F478021
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 326 | 732 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10078099|Ga0081455_100780993 |
| Length | 340 |
| Sequence | MGYAPKALHRRLETCITSPLRETDKVSRLRTFLFVTAACVIFGLAAIWILTLPSIVPATALPAHTPNLADGETMFNIGGCSSCHAVPNNSPEEVDRKRLGGGLALKSPFGVFYAPNISPDSKDGIGSWSEANFVTALWKGTSEHGANLYPAFPYTSYRYMQLKDVRDLFAYLKTLPPVQGRSRRHELSFPFNERRLLGIWKLLFLGEKPFVPDPSKSAQYNRGAYLVNGPGHCAECHSPRNILGGIIDGQRFAGGSPDGNEWAPNITPVGLRGGDEDWSEKDVASFLADGMTPSGDFAGGSMAEVIRNTSLLAPEDRSAIAAYVAALPPRQGPTPPPKKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 160 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 168 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 170 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 317 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 320 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 321 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 323 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.28 |
| Nodule | 0 |
| Rhizoplane | 8.33 |
| Rhizosphere | 87.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001140 | 3300003215 | Bacteria | 16088 |
| 2 | Ga0065707_10109104 | 3300005295 | Bacteria | 2482 |
| 3 | Ga0070658_10142249 | 3300005327 | Bacteria | 2004 |
| 4 | Ga0070658_10160279 | 3300005327 | Bacteria | 1887 |
| 5 | Ga0070683_100076411 | 3300005329 | Bacteria | 3130 |
| 6 | Ga0070683_100214136 | 3300005329 | Bacteria | 1830 |
| 7 | Ga0070690_100094018 | 3300005330 | Bacteria | 1978 |
| 8 | Ga0070690_100185446 | 3300005330 | Bacteria | 1439 |
| 9 | Ga0070670_100012852 | 3300005331 | Bacteria | 7167 |
| 10 | Ga0070670_100021459 | 3300005331 | Bacteria | 5555 |
| 11 | Ga0070666_10004919 | 3300005335 | Bacteria | 8167 |
| 12 | Ga0070680_100019308 | 3300005336 | Bacteria | 5401 |
| 13 | Ga0070680_100046860 | 3300005336 | Bacteria | 3518 |
| 14 | Ga0070680_100125863 | 3300005336 | Bacteria | 2141 |
| 15 | Ga0070680_100169045 | 3300005336 | Bacteria | 1839 |
| 16 | Ga0068868_100136190 | 3300005338 | Bacteria | 2013 |
| 17 | Ga0070660_100008537 | 3300005339 | Bacteria | 7172 |
| 18 | Ga0070660_100094953 | 3300005339 | Bacteria | 2356 |
| 19 | Ga0070689_100006481 | 3300005340 | Bacteria | 8106 |
| 20 | Ga0070661_100033043 | 3300005344 | Bacteria | 3747 |
| 21 | Ga0070668_100259082 | 3300005347 | Bacteria | 1446 |
| 22 | Ga0070669_100052137 | 3300005353 | Bacteria | 2992 |
| 23 | Ga0070669_100173160 | 3300005353 | Bacteria | 1684 |
| 24 | Ga0070675_100125186 | 3300005354 | Bacteria | 2186 |
| 25 | Ga0070671_100027257 | 3300005355 | Bacteria | 4701 |
| 26 | Ga0070671_100027439 | 3300005355 | Bacteria | 4688 |
| 27 | Ga0070671_100098915 | 3300005355 | Bacteria | 2447 |
| 28 | Ga0070671_100106570 | 3300005355 | Bacteria | 2353 |
| 29 | Ga0070671_100175793 | 3300005355 | Bacteria | 1812 |
| 30 | Ga0070674_100010649 | 3300005356 | Bacteria | 5570 |
| 31 | Ga0070674_100126342 | 3300005356 | Bacteria | 1900 |
| 32 | Ga0070673_100027086 | 3300005364 | Bacteria | 4245 |
| 33 | Ga0070688_100026349 | 3300005365 | Bacteria | 3454 |
| 34 | Ga0070688_100116827 | 3300005365 | Bacteria | 1781 |
| 35 | Ga0070659_100138454 | 3300005366 | Bacteria | 1981 |
| 36 | Ga0070667_100012009 | 3300005367 | Bacteria | 7170 |
| 37 | Ga0070667_100117578 | 3300005367 | Bacteria | 2309 |
| 38 | Ga0070667_100184188 | 3300005367 | Bacteria | 1848 |
| 39 | Ga0070709_10015959 | 3300005434 | Bacteria | 4278 |
| 40 | Ga0070709_10032741 | 3300005434 | Bacteria | 3137 |
| 41 | Ga0070709_10047527 | 3300005434 | Bacteria | 2674 |
| 42 | Ga0070714_100115564 | 3300005435 | Bacteria | 2382 |
| 43 | Ga0070714_100166152 | 3300005435 | Bacteria | 2000 |
| 44 | Ga0070714_100257700 | 3300005435 | Bacteria | 1614 |
| 45 | Ga0070714_100260277 | 3300005435 | Bacteria | 1606 |
| 46 | Ga0070714_100394035 | 3300005435 | Unclassified | 1308 |
| 47 | Ga0070713_100050644 | 3300005436 | Bacteria | 3431 |
| 48 | Ga0070713_100263807 | 3300005436 | Unclassified | 1575 |
