Ga0501072_0030329 Ga0501072_0030329_625_1638 309
100 3300005335 Ga0070666_10005854 Ga0070666_100058542 311
101 3300028379 Ga0268266_10001254 Ga0268266_1000125428 311
102 3300046543 Ga0495645_0027447 Ga0495645_0027447_2590_3597 311
103 3300048927 Ga0496124_0051640 Ga0496124_0051640_2305_3309 311
104 3300005549 Ga0070704_100062477 Ga0070704_1000624773 312
105 3300048922 Ga0496119_0104486 Ga0496119_0104486_212_1219 312
106 3300050490 nmdc:mga03n38_41860_c1 nmdc:mga03n38_41860_c1_492_1481 312
107 3300005356 Ga0070674_100124738 Ga0070674_1001247382 313
108 3300009147 Ga0114129_10001353 Ga0114129_1000135322 313
109 3300013308 Ga0157375_10436619 Ga0157375_104366192 313
110 3300025937 Ga0207669_10178961 Ga0207669_101789612 313
111 3300025945 Ga0207679_10215838 Ga0207679_102158382 313
112 3300046514 Ga0495618_0000014 Ga0495618_0000014_111627_112634 313
113 3300047469 Ga0495673_0072568 Ga0495673_0072568_90_1091 313
114 3300003323 rootH1_10002124 rootH1_100021244 314
115 3300005364 Ga0070673_100006402 Ga0070673_1000064025 314
116 3300005985 Ga0081539_10000878 Ga0081539_100008788 314
117 3300013104 Ga0157370_10047400 Ga0157370_100474004 314
118 3300049575 Ga0501039_0173382 Ga0501039_0173382_148_1101 314
119 3300060353 Ga0501082_0091634 Ga0501082_0091634_1273_2265 314
120 3300048907 Ga0496104_0049764 Ga0496104_0049764_1654_2658 315
121 3300048922 Ga0496119_0066967 Ga0496119_0066967_671_1675 315
122 3300005354 Ga0070675_100000036 Ga0070675_10000003671 316
123 3300005981 Ga0081538_10000812 Ga0081538_1000081236 316
124 3300009147 Ga0114129_10112386 Ga0114129_101123864 316
125 3300025926 Ga0207659_10000013 Ga0207659_1000001389 316
126 3300046533 Ga0495640_0091728 Ga0495640_0091728_266_1273 316
127 3300046660 Ga0495625_0076676 Ga0495625_0076676_956_1960 316
128 3300047319 Ga0495674_0000030 Ga0495674_0000030_9983_10990 316
129 3300047472 Ga0495686_0097769 Ga0495686_0097769_433_1440 316
130 3300048925 Ga0496122_0041994 Ga0496122_0041994_109_1098 316
131 3300050507 nmdc:mga05p37_70480_c1 nmdc:mga05p37_70480_c1_1091_2092 316
132 3300053104 Ga0500556_0000723 Ga0500556_0000723_11186_12175 316
133 3300053153 Ga0500616_0003272 Ga0500616_0003272_7617_8606 316
134 3300001979 JGI24740J21852_10010068 JGI24740J21852_100100684 317
135 3300006847 Ga0075431_100072846 Ga0075431_1000728462 317
136 3300006871 Ga0075434_100027126 Ga0075434_1000271264 317
137 3300006914 Ga0075436_100079950 Ga0075436_1000799502 317
138 3300009094 Ga0111539_10070367 Ga0111539_100703672 317
139 3300013297 Ga0157378_10040737 Ga0157378_100407374 317
140 3300038443 Ga0395901_0053141 Ga0395901_0053141_2525_3526 317
141 3300049575 Ga0501039_0355897 Ga0501039_0355897_61_1062 317
142 3300050511 nmdc:mga08y16_94149_c1 nmdc:mga08y16_94149_c1_1261_2259 317
143 3300050515 nmdc:mga0a205_15449_c1 nmdc:mga0a205_15449_c1_1958_2956 317
144 3300011119 Ga0105246_10107799 Ga0105246_101077993 318
145 3300031727 Ga0316576_10015088 Ga0316576_100150885 318
146 3300036712 Ga0316584_0001782 Ga0316584_0001782_1606_2616 318
147 3300006038 Ga0075365_10230635 Ga0075365_102306351 319
148 3300005985 Ga0081539_10024074 Ga0081539_100240744 320
149 3300006871 Ga0075434_100043274 Ga0075434_1000432742 320
150 3300048904 Ga0496101_0211132 Ga0496101_0211132_333_1340 320
151 3300048905 Ga0496102_0340303 Ga0496102_0340303_361_1368 320
152 3300048912 Ga0496109_0000942 Ga0496109_0000942_14962_15963 320
153 3300048912 Ga0496109_0039321 Ga0496109_0039321_2841_3809 320
154 3300048913 Ga0496110_0102704 Ga0496110_0102704_221_1189 320
155 3300048915 Ga0496112_0409451 Ga0496112_0409451_302_1270 320
156 3300050512 nmdc:mga0n895_326505_c1 nmdc:mga0n895_326505_c1_79_1086 320
157 3300050515 nmdc:mga0a205_142921_c1 nmdc:mga0a205_142921_c1_195_1202 320
158 3300005341 Ga0070691_10000524 Ga0070691_1000052411 321
159 3300005356 Ga0070674_100000012 Ga0070674_10000001232 321
160 3300005547 Ga0070693_100003731 Ga0070693_1000037315 321
161 3300009098 Ga0105245_10001311 Ga0105245_1000131123 321
162 3300009147 Ga0114129_10692375 Ga0114129_106923751 321
163 3300025899 Ga0207642_10000080 Ga0207642_1000008014 321
164 3300025927 Ga0207687_10000032 Ga0207687_1000003218 321
165 3300025937 Ga0207669_10000017 Ga0207669_1000001717 321
166 3300031903 Ga0307407_10038141 Ga0307407_100381412 321
167 3300046511 Ga0495608_0094331 Ga0495608_0094331_778_1779 321
168 3300046684 Ga0495669_0000113 Ga0495669_0000113_27747_28748 321
169 3300048903 Ga0496100_0000013 Ga0496100_0000013_62778_63779 321
170 3300048904 Ga0496101_0000035 Ga0496101_0000035_62778_63779 321
171 3300048909 Ga0496106_0000121 Ga0496106_0000121_32679_33680 321
172 3300048910 Ga0496107_0000020 Ga0496107_0000020_33927_34928 321
173 3300048915 Ga0496112_0282194 Ga0496112_0282194_41_1012 321
174 3300049592 Ga0501076_0029982 Ga0501076_0029982_946_1953 321
175 3300005535 Ga0070684_100052595 Ga0070684_1000525954 322
176 3300005578 Ga0068854_100001203 Ga0068854_10000120316 322
177 3300005614 Ga0068856_100250189 Ga0068856_1002501892 322
178 3300005834 Ga0068851_10001260 Ga0068851_100012602 322
179 3300005937 Ga0081455_10049005 Ga0081455_100490053 322
180 3300009553 Ga0105249_10000143 Ga0105249_1000014372 322
181 3300025321 Ga0207656_10000226 Ga0207656_1000022613 322