| 49 | Ga0070710_10032225 | 3300005437 | Bacteria | 2838 |
| 50 | Ga0070710_10080001 | 3300005437 | Bacteria | 1906 |
| 51 | Ga0070663_100046829 | 3300005455 | Bacteria | 3062 |
| 52 | Ga0070663_100068729 | 3300005455 | Bacteria | 2572 |
| 53 | Ga0070678_100043785 | 3300005456 | Bacteria | 3191 |
| 54 | Ga0070678_100221472 | 3300005456 | Bacteria | 1573 |
| 55 | Ga0070662_100075462 | 3300005457 | Bacteria | 2497 |
| 56 | Ga0070681_10180078 | 3300005458 | Bacteria | 2035 |
| 57 | Ga0070681_10504365 | 3300005458 | Bacteria | 1123 |
| 58 | Ga0070685_10219873 | 3300005466 | Bacteria | 1244 |
| 59 | Ga0070706_100113119 | 3300005467 | Bacteria | 2528 |
| 60 | Ga0070698_100084450 | 3300005471 | Bacteria | 3163 |
| 61 | Ga0070699_100300282 | 3300005518 | Bacteria | 1441 |
| 62 | Ga0070679_100021262 | 3300005530 | Bacteria | 6331 |
| 63 | Ga0070679_100067619 | 3300005530 | Bacteria | 3563 |
| 64 | Ga0070679_100160367 | 3300005530 | Bacteria | 2224 |
| 65 | Ga0070679_100169791 | 3300005530 | Bacteria | 2154 |
| 66 | Ga0070684_100170309 | 3300005535 | Bacteria | 1978 |
| 67 | Ga0068853_100523613 | 3300005539 | Bacteria | 1121 |
| 68 | Ga0070672_100476719 | 3300005543 | Bacteria | 1077 |
| 69 | Ga0070686_100017887 | 3300005544 | Bacteria | 4149 |
| 70 | Ga0070686_100054093 | 3300005544 | Bacteria | 2566 |
| 71 | Ga0070695_100221348 | 3300005545 | Unclassified | 1364 |
| 72 | Ga0070696_100324784 | 3300005546 | Bacteria | 1185 |
| 73 | Ga0070665_100104069 | 3300005548 | Bacteria | 2841 |
| 74 | Ga0068855_100029137 | 3300005563 | Bacteria | 6602 |
| 75 | Ga0068855_100176238 | 3300005563 | Bacteria | 2419 |
| 76 | Ga0068855_100563935 | 3300005563 | Bacteria | 1231 |
| 77 | Ga0070664_100380480 | 3300005564 | Bacteria | 1288 |
| 78 | Ga0068856_100100864 | 3300005614 | Bacteria | 2880 |
| 79 | Ga0068856_100102358 | 3300005614 | Bacteria | 2857 |
| 80 | Ga0068856_100492591 | 3300005614 | Bacteria | 1246 |
| 81 | Ga0070702_100037096 | 3300005615 | Bacteria | 2705 |
| 82 | Ga0068852_100035849 | 3300005616 | Bacteria | 4143 |
| 83 | Ga0068852_100541192 | 3300005616 | Bacteria | 1164 |
| 84 | Ga0068859_100190897 | 3300005617 | Bacteria | 2133 |
| 85 | Ga0068864_100030481 | 3300005618 | Bacteria | 4572 |
| 86 | Ga0068864_100247610 | 3300005618 | Bacteria | 1653 |
| 87 | Ga0068866_10029100 | 3300005718 | Bacteria | 2639 |
| 88 | Ga0068858_100040742 | 3300005842 | Bacteria | 4308 |
| 89 | Ga0068858_100405655 | 3300005842 | Bacteria | 1310 |
| 90 | Ga0068860_100198490 | 3300005843 | Bacteria | 1943 |
| 91 | Ga0068862_100579436 | 3300005844 | Bacteria | 1075 |
| 92 | Ga0081455_10000438 | 3300005937 | Bacteria | 54690 |
| 93 | Ga0081455_10012637 | 3300005937 | Bacteria | 8408 |
| 94 | Ga0081455_10078099 | 3300005937 | Bacteria | 2721 |
| 95 | Ga0081455_10125469 | 3300005937 | Bacteria | 2015 |
| 96 | Ga0081538_10003052 | 3300005981 | Bacteria | 15956 |
| 97 | Ga0081540_1016887 | 3300005983 | Bacteria | 4544 |
| 98 | Ga0070717_10000145 | 3300006028 | Bacteria | 52677 |
| 99 | Ga0070717_10050241 | 3300006028 | Bacteria | 3426 |
| 100 | Ga0070717_10083228 | 3300006028 | Bacteria | 2690 |
| 101 | Ga0075365_10020435 | 3300006038 | Bacteria | 4105 |
| 102 | Ga0075368_10020965 | 3300006042 | Bacteria | 2479 |
| 103 | Ga0075368_10079985 | 3300006042 | Bacteria | 1329 |
| 104 | Ga0075363_100125084 | 3300006048 | Bacteria | 1439 |
| 105 | Ga0070715_10009786 | 3300006163 | Bacteria | 3393 |
| 106 | Ga0070716_100003681 | 3300006173 | Bacteria | 7254 |
| 107 | Ga0070712_100009070 | 3300006175 | Bacteria | 6263 |
| 108 | Ga0070712_100071306 | 3300006175 | Bacteria | 2485 |
| 109 | Ga0070712_100263636 | 3300006175 | Bacteria | 1381 |
| 110 | Ga0075367_10034214 | 3300006178 | Bacteria | 2934 |
| 111 | Ga0075367_10048103 | 3300006178 | Bacteria | 2511 |
| 112 | Ga0075367_10090012 | 3300006178 | Bacteria | 1866 |
| 113 | Ga0075367_10283599 | 3300006178 | Bacteria | 1041 |
| 114 | Ga0075427_10007028 | 3300006194 | Bacteria | 1648 |
| 115 | Ga0075366_10001361 | 3300006195 | Bacteria | 12206 |