182 3300025961 Ga0207712_10000058 Ga0207712_10000058122 322
183 3300025981 Ga0207640_10000093 Ga0207640_1000009327 322
184 3300044694 Ga0466963_0000017 Ga0466963_0000017_22897_23901 322
185 3300046455 Ga0495603_0001350 Ga0495603_0001350_10178_11173 322
186 3300046683 Ga0495658_0019725 Ga0495658_0019725_2373_3380 322
187 3300048907 Ga0496104_0000052 Ga0496104_0000052_26777_27781 322
188 3300048908 Ga0496105_0000030 Ga0496105_0000030_109545_110549 322
189 3300048908 Ga0496105_0027673 Ga0496105_0027673_159_1166 322
190 3300048911 Ga0496108_0000006 Ga0496108_0000006_344519_345523 322
191 3300048912 Ga0496109_0000009 Ga0496109_0000009_111607_112611 322
192 3300048913 Ga0496110_0002164 Ga0496110_0002164_6227_7234 322
193 3300048914 Ga0496111_0000044 Ga0496111_0000044_30153_31160 322
194 3300050514 nmdc:mga08x19_126213_c1 nmdc:mga08x19_126213_c1_410_1414 322
195 3300053085 Ga0495619_0000102 Ga0495619_0000102_46070_47077 322
196 3300005333 Ga0070677_10000008 Ga0070677_1000000877 323
197 3300005338 Ga0068868_100000141 Ga0068868_10000014139 323
198 3300005344 Ga0070661_100000099 Ga0070661_1000000998 323
199 3300005441 Ga0070700_100283756 Ga0070700_1002837561 323
200 3300005457 Ga0070662_100000002 Ga0070662_100000002227 323
201 3300005458 Ga0070681_10084184 Ga0070681_100841842 323
202 3300005466 Ga0070685_10000674 Ga0070685_1000067411 323
203 3300005530 Ga0070679_100005826 Ga0070679_10000582611 323
204 3300005539 Ga0068853_100083524 Ga0068853_1000835241 323
205 3300005548 Ga0070665_100000135 Ga0070665_10000013521 323
206 3300005548 Ga0070665_100081770 Ga0070665_1000817703 323
207 3300005578 Ga0068854_100056337 Ga0068854_1000563373 323
208 3300005618 Ga0068864_100000015 Ga0068864_100000015197 323
209 3300005841 Ga0068863_100000022 Ga0068863_10000002269 323
210 3300006852 Ga0075433_10033900 Ga0075433_100339002 323
211 3300009098 Ga0105245_10000415 Ga0105245_100004156 323
212 3300009101 Ga0105247_10001706 Ga0105247_1000170613 323
213 3300009176 Ga0105242_10000653 Ga0105242_1000065317 323
214 3300013104 Ga0157370_10003254 Ga0157370_1000325414 323
215 3300014325 Ga0163163_10113198 Ga0163163_101131983 323
216 3300014326 Ga0157380_10000236 Ga0157380_100002362 323
217 3300017792 Ga0163161_10000053 Ga0163161_10000053121 323
218 3300025893 Ga0207682_10010613 Ga0207682_100106132 323
219 3300025900 Ga0207710_10000157 Ga0207710_1000015766 323
220 3300025915 Ga0207693_10103235 Ga0207693_101032353 323
221 3300025920 Ga0207649_10000127 Ga0207649_1000012763 323
222 3300025921 Ga0207652_10001733 Ga0207652_1000173311 323
223 3300025927 Ga0207687_10000460 Ga0207687_100004603 323
224 3300025933 Ga0207706_10000001 Ga0207706_10000001408 323
225 3300025934 Ga0207686_10000921 Ga0207686_100009218 323
226 3300025944 Ga0207661_10004460 Ga0207661_100044603 323
227 3300025981 Ga0207640_10034577 Ga0207640_100345773 323
228 3300026041 Ga0207639_10005999 Ga0207639_100059993 323
229 3300026088 Ga0207641_10000016 Ga0207641_10000016190 323
230 3300026095 Ga0207676_10000018 Ga0207676_10000018103 323
231 3300028379 Ga0268266_10000056 Ga0268266_10000056170 323
232 3300035172 Ga0373955_0147652 Ga0373955_0147652_59_1066 323
233 3300046454 Ga0495592_0000607 Ga0495592_0000607_21106_22113 323
234 3300046455 Ga0495603_0000286 Ga0495603_0000286_17885_18892 323
235 3300046459 Ga0495629_0000245 Ga0495629_0000245_36167_37177 323
236 3300046461 Ga0495641_0000005 Ga0495641_0000005_181447_182454 323
237 3300046476 Ga0495662_0000001 Ga0495662_0000001_22578_23585 323
238 3300046514 Ga0495618_0167218 Ga0495618_0167218_161_1168 323
239 3300046515 Ga0495620_0000784 Ga0495620_0000784_2265_3272 323
240 3300046516 Ga0495628_0023790 Ga0495628_0023790_174_1181 323
241 3300046523 Ga0495644_0001871 Ga0495644_0001871_1816_2823 323
242 3300046535 Ga0495586_0003054 Ga0495586_0003054_7869_8876 323
243 3300046559 Ga0495667_0000020 Ga0495667_0000020_64176_65183 323
244 3300046615 Ga0495656_0000465 Ga0495656_0000465_5817_6824 323
245 3300046616 Ga0495668_0041252 Ga0495668_0041252_1043_2050 323
246 3300046642 Ga0495634_0000028 Ga0495634_0000028_7487_8494 323
247 3300046660 Ga0495625_0000349 Ga0495625_0000349_52013_53020 323
248 3300046663 Ga0495635_0000076 Ga0495635_0000076_3435_4442 323
249 3300046675 Ga0495657_0017364 Ga0495657_0017364_2974_3981 323
250 3300046678 Ga0495599_0036072 Ga0495599_0036072_557_1564 323
251 3300046680 Ga0495646_0106600 Ga0495646_0106600_197_1204 323
252 3300046690 Ga0495624_0033290 Ga0495624_0033290_879_1886 323
253 3300046694 Ga0495649_0002403 Ga0495649_0002403_4163_5170 323
254 3300047322 Ga0495680_0000143 Ga0495680_0000143_7551_8558 323
255 3300047322 Ga0495680_0001430 Ga0495680_0001430_4113_5120 323
256 3300048088 Ga0495602_0001031 Ga0495602_0001031_16550_17557 323
257 3300048909 Ga0496106_0004512 Ga0496106_0004512_8063_9070 323
258 3300048912 Ga0496109_0003361 Ga0496109_0003361_7884_8891 323
259 3300049578 Ga0501042_0252330 Ga0501042_0252330_186_1193 323
260 3300050515 nmdc:mga0a205_43_c1 nmdc:mga0a205_43_c1_44367_45374 323
261 3300053077 Ga0495601_0000060 Ga0495601_0000060_29428_30435 323
262 3300053077 Ga0495601_0200353 Ga0495601_0200353_74_1081 323
263 3300053078 Ga0495612_0003484 Ga0495612_0003484_3636_4646 323
264 3300053078 Ga0495612_0005082 Ga0495612_0005082_373_1383 323