| 116 | Ga0075366_10242131 | 3300006195 | Bacteria | 1100 |
| 117 | Ga0097621_100028219 | 3300006237 | Bacteria | 4423 |
| 118 | Ga0068871_100005724 | 3300006358 | Bacteria | 8725 |
| 119 | Ga0068871_100011946 | 3300006358 | Bacteria | 6392 |
| 120 | Ga0075428_100132548 | 3300006844 | Bacteria | 2710 |
| 121 | Ga0075430_100088188 | 3300006846 | Bacteria | 2596 |
| 122 | Ga0075430_100089677 | 3300006846 | Bacteria | 2572 |
| 123 | Ga0075431_100010236 | 3300006847 | Bacteria | 9427 |
| 124 | Ga0075431_100138807 | 3300006847 | Unclassified | 2506 |
| 125 | Ga0075431_100270929 | 3300006847 | Bacteria | 1720 |
| 126 | Ga0075433_10001918 | 3300006852 | Bacteria | 15641 |
| 127 | Ga0075433_10264811 | 3300006852 | Bacteria | 1523 |
| 128 | Ga0075434_100003101 | 3300006871 | Bacteria | 14794 |
| 129 | Ga0075434_100003168 | 3300006871 | Bacteria | 14664 |
| 130 | Ga0075434_100027058 | 3300006871 | Bacteria | 5629 |
| 131 | Ga0075434_100248991 | 3300006871 | Bacteria | 1796 |
| 132 | Ga0075429_100028007 | 3300006880 | Bacteria | 4890 |
| 133 | Ga0075429_100063595 | 3300006880 | Bacteria | 3214 |
| 134 | Ga0068865_100007622 | 3300006881 | Bacteria | 6666 |
| 135 | Ga0075436_100028648 | 3300006914 | Bacteria | 3830 |
| 136 | Ga0075436_100147960 | 3300006914 | Bacteria | 1652 |
| 137 | Ga0097620_100190898 | 3300006931 | Bacteria | 2133 |
| 138 | Ga0075435_100010352 | 3300007076 | Bacteria | 6819 |
| 139 | Ga0075435_100044759 | 3300007076 | Bacteria | 3546 |
| 140 | Ga0075435_100174513 | 3300007076 | Bacteria | 1814 |
| 141 | Ga0099795_10046226 | 3300007788 | Bacteria | 1568 |
| 142 | Ga0105251_10027198 | 3300009011 | Bacteria | 2903 |
| 143 | Ga0105240_10461707 | 3300009093 | Bacteria | 1419 |
| 144 | Ga0105240_10640371 | 3300009093 | Bacteria | 1166 |
| 145 | Ga0111539_10009267 | 3300009094 | Bacteria | 12439 |
| 146 | Ga0111539_10041314 | 3300009094 | Bacteria | 5546 |
| 147 | Ga0111539_10101847 | 3300009094 | Bacteria | 3371 |
| 148 | Ga0105247_10040966 | 3300009101 | Bacteria | 2833 |
| 149 | Ga0114129_10002620 | 3300009147 | Bacteria | 25037 |
| 150 | Ga0105243_10021600 | 3300009148 | Bacteria | 4886 |
| 151 | Ga0105241_10008642 | 3300009174 | Bacteria | 7487 |
| 152 | Ga0105242_10008481 | 3300009176 | Bacteria | 7892 |
| 153 | Ga0105248_10061485 | 3300009177 | Bacteria | 4217 |
| 154 | Ga0105248_10075049 | 3300009177 | Bacteria | 3800 |
| 155 | Ga0105248_10614035 | 3300009177 | Bacteria | 1227 |
| 156 | Ga0105237_10041268 | 3300009545 | Bacteria | 4654 |
| 157 | Ga0105237_10137752 | 3300009545 | Bacteria | 2435 |
| 158 | Ga0105238_10010345 | 3300009551 | Bacteria | 9360 |
| 159 | Ga0105238_10037336 | 3300009551 | Bacteria | 4939 |
| 160 | Ga0105238_10193691 | 3300009551 | Bacteria | 2008 |
| 161 | Ga0105238_10196033 | 3300009551 | Bacteria | 1996 |
| 162 | Ga0105239_10274765 | 3300010375 | Bacteria | 1896 |
| 163 | Ga0105239_10580658 | 3300010375 | Bacteria | 1278 |
| 164 | Ga0105246_10031236 | 3300011119 | Bacteria | 3523 |
| 165 | Ga0105246_10385015 | 3300011119 | Bacteria | 1160 |
| 166 | Ga0157373_10329043 | 3300013100 | Bacteria | 1088 |
| 167 | Ga0157370_10037827 | 3300013104 | Bacteria | 4672 |
| 168 | Ga0157370_10148763 | 3300013104 | Bacteria | 2180 |
| 169 | Ga0157374_10046005 | 3300013296 | Bacteria | 4040 |
| 170 | Ga0157378_10045148 | 3300013297 | Bacteria | 3915 |
| 171 | Ga0157378_10114051 | 3300013297 | Bacteria | 2482 |
| 172 | Ga0157378_10299102 | 3300013297 | Bacteria | 1557 |
| 173 | Ga0163162_10043235 | 3300013306 | Bacteria | 4511 |
| 174 | Ga0163162_10195346 | 3300013306 | Bacteria | 2152 |
| 175 | Ga0163162_10435449 | 3300013306 | Bacteria | 1443 |
| 176 | Ga0157372_10084201 | 3300013307 | Bacteria | 3604 |
| 177 | Ga0157375_10091254 | 3300013308 | Bacteria | 3107 |
| 178 | Ga0157375_10234030 | 3300013308 | Bacteria | 1996 |
| 179 | Ga0163163_10035877 | 3300014325 | Unclassified | 4814 |
| 180 | Ga0163163_10064618 | 3300014325 | Bacteria | 3631 |
| 181 | Ga0157380_10018225 | 3300014326 | Bacteria | 5209 |
| 182 | Ga0157380_10183978 | 3300014326 | Bacteria | 1838 |
| 183 | Ga0157380_10290599 | 3300014326 | Bacteria | 1501 |
| 184 | Ga0157380_10335969 | 3300014326 | Bacteria | 1407 |
| 185 | Ga0197907_10636662 | 3300020069 | Bacteria | 2027 |
| 186 | Ga0206354_10791022 | 3300020081 | Bacteria | 1164 |
| 187 | Ga0206353_11305831 | 3300020082 | Bacteria | 2079 |
| 188 | Ga0213876_10001824 | 3300021384 | Bacteria | 12862 |
| 189 | Ga0213876_10054220 | 3300021384 | Bacteria | 2117 |
| 190 | Ga0213875_10027032 | 3300021388 | Bacteria | 2730 |
| 191 | Ga0224572_1000634 | 3300024225 | Bacteria | 4381 |
| 192 | Ga0209758_1000741 | 3300025297 | Bacteria | 47516 |
| 193 | Ga0207692_10002671 | 3300025898 | Bacteria | 6862 |
| 194 | Ga0207692_10219545 | 3300025898 | Bacteria | 1126 |
| 195 | Ga0207692_10243676 | 3300025898 | Bacteria | 1074 |
| 196 | Ga0207642_10066461 | 3300025899 | Bacteria | 1698 |
| 197 | Ga0207688_10089649 | 3300025901 | Bacteria | 1765 |
| 198 | Ga0207680_10008757 | 3300025903 | Bacteria | 4985 |
| 199 | Ga0207685_10002216 | 3300025905 | Bacteria | 4395 |
| 200 | Ga0207685_10024188 | 3300025905 | Bacteria | 2079 |
| 201 | Ga0207699_10034141 | 3300025906 | Bacteria | 2882 |
| 202 | Ga0207699_10141493 | 3300025906 | Bacteria | 1582 |
| 203 | Ga0207705_10063491 | 3300025909 | Bacteria | 2668 |
| 204 | Ga0207705_10141179 | 3300025909 | Bacteria | 1799 |
| 205 | Ga0207684_10379665 | 3300025910 | Bacteria | 1215 |
| 206 | Ga0207654_10065902 | 3300025911 | Bacteria | 2134 |
| 207 | Ga0207654_10165019 | 3300025911 | Bacteria | 1434 |
| 208 | Ga0207707_10051087 | 3300025912 | Bacteria | 3600 |
| 209 | Ga0207707_10111500 | 3300025912 | Bacteria | 2392 |
| 210 | Ga0207707_10160155 | 3300025912 | Bacteria | 1968 |
| 211 | Ga0207693_10001807 | 3300025915 | Bacteria | 18754 |
| 212 | Ga0207693_10008161 | 3300025915 | Bacteria | 8580 |
| 213 | Ga0207693_10055389 | 3300025915 | Bacteria | 3111 |
| 214 | Ga0207693_10270398 | 3300025915 | Bacteria | 1332 |
| 215 | Ga0207693_10423038 | 3300025915 | Unclassified | 1041 |
| 216 | Ga0207663_10067485 | 3300025916 | Bacteria | 2294 |
| 217 | Ga0207660_10019987 | 3300025917 | Bacteria | 4487 |
| 218 | Ga0207660_10247386 | 3300025917 | Bacteria | 1406 |
| 219 | Ga0207662_10111363 | 3300025918 | Bacteria | 1707 |
| 220 | Ga0207657_10004688 | 3300025919 | Bacteria | 14436 |
| 221 | Ga0207657_10052916 | 3300025919 | Bacteria | 3521 |
| 222 | Ga0207649_10162261 | 3300025920 | Bacteria | 1550 |
| 223 | Ga0207652_10017799 | 3300025921 | Bacteria | 5820 |
| 224 | Ga0207652_10099816 | 3300025921 | Bacteria | 2562 |
| 225 | Ga0207652_10136848 | 3300025921 | Bacteria | 2188 |
| 226 | Ga0207681_10042227 | 3300025923 | Bacteria | 3045 |
| 227 | Ga0207694_10032862 | 3300025924 | Bacteria | 3974 |
| 228 | Ga0207694_10053754 | 3300025924 | Bacteria | 3124 |
| 229 | Ga0207694_10131465 | 3300025924 | Bacteria | 2007 |
| 230 | Ga0207650_10325680 | 3300025925 | Bacteria | 1259 |
| 231 | Ga0207659_10114781 | 3300025926 | Bacteria | 2053 |
| 232 | Ga0207659_10270084 | 3300025926 | Bacteria | 1387 |
| 233 | Ga0207687_10117712 | 3300025927 | Bacteria | 1982 |
| 234 | Ga0207700_10002538 | 3300025928 | Bacteria | 10476 |
| 235 | Ga0207700_10060797 | 3300025928 | Bacteria | 2862 |
| 236 | Ga0207700_10066202 | 3300025928 | Bacteria | 2761 |
| 237 | Ga0207664_10079431 | 3300025929 | Bacteria | 2663 |
| 238 | Ga0207664_10081567 | 3300025929 | Bacteria | 2632 |
| 239 | Ga0207664_10116714 | 3300025929 | Bacteria | 2227 |
| 240 | Ga0207644_10011229 | 3300025931 | Bacteria | 5920 |
| 241 | Ga0207644_10014393 | 3300025931 | Bacteria | 5292 |
| 242 | Ga0207690_10083259 | 3300025932 | Bacteria | 2240 |
| 243 | Ga0207706_10017852 | 3300025933 | Bacteria | 6390 |
| 244 | Ga0207706_10077798 | 3300025933 | Bacteria | 2917 |
| 245 | Ga0207686_10016968 | 3300025934 | Bacteria | 4093 |
| 246 | Ga0207686_10106508 | 3300025934 | Bacteria | 1882 |
| 247 | Ga0207709_10023456 | 3300025935 | Bacteria | 3512 |