265 3300053084 Ga0495595_0000045 Ga0495595_0000045_24003_25010 323
266 3300053085 Ga0495619_0000008 Ga0495619_0000008_190230_191237 323
267 3300053096 Ga0500641_0001622 Ga0500641_0001622_6129_7136 323
268 3300053123 Ga0500614_001424 Ga0500614_001424_346_1353 323
269 3300001977 JGI24746J21847_1000760 JGI24746J21847_10007605 324
270 3300005331 Ga0070670_100073330 Ga0070670_1000733302 324
271 3300005365 Ga0070688_100000071 Ga0070688_10000007139 324
272 3300005439 Ga0070711_100008252 Ga0070711_1000082524 324
273 3300005466 Ga0070685_10000020 Ga0070685_1000002074 324
274 3300005543 Ga0070672_100000001 Ga0070672_10000000199 324
275 3300005614 Ga0068856_100266325 Ga0068856_1002663252 324
276 3300005616 Ga0068852_100000002 Ga0068852_100000002247 324
277 3300009098 Ga0105245_10000278 Ga0105245_100002789 324
278 3300009551 Ga0105238_10000055 Ga0105238_1000005519 324
279 3300013102 Ga0157371_10001577 Ga0157371_100015772 324
280 3300013104 Ga0157370_10269346 Ga0157370_102693462 324
281 3300013105 Ga0157369_10000074 Ga0157369_1000007428 324
282 3300013105 Ga0157369_10276762 Ga0157369_102767622 324
283 3300013296 Ga0157374_10000486 Ga0157374_1000048617 324
284 3300013307 Ga0157372_10000053 Ga0157372_1000005327 324
285 3300014969 Ga0157376_10027214 Ga0157376_100272144 324
286 3300025924 Ga0207694_10000063 Ga0207694_10000063122 324
287 3300025925 Ga0207650_10091138 Ga0207650_100911382 324
288 3300025927 Ga0207687_10000036 Ga0207687_10000036122 324
289 3300025927 Ga0207687_10003112 Ga0207687_100031123 324
290 3300025940 Ga0207691_10000017 Ga0207691_1000001726 324
291 3300026078 Ga0207702_10223666 Ga0207702_102236662 324
292 3300026142 Ga0207698_10000004 Ga0207698_1000000438 324
293 3300028556 Ga0265337_1000066 Ga0265337_100006619 324
294 3300028558 Ga0265326_10000019 Ga0265326_10000019139 324
295 3300028563 Ga0265319_1000469 Ga0265319_100046921 324
296 3300028654 Ga0265322_10000011 Ga0265322_10000011139 324
297 3300028800 Ga0265338_10000244 Ga0265338_1000024489 324
298 3300029957 Ga0265324_10000283 Ga0265324_1000028321 324
299 3300031238 Ga0265332_10061866 Ga0265332_100618662 324
300 3300031239 Ga0265328_10000737 Ga0265328_1000073716 324
301 3300031240 Ga0265320_10000011 Ga0265320_10000011139 324
302 3300031242 Ga0265329_10016232 Ga0265329_100162322 324
303 3300031250 Ga0265331_10000858 Ga0265331_1000085817 324
304 3300031250 Ga0265331_10047145 Ga0265331_100471451 324
305 3300031251 Ga0265327_10000015 Ga0265327_10000015247 324
306 3300031344 Ga0265316_10047188 Ga0265316_100471882 324
307 3300031711 Ga0265314_10000640 Ga0265314_1000064038 324
308 3300037466 Ga0395898_0235746 Ga0395898_0235746_272_1270 324
309 3300044842 Ga0466957_0001414 Ga0466957_0001414_7153_8160 324
310 3300045836 Ga0466958_0010414 Ga0466958_0010414_590_1597 324
311 3300045976 Ga0466967_0000001 Ga0466967_0000001_116642_117649 324
312 3300046473 Ga0495582_0000001 Ga0495582_0000001_74697_75704 324
313 3300046476 Ga0495662_0000848 Ga0495662_0000848_10763_11770 324
314 3300046511 Ga0495608_0000007 Ga0495608_0000007_123886_124893 324
315 3300046517 Ga0495630_0000533 Ga0495630_0000533_5691_6698 324
316 3300046517 Ga0495630_0003407 Ga0495630_0003407_6317_7324 324
317 3300046642 Ga0495634_0113592 Ga0495634_0113592_473_1480 324
318 3300046675 Ga0495657_0000001 Ga0495657_0000001_256032_257039 324
319 3300046681 Ga0495647_0000001 Ga0495647_0000001_107067_108074 324
320 3300046683 Ga0495658_0000002 Ga0495658_0000002_198303_199310 324
321 3300046689 Ga0495613_0000005 Ga0495613_0000005_103457_104464 324
322 3300046690 Ga0495624_0000019 Ga0495624_0000019_101179_102186 324
323 3300047317 Ga0495604_0001251 Ga0495604_0001251_8221_9231 324
324 3300047320 Ga0495672_0068475 Ga0495672_0068475_167_1177 324
325 3300047444 Ga0495675_0001421 Ga0495675_0001421_7661_8668 324
326 3300048907 Ga0496104_0000765 Ga0496104_0000765_24586_25593 324
327 3300048908 Ga0496105_0000409 Ga0496105_0000409_11726_12733 324
328 3300053077 Ga0495601_0025379 Ga0495601_0025379_391_1398 324
329 3300053084 Ga0495595_0000002 Ga0495595_0000002_188603_189610 324
330 3300053085 Ga0495619_0000095 Ga0495619_0000095_5843_6850 324
331 3300053085 Ga0495619_0000195 Ga0495619_0000195_293_1300 324
332 3300053085 Ga0495619_0000320 Ga0495619_0000320_13012_14019 324
333 3300053085 Ga0495619_0010358 Ga0495619_0010358_1816_2823 324
334 3300005459 Ga0068867_100005480 Ga0068867_10000548011 325
335 3300006852 Ga0075433_10000897 Ga0075433_100008979 325
336 3300006881 Ga0068865_100000082 Ga0068865_10000008227 325
337 3300009177 Ga0105248_10000020 Ga0105248_10000020124 325
338 3300025938 Ga0207704_10000184 Ga0207704_1000018421 325
339 3300025941 Ga0207711_10000006 Ga0207711_10000006252 325
340 3300026089 Ga0207648_10100881 Ga0207648_101008812 325
341 3300049568 Ga0501031_0192515 Ga0501031_0192515_247_1239 325
342 3300049571 Ga0501034_0016892 Ga0501034_0016892_6269_7285 325
343 3300049571 Ga0501034_0200589 Ga0501034_0200589_185_1201 325
344 3300049573 Ga0501037_0160448 Ga0501037_0160448_238_1230 325
345 3300049575 Ga0501039_0013344 Ga0501039_0013344_586_1578 325
346 3300049575 Ga0501039_0152073 Ga0501039_0152073_254_1246 325
347 3300049576 Ga0501040_0002837 Ga0501040_0002837_3379_4371 325