| 248 | Ga0207670_10025042 | 3300025936 | Bacteria | 3739 |
| 249 | Ga0207670_10229806 | 3300025936 | Bacteria | 1424 |
| 250 | Ga0207669_10101372 | 3300025937 | Bacteria | 1904 |
| 251 | Ga0207665_10000265 | 3300025939 | Bacteria | 36482 |
| 252 | Ga0207691_10089653 | 3300025940 | Bacteria | 2757 |
| 253 | Ga0207691_10224554 | 3300025940 | Bacteria | 1628 |
| 254 | Ga0207711_10194540 | 3300025941 | Bacteria | 1849 |
| 255 | Ga0207689_10046493 | 3300025942 | Bacteria | 3587 |
| 256 | Ga0207661_10155948 | 3300025944 | Bacteria | 1978 |
| 257 | Ga0207667_10114444 | 3300025949 | Bacteria | 2780 |
| 258 | Ga0207667_10132921 | 3300025949 | Bacteria | 2563 |
| 259 | Ga0207651_10020560 | 3300025960 | Bacteria | 3987 |
| 260 | Ga0207651_10080430 | 3300025960 | Bacteria | 2345 |
| 261 | Ga0207668_10229079 | 3300025972 | Bacteria | 1497 |
| 262 | Ga0207703_10094114 | 3300026035 | Bacteria | 2525 |
| 263 | Ga0207678_10006465 | 3300026067 | Bacteria | 10398 |
| 264 | Ga0207641_10051603 | 3300026088 | Bacteria | 3483 |
| 265 | Ga0207648_10064010 | 3300026089 | Bacteria | 3205 |
| 266 | Ga0207676_10011939 | 3300026095 | Bacteria | 6216 |
| 267 | Ga0207676_10018713 | 3300026095 | Bacteria | 5041 |
| 268 | Ga0207683_10065445 | 3300026121 | Bacteria | 3205 |
| 269 | Ga0207683_10277588 | 3300026121 | Bacteria | 1531 |
| 270 | Ga0207698_10238304 | 3300026142 | Bacteria | 1656 |
| 271 | Ga0207698_10495856 | 3300026142 | Bacteria | 1187 |
| 272 | Ga0207698_10514861 | 3300026142 | Bacteria | 1167 |
| 273 | Ga0209813_10028236 | 3300027866 | Bacteria | 1635 |
| 274 | Ga0207428_10060942 | 3300027907 | Bacteria | 2989 |
| 275 | Ga0207428_10243434 | 3300027907 | Bacteria | 1343 |
| 276 | Ga0207428_10383373 | 3300027907 | Bacteria | 1031 |
| 277 | Ga0268266_10012360 | 3300028379 | Bacteria | 7383 |
| 278 | Ga0268264_10325648 | 3300028381 | Bacteria | 1454 |
| 279 | Ga0265337_1000408 | 3300028556 | Bacteria | 23003 |
| 280 | Ga0265338_10019657 | 3300028800 | Bacteria | 7148 |
| 281 | Ga0265338_10021763 | 3300028800 | Bacteria | 6666 |
| 282 | Ga0265330_10023812 | 3300031235 | Bacteria | 2779 |
| 283 | Ga0265325_10000053 | 3300031241 | Bacteria | 77918 |
| 284 | Ga0265325_10000693 | 3300031241 | Bacteria | 24565 |
| 285 | Ga0265325_10007800 | 3300031241 | Bacteria | 6374 |
| 286 | Ga0265340_10134698 | 3300031247 | Bacteria | 1131 |
| 287 | Ga0265339_10000080 | 3300031249 | Bacteria | 83570 |
| 288 | Ga0265339_10036217 | 3300031249 | Bacteria | 2763 |
| 289 | Ga0265339_10059630 | 3300031249 | Bacteria | 2057 |
| 290 | Ga0265313_10000027 | 3300031595 | Bacteria | 133281 |
| 291 | Ga0265313_10000330 | 3300031595 | Bacteria | 51547 |
| 292 | Ga0265313_10010419 | 3300031595 | Bacteria | 5876 |
| 293 | Ga0265313_10014816 | 3300031595 | Bacteria | 4583 |
| 294 | Ga0265313_10038835 | 3300031595 | Bacteria | 2367 |
| 295 | Ga0265342_10000518 | 3300031712 | Bacteria | 41040 |
| 296 | Ga0265342_10005933 | 3300031712 | Bacteria | 9197 |
| 297 | Ga0373926_0010622 | 3300035083 | Bacteria | 3087 |
| 298 | Ga0373926_0012939 | 3300035083 | Bacteria | 2826 |
| 299 | Ga0373926_0020903 | 3300035083 | Bacteria | 2263 |
| 300 | Ga0373934_0059495 | 3300035086 | Bacteria | 1521 |
| 301 | Ga0373944_0004008 | 3300035089 | Bacteria | 3815 |
| 302 | Ga0373944_0037495 | 3300035089 | Bacteria | 1485 |
| 303 | Ga0373952_0006089 | 3300035092 | Bacteria | 2225 |
| 304 | Ga0373923_0004385 | 3300035111 | Bacteria | 4676 |
| 305 | Ga0373923_0006177 | 3300035111 | Bacteria | 4122 |
| 306 | Ga0373923_0070956 | 3300035111 | Bacteria | 1496 |
| 307 | Ga0373932_0009230 | 3300035112 | Bacteria | 2368 |
| 308 | Ga0373936_0026391 | 3300035113 | Bacteria | 2274 |
| 309 | Ga0373939_0009096 | 3300035114 | Bacteria | 2455 |
| 310 | Ga0373945_0008773 | 3300035116 | Bacteria | 3300 |
| 311 | Ga0373953_0012233 | 3300035117 | Bacteria | 3035 |
| 312 | Ga0373954_0002335 | 3300035118 | Bacteria | 7919 |
| 313 | Ga0373954_0032919 | 3300035118 | Bacteria | 2398 |