348 3300049576 Ga0501040_0090694 Ga0501040_0090694_697_1692 325
349 3300049577 Ga0501041_0017928 Ga0501041_0017928_2388_3380 325
350 3300049577 Ga0501041_0227064 Ga0501041_0227064_14_1006 325
351 3300049578 Ga0501042_0018999 Ga0501042_0018999_703_1695 325
352 3300049579 Ga0501043_0159126 Ga0501043_0159126_13_1029 325
353 3300049580 Ga0501046_0079832 Ga0501046_0079832_1300_2292 325
354 3300049582 Ga0501048_0009218 Ga0501048_0009218_5941_6933 325
355 3300049587 Ga0501071_0010365 Ga0501071_0010365_946_1938 325
356 3300049588 Ga0501072_0019616 Ga0501072_0019616_3382_4374 325
357 3300049590 Ga0501074_0034411 Ga0501074_0034411_269_1261 325
358 3300049590 Ga0501074_0113146 Ga0501074_0113146_183_1178 325
359 3300049591 Ga0501075_0007586 Ga0501075_0007586_3670_4662 325
360 3300049591 Ga0501075_0133564 Ga0501075_0133564_461_1453 325
361 3300049592 Ga0501076_0003612 Ga0501076_0003612_1672_2664 325
362 3300049592 Ga0501076_0180083 Ga0501076_0180083_441_1436 325
363 3300049593 Ga0501077_0030258 Ga0501077_0030258_1354_2346 325
364 3300049742 Ga0501080_0062326 Ga0501080_0062326_948_1940 325
365 3300049822 Ga0501035_0079660 Ga0501035_0079660_1627_2619 325
366 3300049822 Ga0501035_0192751 Ga0501035_0192751_27_1043 325
367 3300049824 Ga0501045_0011542 Ga0501045_0011542_3673_4665 325
368 3300050507 nmdc:mga05p37_69258_c1 nmdc:mga05p37_69258_c1_1615_2607 325
369 3300050515 nmdc:mga0a205_53_c2 nmdc:mga0a205_53_c2_11357_12364 325
370 3300054114 Ga0501084_0044771 Ga0501084_0044771_1846_2841 325
371 3300060353 Ga0501082_0297438 Ga0501082_0297438_101_1093 325
372 3300061734 Ga0530510_0050397 Ga0530510_0050397_273_1265 325
373 3300005937 Ga0081455_10021412 Ga0081455_100214124 326
374 3300005981 Ga0081538_10030544 Ga0081538_100305441 326
375 3300006038 Ga0075365_10018720 Ga0075365_100187203 326
376 3300006038 Ga0075365_10116029 Ga0075365_101160292 326
377 3300006844 Ga0075428_100082957 Ga0075428_1000829572 326
378 3300006846 Ga0075430_100053196 Ga0075430_1000531964 326
379 3300006847 Ga0075431_100018318 Ga0075431_10001831810 326
380 3300009147 Ga0114129_10251406 Ga0114129_102514062 326
381 3300049587 Ga0501071_0169999 Ga0501071_0169999_560_1567 326
382 3300050491 nmdc:mga00v17_51630_c2 nmdc:mga00v17_51630_c2_685_1701 326
383 3300050492 nmdc:mga0yw44_97687_c1 nmdc:mga0yw44_97687_c1_396_1412 326
384 3300044693 Ga0466961_0114035 Ga0466961_0114035_24_1013 327
385 3300044842 Ga0466957_0125696 Ga0466957_0125696_50_1039 327
386 3300005937 Ga0081455_10005716 Ga0081455_100057162 328
387 3300005981 Ga0081538_10008324 Ga0081538_100083243 328
388 3300005981 Ga0081538_10089786 Ga0081538_100897861 328
389 3300006038 Ga0075365_10007560 Ga0075365_100075603 328
390 3300009176 Ga0105242_10417403 Ga0105242_104174031 328
391 3300013306 Ga0163162_10120085 Ga0163162_101200852 328
392 3300014968 Ga0157379_10030707 Ga0157379_100307074 328
393 3300044694 Ga0466963_0285886 Ga0466963_0285886_65_1063 328
394 3300045976 Ga0466967_0025483 Ga0466967_0025483_3379_4374 328
395 3300046471 Ga0495650_0000054 Ga0495650_0000054_124483_125481 328
396 3300046516 Ga0495628_0066303 Ga0495628_0066303_1763_2776 328
397 3300046538 Ga0495609_0091426 Ga0495609_0091426_13_1005 328
398 3300047673 Ga0495593_0039645 Ga0495593_0039645_503_1519 328
399 3300048905 Ga0496102_0010565 Ga0496102_0010565_1410_2411 328
400 3300048919 Ga0496116_0000848 Ga0496116_0000848_9741_10742 328
401 3300048920 Ga0496117_0009784 Ga0496117_0009784_5182_6183 328
402 3300048924 Ga0496121_0013496 Ga0496121_0013496_4973_5971 328
403 3300048927 Ga0496124_0183177 Ga0496124_0183177_41_1039 328
404 3300048928 Ga0496125_0071032 Ga0496125_0071032_491_1492 328
405 3300049572 Ga0501036_0022928 Ga0501036_0022928_1239_2231 328
406 3300049581 Ga0501047_0010850 Ga0501047_0010850_5211_6212 328
407 3300049744 Ga0501083_0003895 Ga0501083_0003895_5619_6620 328
408 3300050491 nmdc:mga00v17_71968_c2 nmdc:mga00v17_71968_c2_53_1078 328
409 3300050492 nmdc:mga0yw44_589_c1 nmdc:mga0yw44_589_c1_8953_9978 328
410 3300053078 Ga0495612_0000210 Ga0495612_0000210_9272_10285 328
411 3300053085 Ga0495619_0053306 Ga0495619_0053306_1332_2348 328
412 3300053153 Ga0500616_0016529 Ga0500616_0016529_2091_3089 328
413 3300003373 JGI25407J50210_10007507 JGI25407J50210_100075072 329
414 3300005327 Ga0070658_10270672 Ga0070658_102706721 329
415 3300005339 Ga0070660_100003750 Ga0070660_1000037507 329
416 3300005347 Ga0070668_100035872 Ga0070668_1000358724 329
417 3300005455 Ga0070663_100001716 Ga0070663_1000017161 329
418 3300005456 Ga0070678_100061536 Ga0070678_1000615362 329
419 3300005530 Ga0070679_100021006 Ga0070679_1000210067 329
420 3300005547 Ga0070693_100167441 Ga0070693_1001674411 329
421 3300005548 Ga0070665_100005405 Ga0070665_1000054053 329
422 3300005549 Ga0070704_100146231 Ga0070704_1001462311 329
423 3300005614 Ga0068856_100157815 Ga0068856_1001578152 329
424 3300005981 Ga0081538_10000486 Ga0081538_1000048632 329
425 3300005981 Ga0081538_10025117 Ga0081538_100251172 329
426 3300005983 Ga0081540_1000706 Ga0081540_100070626 329
427 3300005983 Ga0081540_1046023 Ga0081540_10460232 329
428 3300005985 Ga0081539_10008209 Ga0081539_100082095 329
429 3300006163 Ga0070715_10000021 Ga0070715_100000215 329
430 3300006846 Ga0075430_100002367 Ga0075430_10000236710 329
431 3300006847 Ga0075431_100023074 Ga0075431_1000230743 329
432 3300006847 Ga0075431_100163972 Ga0075431_1001639722 329
433 3300006852 Ga0075433_10131035 Ga0075433_101310352 329
434 3300009094 Ga0111539_10100345 Ga0111539_101003453 329
435 3300009098 Ga0105245_10011891 Ga0105245_100118914 329
436 3300009147 Ga0114129_10032936 Ga0114129_100329362 329
437 3300009545 Ga0105237_10408162 Ga0105237_104081621 329
438 3300009553 Ga0105249_10007747 Ga0105249_100077472 329
439 3300013306 Ga0163162_10034394 Ga0163162_100343943 329
440 3300013307 Ga0157372_10148694 Ga0157372_101486943 329
441 3300014326 Ga0157380_10000016 Ga0157380_10000016101 329
442 3300025905 Ga0207685_10000054 Ga0207685_1000005415 329
443 3300025909 Ga0207705_10290817 Ga0207705_102908171 329
444 3300025911 Ga0207654_10057938 Ga0207654_100579383 329
445 3300025919 Ga0207657_10004340 Ga0207657_1000434011 329
446 3300025919 Ga0207657_10015215 Ga0207657_100152154 329
447 3300025921 Ga0207652_10000321 Ga0207652_1000032137 329
448 3300025921 Ga0207652_10312844 Ga0207652_103128442 329
449 3300025961 Ga0207712_10277264 Ga0207712_102772642 329
450 3300025972 Ga0207668_10071280 Ga0207668_100712802 329
451 3300025981 Ga0207640_10171236 Ga0207640_101712361 329
452 3300025981 Ga0207640_10228930 Ga0207640_102289301 329
453 3300025986 Ga0207658_10023672 Ga0207658_100236725 329
454 3300026067 Ga0207678_10002224 Ga0207678_100022247 329
455 3300026078 Ga0207702_10426774 Ga0207702_104267741 329
456 3300026118 Ga0207675_100043378 Ga0207675_1000433782 329
457 3300027907 Ga0207428_10065295 Ga0207428_100652951 329
458 3300031548 Ga0307408_100103118 Ga0307408_1001031182 329
459 3300031731 Ga0307405_10080241 Ga0307405_100802412 329
460 3300031852 Ga0307410_10068378 Ga0307410_100683782 329
461 3300031901 Ga0307406_10014323 Ga0307406_100143232 329
462 3300031901 Ga0307406_10270804 Ga0307406_102708041 329
463 3300031995 Ga0307409_100141139 Ga0307409_1001411392 329
464 3300032002 Ga0307416_100054463 Ga0307416_1000544633 329
465 3300032002 Ga0307416_100073654 Ga0307416_1000736542 329
466 3300032002 Ga0307416_100102545 Ga0307416_1001025451 329
467 3300032002 Ga0307416_100380160 Ga0307416_1003801602 329
468 3300032004 Ga0307414_10041832 Ga0307414_100418323 329
469 3300032126 Ga0307415_100004435 Ga0307415_1000044354 329
470 3300032126 Ga0307415_100027919 Ga0307415_1000279192 329
471 3300032126 Ga0307415_100095665 Ga0307415_1000956654 329
472 3300035090 Ga0373949_0009952 Ga0373949_0009952_835_1842 329
473 3300037068 Ga0373925_0118482 Ga0373925_0118482_778_1791 329
474 3300037418 Ga0395900_0105892 Ga0395900_0105892_976_1971 329
475 3300037418 Ga0395900_0223900 Ga0395900_0223900_798_1805 329
476 3300037466 Ga0395898_0026411 Ga0395898_0026411_2990_3985 329
477 3300037466 Ga0395898_0092869 Ga0395898_0092869_20_1030 329
478 3300037471 Ga0395905_0246814 Ga0395905_0246814_538_1545 329
479 3300038443 Ga0395901_0004095 Ga0395901_0004095_5545_6540 329
480 3300042016 Ga0439463_010194 Ga0439463_010194_896_1891 329
481 3300042437 Ga0439444_0016827 Ga0439444_0016827_212_1207 329
482 3300044735 Ga0466968_0074169 Ga0466968_0074169_332_1327 329
483 3300044901 Ga0466960_0074615 Ga0466960_0074615_644_1651 329
484 3300045976 Ga0466967_0010090 Ga0466967_0010090_505_1512 329
485 3300046455 Ga0495603_0122584 Ga0495603_0122584_294_1307 329
486 3300046473 Ga0495582_0098596 Ga0495582_0098596_226_1239 329
487 3300046528 Ga0495642_0081004 Ga0495642_0081004_49_1062 329
488 3300046615 Ga0495656_0077512 Ga0495656_0077512_352_1359 329
489 3300047321 Ga0495676_0057606 Ga0495676_0057606_697_1710 329
490 3300048905 Ga0496102_0145284 Ga0496102_0145284_650_1666 329
491 3300048907 Ga0496104_0120640 Ga0496104_0120640_441_1454 329
492 3300048909 Ga0496106_0006748 Ga0496106_0006748_1473_2489 329
493 3300048911 Ga0496108_0025146 Ga0496108_0025146_650_1663 329
494 3300048911 Ga0496108_0108936 Ga0496108_0108936_455_1465 329
495 3300048912 Ga0496109_0057511 Ga0496109_0057511_1423_2436 329
496 3300048913 Ga0496110_0037796 Ga0496110_0037796_3138_4148 329
497 3300048913 Ga0496110_0062843 Ga0496110_0062843_1777_2790 329
498 3300048914 Ga0496111_0025522 Ga0496111_0025522_1195_2208 329
499 3300048915 Ga0496112_0000025 Ga0496112_0000025_112479_113483 329
500 3300048916 Ga0496113_0020234 Ga0496113_0020234_936_1946 329
501 3300048916 Ga0496113_0024871 Ga0496113_0024871_862_1875 329
502 3300048927 Ga0496124_0159321 Ga0496124_0159321_157_1161 329
503 3300048929 Ga0496126_0019594 Ga0496126_0019594_1014_2018 329
504 3300049568 Ga0501031_0002175 Ga0501031_0002175_6519_7523 329
505 3300049569 Ga0501032_0011222 Ga0501032_0011222_4983_5987 329
506 3300049570 Ga0501033_0003689 Ga0501033_0003689_6510_7514 329
507 3300049571 Ga0501034_0016227 Ga0501034_0016227_2448_3449 329
508 3300049572 Ga0501036_0114656 Ga0501036_0114656_79_1074 329
509 3300049573 Ga0501037_0002926 Ga0501037_0002926_6519_7523 329
510 3300049574 Ga0501038_0005058 Ga0501038_0005058_6519_7523 329
511 3300049575 Ga0501039_0126956 Ga0501039_0126956_575_1570 329
512 3300049576 Ga0501040_0153891 Ga0501040_0153891_326_1321 329
513 3300049577 Ga0501041_0027445 Ga0501041_0027445_2199_3194 329
514 3300049578 Ga0501042_0012872 Ga0501042_0012872_639_1643 329