| 314 | Ga0373956_0046447 | 3300035119 | Bacteria | 1940 |
| 315 | Ga0373957_0003196 | 3300035120 | Bacteria | 4805 |
| 316 | Ga0373960_0042512 | 3300035121 | Bacteria | 1320 |
| 317 | Ga0373943_0012016 | 3300035170 | Bacteria | 3897 |
| 318 | Ga0373943_0021746 | 3300035170 | Bacteria | 2964 |
| 319 | Ga0373943_0022083 | 3300035170 | Bacteria | 2944 |
| 320 | Ga0373943_0024286 | 3300035170 | Bacteria | 2825 |
| 321 | Ga0373943_0081446 | 3300035170 | Bacteria | 1660 |
| 322 | Ga0373946_0012124 | 3300035171 | Bacteria | 3224 |
| 323 | Ga0373946_0017656 | 3300035171 | Bacteria | 2732 |
| 324 | Ga0373946_0044646 | 3300035171 | Unclassified | 1830 |
| 325 | Ga0373955_0001741 | 3300035172 | Bacteria | 9333 |
| 326 | Ga0373955_0006730 | 3300035172 | Bacteria | 5248 |
| 327 | Ga0373924_0005515 | 3300035410 | Bacteria | 4487 |
| 328 | Ga0373924_0013890 | 3300035410 | Bacteria | 3033 |
| 329 | Ga0373931_0092748 | 3300035691 | Bacteria | 1685 |
| 330 | Ga0373931_0198568 | 3300035691 | Bacteria | 1197 |
| 331 | Ga0373935_0002963 | 3300035692 | Bacteria | 9781 |
| 332 | Ga0373935_0010200 | 3300035692 | Bacteria | 5627 |
| 333 | Ga0373935_0015752 | 3300035692 | Bacteria | 4573 |
| 334 | Ga0373935_0020718 | 3300035692 | Bacteria | 4020 |
| 335 | Ga0373935_0035403 | 3300035692 | Bacteria | 3116 |
| 336 | Ga0373935_0036408 | 3300035692 | Bacteria | 3076 |
| 337 | Ga0373927_0000755 | 3300035695 | Bacteria | 24701 |
| 338 | Ga0373927_0016719 | 3300035695 | Bacteria | 4839 |
| 339 | Ga0373927_0021678 | 3300035695 | Bacteria | 4210 |
| 340 | Ga0373927_0022023 | 3300035695 | Bacteria | 4176 |
| 341 | Ga0373927_0035459 | 3300035695 | Bacteria | 3244 |
| 342 | Ga0373927_0111639 | 3300035695 | Bacteria | 1781 |
| 343 | Ga0373927_0112291 | 3300035695 | Bacteria | 1776 |
| 344 | Ga0373933_0001680 | 3300035724 | Bacteria | 12883 |
| 345 | Ga0373933_0006411 | 3300035724 | Bacteria | 6404 |
| 346 | Ga0373933_0107575 | 3300035724 | Bacteria | 1736 |
| 347 | Ga0373947_0004314 | 3300035725 | Bacteria | 8356 |
| 348 | Ga0373947_0005471 | 3300035725 | Bacteria | 7414 |
| 349 | Ga0373947_0006848 | 3300035725 | Bacteria | 6609 |
| 350 | Ga0373947_0010013 | 3300035725 | Bacteria | 5443 |
| 351 | Ga0373947_0066744 | 3300035725 | Bacteria | 2196 |
| 352 | Ga0373947_0075340 | 3300035725 | Bacteria | 2077 |
| 353 | Ga0373937_0000293 | 3300036401 | Bacteria | 47507 |
| 354 | Ga0373937_0002545 | 3300036401 | Bacteria | 15141 |
| 355 | Ga0373937_0027264 | 3300036401 | Bacteria | 5166 |
| 356 | Ga0373937_0049773 | 3300036401 | Bacteria | 3837 |
| 357 | Ga0373937_0497320 | 3300036401 | Bacteria | 1158 |
| 358 | Ga0373925_0000087 | 3300037068 | Bacteria | 99043 |
| 359 | Ga0373925_0001685 | 3300037068 | Bacteria | 18592 |
| 360 | Ga0373925_0025347 | 3300037068 | Bacteria | 4332 |
| 361 | Ga0373925_0026243 | 3300037068 | Bacteria | 4262 |
| 362 | Ga0373925_0032671 | 3300037068 | Bacteria | 3831 |
| 363 | Ga0373925_0053236 | 3300037068 | Bacteria | 3025 |
| 364 | Ga0373925_0067422 | 3300037068 | Unclassified | 2699 |
| 365 | Ga0373925_0100521 | 3300037068 | Bacteria | 2222 |
| 366 | Ga0373925_0170041 | 3300037068 | Bacteria | 1720 |
| 367 | Ga0395898_0036506 | 3300037466 | Bacteria | 4879 |
| 368 | Ga0436364_0748531 | 3300037853 | Bacteria | 2919 |
| 369 | Ga0436364_0771233 | 3300037853 | Bacteria | 3155 |
| 370 | Ga0395901_0033281 | 3300038443 | Bacteria | 5320 |
| 371 | Ga0436365_0421213 | 3300039437 | Bacteria | 2218 |
| 372 | Ga0436365_1622903 | 3300039437 | Bacteria | 4637 |
| 373 | Ga0436365_1873205 | 3300039437 | Bacteria | 55177 |
| 374 | Ga0436361_0925931 | 3300039447 | Bacteria | 1836 |
| 375 | Ga0436362_0818986 | 3300039453 | Bacteria | 1226 |
| 376 | Ga0439460_0056930 | 3300042461 | Bacteria | 1185 |
| 377 | Ga0466963_0051933 | 3300044694 | Bacteria | 2719 |
| 378 | Ga0466971_0077537 | 3300044719 | Unclassified | 1513 |
| 379 | Ga0466957_0179186 | 3300044842 | Bacteria | 1383 |
| 380 | Ga0466958_0077456 | 3300045836 | Bacteria | 2042 |