515 3300049580 Ga0501046_0004559 Ga0501046_0004559_5037_6041 329
516 3300049581 Ga0501047_0004952 Ga0501047_0004952_4988_5992 329
517 3300049581 Ga0501047_0148155 Ga0501047_0148155_159_1163 329
518 3300049581 Ga0501047_0176579 Ga0501047_0176579_670_1674 329
519 3300049582 Ga0501048_0003128 Ga0501048_0003128_4914_5918 329
520 3300049584 Ga0501068_0002345 Ga0501068_0002345_1919_2923 329
521 3300049585 Ga0501069_0075472 Ga0501069_0075472_195_1199 329
522 3300049586 Ga0501070_0004064 Ga0501070_0004064_5053_6057 329
523 3300049587 Ga0501071_0056805 Ga0501071_0056805_556_1551 329
524 3300049587 Ga0501071_0132089 Ga0501071_0132089_806_1810 329
525 3300049588 Ga0501072_0017464 Ga0501072_0017464_2139_3143 329
526 3300049588 Ga0501072_0043596 Ga0501072_0043596_1301_2296 329
527 3300049589 Ga0501073_0012127 Ga0501073_0012127_4759_5763 329
528 3300049590 Ga0501074_0018921 Ga0501074_0018921_2672_3676 329
529 3300049592 Ga0501076_0048517 Ga0501076_0048517_1468_2463 329
530 3300049741 Ga0501079_0080440 Ga0501079_0080440_1334_2338 329
531 3300049742 Ga0501080_0030783 Ga0501080_0030783_3457_4461 329
532 3300049743 Ga0501081_0025371 Ga0501081_0025371_397_1392 329
533 3300049744 Ga0501083_0002614 Ga0501083_0002614_4890_5894 329
534 3300049822 Ga0501035_0005116 Ga0501035_0005116_4898_5902 329
535 3300049823 Ga0501044_0006919 Ga0501044_0006919_4961_5965 329
536 3300049824 Ga0501045_0011031 Ga0501045_0011031_4764_5759 329
537 3300050507 nmdc:mga05p37_114066_c1 nmdc:mga05p37_114066_c1_894_1886 329
538 3300050507 nmdc:mga05p37_51957_c1 nmdc:mga05p37_51957_c1_3488_4480 329
539 3300050509 nmdc:mga0qj67_26043_c1 nmdc:mga0qj67_26043_c1_2818_3810 329
540 3300050509 nmdc:mga0qj67_6768_c1 nmdc:mga0qj67_6768_c1_3590_4606 329
541 3300050510 nmdc:mga06r32_20441_c1 nmdc:mga06r32_20441_c1_3710_4726 329
542 3300050511 nmdc:mga08y16_130720_c1 nmdc:mga08y16_130720_c1_986_1978 329
543 3300050512 nmdc:mga0n895_209759_c1 nmdc:mga0n895_209759_c1_627_1634 329
544 3300060353 Ga0501082_0081193 Ga0501082_0081193_202_1197 329
545 3300060353 Ga0501082_0355486 Ga0501082_0355486_112_1107 329
546 3300002074 JGI24748J21848_1000727 JGI24748J21848_10007272 330
547 3300002239 JGI24034J26672_10001507 JGI24034J26672_100015072 330
548 3300002244 JGI24742J22300_10001453 JGI24742J22300_100014534 330
549 3300003373 JGI25407J50210_10002254 JGI25407J50210_100022545 330
550 3300005327 Ga0070658_10159858 Ga0070658_101598582 330
551 3300005329 Ga0070683_100023077 Ga0070683_1000230772 330
552 3300005336 Ga0070680_100003235 Ga0070680_10000323515 330
553 3300005337 Ga0070682_100245968 Ga0070682_1002459682 330
554 3300005338 Ga0068868_100021155 Ga0068868_1000211553 330
555 3300005339 Ga0070660_100144134 Ga0070660_1001441342 330
556 3300005341 Ga0070691_10000044 Ga0070691_100000448 330
557 3300005353 Ga0070669_100145838 Ga0070669_1001458382 330
558 3300005366 Ga0070659_100004223 Ga0070659_1000042233 330
559 3300005366 Ga0070659_100057747 Ga0070659_1000577473 330
560 3300005440 Ga0070705_100122056 Ga0070705_1001220561 330
561 3300005441 Ga0070700_100005895 Ga0070700_1000058954 330
562 3300005455 Ga0070663_100022099 Ga0070663_1000220992 330
563 3300005458 Ga0070681_10013391 Ga0070681_1001339111 330
564 3300005466 Ga0070685_10035279 Ga0070685_100352792 330
565 3300005530 Ga0070679_100023402 Ga0070679_1000234021 330
566 3300005535 Ga0070684_100042488 Ga0070684_1000424884 330
567 3300005535 Ga0070684_100043406 Ga0070684_1000434064 330
568 3300005543 Ga0070672_100059780 Ga0070672_1000597802 330
569 3300005549 Ga0070704_100216168 Ga0070704_1002161681 330
570 3300005563 Ga0068855_100294366 Ga0068855_1002943661 330
571 3300005564 Ga0070664_100013275 Ga0070664_1000132754 330
572 3300005564 Ga0070664_100058703 Ga0070664_1000587033 330
573 3300005614 Ga0068856_100026571 Ga0068856_1000265715 330
574 3300005616 Ga0068852_100007835 Ga0068852_1000078357 330
575 3300005618 Ga0068864_100043739 Ga0068864_1000437392 330
576 3300005718 Ga0068866_10000008 Ga0068866_10000008121 330
577 3300005719 Ga0068861_100152617 Ga0068861_1001526172 330
578 3300005842 Ga0068858_100093657 Ga0068858_1000936572 330
579 3300005843 Ga0068860_100011591 Ga0068860_1000115919 330
580 3300005937 Ga0081455_10059195 Ga0081455_100591952 330
581 3300005937 Ga0081455_10067266 Ga0081455_100672661 330
582 3300005981 Ga0081538_10000020 Ga0081538_10000020100 330
583 3300005981 Ga0081538_10000526 Ga0081538_1000052636 330
584 3300005981 Ga0081538_10000796 Ga0081538_1000079626 330
585 3300005983 Ga0081540_1000100 Ga0081540_10001004 330
586 3300006051 Ga0075364_10107249 Ga0075364_101072492 330
587 3300006844 Ga0075428_100208639 Ga0075428_1002086392 330
588 3300006844 Ga0075428_100278885 Ga0075428_1002788852 330
589 3300006846 Ga0075430_100394196 Ga0075430_1003941961 330
590 3300006847 Ga0075431_100008439 Ga0075431_1000084395 330
591 3300006847 Ga0075431_100036502 Ga0075431_1000365024 330
592 3300006852 Ga0075433_10004260 Ga0075433_100042607 330
593 3300006880 Ga0075429_100028882 Ga0075429_1000288825 330
594 3300006881 Ga0068865_100092346 Ga0068865_1000923462 330
595 3300009093 Ga0105240_10042151 Ga0105240_100421514 330
596 3300009098 Ga0105245_10180209 Ga0105245_101802092 330
597 3300009147 Ga0114129_10012393 Ga0114129_1001239315 330
598 3300009176 Ga0105242_10000449 Ga0105242_100004492 330
599 3300009551 Ga0105238_10006420 Ga0105238_1000642012 330
600 3300010375 Ga0105239_10036088 Ga0105239_100360884 330
601 3300011119 Ga0105246_10037640 Ga0105246_100376404 330
602 3300013105 Ga0157369_10083922 Ga0157369_100839222 330
603 3300013105 Ga0157369_10215970 Ga0157369_102159702 330
604 3300013296 Ga0157374_10004880 Ga0157374_1000488011 330
605 3300013307 Ga0157372_10323196 Ga0157372_103231962 330
606 3300014745 Ga0157377_10017479 Ga0157377_100174792 330
607 3300014969 Ga0157376_10153677 Ga0157376_101536772 330
608 3300020082 Ga0206353_10154608 Ga0206353_101546081 330
609 3300025321 Ga0207656_10027875 Ga0207656_100278753 330
610 3300025899 Ga0207642_10000002 Ga0207642_10000002548 330
611 3300025901 Ga0207688_10004162 Ga0207688_100041622 330
612 3300025912 Ga0207707_10164307 Ga0207707_101643072 330
613 3300025913 Ga0207695_10104584 Ga0207695_101045842 330
614 3300025917 Ga0207660_10013331 Ga0207660_100133317 330
615 3300025921 Ga0207652_10009748 Ga0207652_100097482 330
616 3300025927 Ga0207687_10049514 Ga0207687_100495143 330
617 3300025932 Ga0207690_10023856 Ga0207690_100238564 330
618 3300025934 Ga0207686_10000097 Ga0207686_1000009714 330
619 3300025937 Ga0207669_10000026 Ga0207669_100000268 330
620 3300025938 Ga0207704_10028503 Ga0207704_100285032 330
621 3300025941 Ga0207711_10101111 Ga0207711_101011112 330
622 3300025944 Ga0207661_10039531 Ga0207661_100395311 330
623 3300025944 Ga0207661_10083801 Ga0207661_100838012 330
624 3300025986 Ga0207658_10137457 Ga0207658_101374571 330
625 3300026023 Ga0207677_10031049 Ga0207677_100310492 330
626 3300026067 Ga0207678_10016375 Ga0207678_100163754 330
627 3300026075 Ga0207708_10014443 Ga0207708_100144434 330
628 3300026078 Ga0207702_10047334 Ga0207702_100473345 330
629 3300026142 Ga0207698_10013220 Ga0207698_100132204 330
630 3300026142 Ga0207698_10191136 Ga0207698_101911362 330
631 3300028379 Ga0268266_10006356 Ga0268266_100063563 330
632 3300028381 Ga0268264_10016645 Ga0268264_100166456 330
633 3300028381 Ga0268264_10059027 Ga0268264_100590273 330
634 3300031731 Ga0307405_10089558 Ga0307405_100895582 330
635 3300031824 Ga0307413_10187315 Ga0307413_101873152 330
636 3300031901 Ga0307406_10113558 Ga0307406_101135582 330
637 3300031911 Ga0307412_10140447 Ga0307412_101404472 330
638 3300031995 Ga0307409_100123747 Ga0307409_1001237472 330
639 3300032004 Ga0307414_10398784 Ga0307414_103987841 330
640 3300032126 Ga0307415_100144164 Ga0307415_1001441642 330
641 3300037418 Ga0395900_0346516 Ga0395900_0346516_261_1259 330
642 3300044719 Ga0466971_0012957 Ga0466971_0012957_2217_3218 330
643 3300046459 Ga0495629_0005286 Ga0495629_0005286_6130_7140 330
644 3300046461 Ga0495641_0056121 Ga0495641_0056121_259_1269 330
645 3300046499 Ga0495594_0000089 Ga0495594_0000089_32804_33811 330
646 3300046500 Ga0495596_0086850 Ga0495596_0086850_123_1121 330
647 3300046507 Ga0495606_0000040 Ga0495606_0000040_48572_49582 330
648 3300046516 Ga0495628_0251803 Ga0495628_0251803_13_1035 330
649 3300046517 Ga0495630_0058778 Ga0495630_0058778_495_1502 330
650 3300046517 Ga0495630_0198928 Ga0495630_0198928_427_1434 330
651 3300046529 Ga0495652_0000037 Ga0495652_0000037_19507_20514 330
652 3300046529 Ga0495652_0011995 Ga0495652_0011995_4051_5061 330
653 3300046557 Ga0495622_0000080 Ga0495622_0000080_81507_82514 330
654 3300046642 Ga0495634_0001744 Ga0495634_0001744_10626_11633 330
655 3300046674 Ga0495588_0000362 Ga0495588_0000362_17901_18911 330
656 3300046689 Ga0495613_0000041 Ga0495613_0000041_58435_59442 330
657 3300046809 Ga0495600_0011717 Ga0495600_0011717_3820_4827 330
658 3300047317 Ga0495604_0000239 Ga0495604_0000239_6392_7399 330
659 3300047321 Ga0495676_0000827 Ga0495676_0000827_12268_13290 330
660 3300047321 Ga0495676_0012579 Ga0495676_0012579_3852_4862 330
661 3300047322 Ga0495680_0022126 Ga0495680_0022126_2542_3549 330
662 3300048088 Ga0495602_0000007 Ga0495602_0000007_148716_149723 330
663 3300048903 Ga0496100_0000001 Ga0496100_0000001_421594_422616 330
664 3300048903 Ga0496100_0080822 Ga0496100_0080822_77_1075 330
665 3300048904 Ga0496101_0000004 Ga0496101_0000004_222946_223968 330
666 3300048905 Ga0496102_0000211 Ga0496102_0000211_7476_8486 330
667 3300048905 Ga0496102_0098230 Ga0496102_0098230_622_1626 330
668 3300048905 Ga0496102_0109368 Ga0496102_0109368_324_1322 330
669 3300048906 Ga0496103_0000083 Ga0496103_0000083_43244_44254 330
670 3300048907 Ga0496104_0017182 Ga0496104_0017182_3870_4868 330
671 3300048908 Ga0496105_0022580 Ga0496105_0022580_3498_4496 330
672 3300048909 Ga0496106_0000076 Ga0496106_0000076_18784_19806 330
673 3300048910 Ga0496107_0000005 Ga0496107_0000005_107632_108654 330
674 3300048910 Ga0496107_0041276 Ga0496107_0041276_2255_3253 330
675 3300048911 Ga0496108_0054035 Ga0496108_0054035_26_1024 330
676 3300048912 Ga0496109_0070649 Ga0496109_0070649_45_1043 330
677 3300048913 Ga0496110_0116106 Ga0496110_0116106_734_1732 330
678 3300048914 Ga0496111_0047291 Ga0496111_0047291_2056_3054 330
679 3300048915 Ga0496112_0030187 Ga0496112_0030187_61_1068 330
680 3300048915 Ga0496112_0279281 Ga0496112_0279281_454_1452 330
681 3300048916 Ga0496113_0000013 Ga0496113_0000013_25399_26406 330
682 3300048917 Ga0496114_0000039 Ga0496114_0000039_27493_28500 330