| 381 | Ga0466958_0083889 | 3300045836 | Bacteria | 1964 |
| 382 | Ga0466958_0184088 | 3300045836 | Bacteria | 1326 |
| 383 | Ga0466967_0002647 | 3300045976 | Bacteria | 11293 |
| 384 | Ga0466967_0129520 | 3300045976 | Bacteria | 2341 |
| 385 | Ga0466967_0376621 | 3300045976 | Bacteria | 1378 |
| 386 | Ga0495592_0019590 | 3300046454 | Bacteria | 5146 |
| 387 | Ga0495592_0038235 | 3300046454 | Bacteria | 3611 |
| 388 | Ga0495592_0072959 | 3300046454 | Bacteria | 2496 |
| 389 | Ga0495603_0014097 | 3300046455 | Bacteria | 4835 |
| 390 | Ga0495629_0000775 | 3300046459 | Bacteria | 25817 |
| 391 | Ga0495629_0005478 | 3300046459 | Bacteria | 9475 |
| 392 | Ga0495629_0011545 | 3300046459 | Bacteria | 6416 |
| 393 | Ga0495629_0088232 | 3300046459 | Bacteria | 2163 |
| 394 | Ga0495638_0030487 | 3300046460 | Bacteria | 3471 |
| 395 | Ga0495641_0019903 | 3300046461 | Bacteria | 3419 |
| 396 | Ga0495641_0049246 | 3300046461 | Bacteria | 1930 |
| 397 | Ga0495651_0005539 | 3300046462 | Bacteria | 9628 |
| 398 | Ga0495651_0028825 | 3300046462 | Bacteria | 4328 |
| 399 | Ga0495651_0045111 | 3300046462 | Bacteria | 3415 |
| 400 | Ga0495651_0094554 | 3300046462 | Bacteria | 2236 |
| 401 | Ga0495651_0210504 | 3300046462 | Bacteria | 1353 |
| 402 | Ga0495653_0000015 | 3300046463 | Bacteria | 213697 |
| 403 | Ga0495653_0017397 | 3300046463 | Bacteria | 5847 |
| 404 | Ga0495653_0038019 | 3300046463 | Bacteria | 3778 |
| 405 | Ga0495653_0060219 | 3300046463 | Bacteria | 2877 |
| 406 | Ga0495653_0124846 | 3300046463 | Bacteria | 1829 |
| 407 | Ga0495580_0054761 | 3300046472 | Bacteria | 2812 |
| 408 | Ga0495580_0068255 | 3300046472 | Bacteria | 2486 |
| 409 | Ga0495582_0002289 | 3300046473 | Bacteria | 10717 |
| 410 | Ga0495582_0028131 | 3300046473 | Bacteria | 3084 |
| 411 | Ga0495605_0026611 | 3300046474 | Bacteria | 3006 |
| 412 | Ga0495639_0001906 | 3300046475 | Bacteria | 9250 |
| 413 | Ga0495639_0056809 | 3300046475 | Bacteria | 1787 |
| 414 | Ga0495639_0129944 | 3300046475 | Bacteria | 1205 |
| 415 | Ga0495662_0002924 | 3300046476 | Bacteria | 8628 |
| 416 | Ga0495662_0006587 | 3300046476 | Bacteria | 5797 |
| 417 | Ga0495662_0039510 | 3300046476 | Bacteria | 2279 |
| 418 | Ga0495662_0165999 | 3300046476 | Bacteria | 1088 |
| 419 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 420 | Ga0495664_0000142 | 3300046477 | Bacteria | 35911 |
| 421 | Ga0495664_0014165 | 3300046477 | Bacteria | 4518 |
| 422 | Ga0495594_0061294 | 3300046499 | Bacteria | 2082 |
| 423 | Ga0495608_0000135 | 3300046511 | Bacteria | 53120 |
| 424 | Ga0495608_0016441 | 3300046511 | Bacteria | 5120 |
| 425 | Ga0495608_0121575 | 3300046511 | Bacteria | 1674 |
| 426 | Ga0495608_0229456 | 3300046511 | Bacteria | 1163 |
| 427 | Ga0495618_0000052 | 3300046514 | Bacteria | 85440 |
| 428 | Ga0495618_0000471 | 3300046514 | Bacteria | 28723 |
| 429 | Ga0495618_0008311 | 3300046514 | Bacteria | 6285 |
| 430 | Ga0495618_0010590 | 3300046514 | Bacteria | 5579 |
| 431 | Ga0495618_0049870 | 3300046514 | Bacteria | 2643 |
| 432 | Ga0495628_0000005 | 3300046516 | Bacteria | 420969 |
| 433 | Ga0495628_0049349 | 3300046516 | Bacteria | 3333 |
| 434 | Ga0495630_0000810 | 3300046517 | Bacteria | 21970 |
| 435 | Ga0495630_0036902 | 3300046517 | Bacteria | 3654 |
| 436 | Ga0495630_0343365 | 3300046517 | Unclassified | 1142 |
| 437 | Ga0495644_0000386 | 3300046523 | Bacteria | 19971 |
| 438 | Ga0495666_0046182 | 3300046526 | Bacteria | 2100 |
| 439 | Ga0495666_0142316 | 3300046526 | Unclassified | 1117 |
| 440 | Ga0495666_0147559 | 3300046526 | Bacteria | 1095 |
| 441 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 442 | Ga0495652_0015686 | 3300046529 | Bacteria | 6782 |
| 443 | Ga0495652_0094220 | 3300046529 | Bacteria | 2442 |
| 444 | Ga0495652_0102291 | 3300046529 | Bacteria | 2321 |
| 445 | Ga0495665_0011071 | 3300046531 | Bacteria | 4881 |
| 446 | Ga0495665_0014033 | 3300046531 | Bacteria | 4326 |
| 447 | Ga0495665_0083043 | 3300046531 | Bacteria | 1684 |