683 3300048918 Ga0496115_0000011 Ga0496115_0000011_106480_107487 330
684 3300048918 Ga0496115_0000377 Ga0496115_0000377_19613_20620 330
685 3300050494 nmdc:mga06z11_63651_c1 nmdc:mga06z11_63651_c1_355_1353 330
686 3300050507 nmdc:mga05p37_38150_c1 nmdc:mga05p37_38150_c1_401_1405 330
687 3300050508 nmdc:mga09592_93327_c1 nmdc:mga09592_93327_c1_1133_2137 330
688 3300050509 nmdc:mga0qj67_170565_c1 nmdc:mga0qj67_170565_c1_337_1341 330
689 3300050510 nmdc:mga06r32_180923_c1 nmdc:mga06r32_180923_c1_237_1235 330
690 3300050510 nmdc:mga06r32_51501_c1 nmdc:mga06r32_51501_c1_1170_2174 330
691 3300050511 nmdc:mga08y16_454811_c1 nmdc:mga08y16_454811_c1_127_1119 330
692 3300053077 Ga0495601_0000165 Ga0495601_0000165_13190_14197 330
693 3300053077 Ga0495601_0057074 Ga0495601_0057074_62_1069 330
694 3300053083 Ga0495655_0000002 Ga0495655_0000002_197651_198661 330
695 3300053085 Ga0495619_0000155 Ga0495619_0000155_39236_40258 330
696 3300053094 Ga0500566_0001093 Ga0500566_0001093_7298_8308 330
697 3300053129 Ga0500628_000001 Ga0500628_000001_286320_287330 330
698 3300061719 Ga0466962_0028029 Ga0466962_0028029_551_1552 330
699 3300000546 LJNas_1005351 LJNas_10053512 331
700 3300003373 JGI25407J50210_10019542 JGI25407J50210_100195422 331
701 3300005441 Ga0070700_100063907 Ga0070700_1000639072 331
702 3300005455 Ga0070663_100084612 Ga0070663_1000846122 331
703 3300005564 Ga0070664_100144185 Ga0070664_1001441852 331
704 3300005578 Ga0068854_100070238 Ga0068854_1000702381 331
705 3300005615 Ga0070702_100013201 Ga0070702_1000132011 331
706 3300005618 Ga0068864_100103015 Ga0068864_1001030152 331
707 3300005937 Ga0081455_10164809 Ga0081455_101648092 331
708 3300005981 Ga0081538_10018966 Ga0081538_100189667 331
709 3300005985 Ga0081539_10000740 Ga0081539_1000074024 331
710 3300025901 Ga0207688_10027092 Ga0207688_100270922 331
711 3300025981 Ga0207640_10061908 Ga0207640_100619082 331
712 3300026067 Ga0207678_10125666 Ga0207678_101256662 331
713 3300026075 Ga0207708_10018028 Ga0207708_100180282 331
714 3300026116 Ga0207674_10035565 Ga0207674_100355651 331
715 3300026142 Ga0207698_10305362 Ga0207698_103053622 331
716 3300028379 Ga0268266_10184601 Ga0268266_101846011 331
717 3300031548 Ga0307408_100140389 Ga0307408_1001403892 331
718 3300031852 Ga0307410_10069885 Ga0307410_100698854 331
719 3300031852 Ga0307410_10166615 Ga0307410_101666151 331
720 3300031903 Ga0307407_10250570 Ga0307407_102505701 331
721 3300031995 Ga0307409_100003645 Ga0307409_1000036453 331
722 3300032004 Ga0307414_10202999 Ga0307414_102029992 331
723 3300032004 Ga0307414_10291312 Ga0307414_102913121 331
724 3300032005 Ga0307411_10050006 Ga0307411_100500063 331
725 3300032126 Ga0307415_100077824 Ga0307415_1000778243 331
726 3300048917 Ga0496114_0054866 Ga0496114_0054866_1462_2457 331
727 3300049568 Ga0501031_0032359 Ga0501031_0032359_1454_2452 331
728 3300049573 Ga0501037_0214085 Ga0501037_0214085_235_1233 331
729 3300049576 Ga0501040_0283912 Ga0501040_0283912_31_1029 331
730 3300049577 Ga0501041_0063221 Ga0501041_0063221_333_1331 331
731 3300049587 Ga0501071_0006091 Ga0501071_0006091_2450_3448 331
732 3300049588 Ga0501072_0306943 Ga0501072_0306943_98_1096 331
733 3300049591 Ga0501075_0045069 Ga0501075_0045069_1506_2504 331
734 3300049592 Ga0501076_0180966 Ga0501076_0180966_544_1542 331

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

36

337

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4egw-assembly1.cif.gz_B the structure of the soluble domain of cora from methanocaldococcus jannaschii 0.9016 38 263
8slb-assembly1.cif.gz_A x-ray structure of cora n-terminal domain in complex with conformation-specific synthetic antibody c12 0.8567 38 242
3nvo-assembly1.cif.gz_A the soluble domain structure of the zntb zn2+ efflux system 0.8519 38 266
3nvo-assembly2.cif.gz_B-2 the soluble domain structure of the zntb zn2+ efflux system 0.8469 38 262
5n77-assembly1.cif.gz_E crystal structure of the cytosolic domain of the cora magnesium channel from escherichia coli in complex with magnesium 0.8447 40 272
ID Description Score Start End Superfamily
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.952 147 253 1.20.58.340
5jtgD02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9516 147 253 1.20.58.340
5jtgA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9509 147 253 1.20.58.340
2iubA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9496 147 253 1.20.58.340
4eebC02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9487 147 253 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A7V5IZC3-F1-model_v4 Magnesium transporter CorA family protein 0.9387 30 259 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A7C0YP30-F1-model_v4 Magnesium transporter CorA family protein 0.9225 31 136 GO:0016020
GO:0046873
AF-X1RBR6-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9199 38 182 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A2M6P1Q7-F1-model_v4 Magnesium transporter CorA 0.9197 30 144 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A377TWQ5-F1-model_v4 Mg2+ and Co2+ transporter 0.9157 120 269 GO:0016020
GO:0046873

Feature Viewer

pLDDT pTM Quality
83.9 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map