| 448 | Ga0495640_0000006 | 3300046533 | Bacteria | 285419 |
| 449 | Ga0495640_0003772 | 3300046533 | Bacteria | 12157 |
| 450 | Ga0495640_0035965 | 3300046533 | Bacteria | 3502 |
| 451 | Ga0495640_0045036 | 3300046533 | Bacteria | 3063 |
| 452 | Ga0495640_0045816 | 3300046533 | Bacteria | 3033 |
| 453 | Ga0495640_0076940 | 3300046533 | Bacteria | 2225 |
| 454 | Ga0495640_0252389 | 3300046533 | Bacteria | 1104 |
| 455 | Ga0495587_0000012 | 3300046536 | Bacteria | 197088 |
| 456 | Ga0495587_0073090 | 3300046536 | Bacteria | 1992 |
| 457 | Ga0495645_0000014 | 3300046543 | Bacteria | 172712 |
| 458 | Ga0495645_0009924 | 3300046543 | Bacteria | 6663 |
| 459 | Ga0495645_0166155 | 3300046543 | Bacteria | 1522 |
| 460 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 461 | Ga0495667_0008415 | 3300046559 | Bacteria | 7000 |
| 462 | Ga0495667_0020257 | 3300046559 | Bacteria | 4488 |
| 463 | Ga0495667_0030679 | 3300046559 | Bacteria | 3612 |
| 464 | Ga0495656_0000650 | 3300046615 | Bacteria | 11110 |
| 465 | Ga0495634_0000412 | 3300046642 | Bacteria | 42303 |
| 466 | Ga0495634_0005395 | 3300046642 | Bacteria | 9849 |
| 467 | Ga0495634_0009029 | 3300046642 | Bacteria | 7375 |
| 468 | Ga0495634_0168651 | 3300046642 | Bacteria | 1377 |
| 469 | Ga0495634_0219946 | 3300046642 | Bacteria | 1172 |
| 470 | Ga0495635_0000007 | 3300046663 | Bacteria | 278786 |
| 471 | Ga0495635_0002818 | 3300046663 | Bacteria | 11934 |
| 472 | Ga0495635_0011967 | 3300046663 | Bacteria | 6078 |
| 473 | Ga0495635_0056121 | 3300046663 | Bacteria | 2712 |
| 474 | Ga0495659_0007001 | 3300046664 | Bacteria | 3571 |
| 475 | Ga0495588_0020559 | 3300046674 | Bacteria | 3247 |
| 476 | Ga0495588_0037530 | 3300046674 | Bacteria | 2462 |
| 477 | Ga0495588_0092353 | 3300046674 | Bacteria | 1586 |
| 478 | Ga0495657_0000727 | 3300046675 | Bacteria | 29568 |
| 479 | Ga0495657_0031511 | 3300046675 | Bacteria | 3706 |
| 480 | Ga0495657_0079268 | 3300046675 | Bacteria | 2127 |
| 481 | Ga0495657_0150747 | 3300046675 | Unclassified | 1444 |
| 482 | Ga0495599_0000002 | 3300046678 | Bacteria | 348168 |
| 483 | Ga0495599_0014166 | 3300046678 | Bacteria | 4936 |
| 484 | Ga0495599_0049670 | 3300046678 | Bacteria | 2629 |
| 485 | Ga0495599_0104615 | 3300046678 | Bacteria | 1763 |
| 486 | Ga0495623_0000316 | 3300046679 | Bacteria | 31267 |
| 487 | Ga0495623_0030361 | 3300046679 | Bacteria | 3476 |
| 488 | Ga0495623_0049791 | 3300046679 | Bacteria | 2655 |
| 489 | Ga0495646_0000024 | 3300046680 | Bacteria | 107836 |
| 490 | Ga0495646_0015685 | 3300046680 | Bacteria | 4808 |
| 491 | Ga0495646_0122061 | 3300046680 | Bacteria | 1473 |
| 492 | Ga0495647_0001516 | 3300046681 | Bacteria | 7173 |
| 493 | Ga0495647_0005856 | 3300046681 | Bacteria | 4045 |
| 494 | Ga0495647_0043513 | 3300046681 | Unclassified | 1718 |
| 495 | Ga0495658_0001879 | 3300046683 | Bacteria | 10728 |
| 496 | Ga0495658_0004566 | 3300046683 | Bacteria | 6809 |
| 497 | Ga0495658_0018833 | 3300046683 | Bacteria | 3596 |
| 498 | Ga0495658_0025734 | 3300046683 | Bacteria | 3148 |
| 499 | Ga0495658_0231711 | 3300046683 | Bacteria | 1158 |
| 500 | Ga0495613_0009325 | 3300046689 | Bacteria | 7284 |
| 501 | Ga0495613_0055042 | 3300046689 | Bacteria | 2924 |
| 502 | Ga0495613_0058735 | 3300046689 | Bacteria | 2822 |
| 503 | Ga0495613_0075985 | 3300046689 | Bacteria | 2445 |
| 504 | Ga0495613_0112125 | 3300046689 | Bacteria | 1964 |
| 505 | Ga0495624_0031072 | 3300046690 | Bacteria | 3475 |
| 506 | Ga0495624_0066228 | 3300046690 | Bacteria | 2255 |
| 507 | Ga0495624_0106044 | 3300046690 | Bacteria | 1729 |
| 508 | Ga0495670_0000894 | 3300046691 | Bacteria | 14410 |
| 509 | Ga0495600_0000199 | 3300046809 | Bacteria | 34659 |
| 510 | Ga0495600_0005943 | 3300046809 | Bacteria | 7385 |
| 511 | Ga0495600_0018126 | 3300046809 | Bacteria | 4483 |
| 512 | Ga0495600_0074410 | 3300046809 | Bacteria | 2218 |
| 513 | Ga0495600_0129665 | 3300046809 | Bacteria | 1640 |
| 514 | Ga0495581_0007126 | 3300047315 | Bacteria | 6476 |
| 515 | Ga0495581_0027077 | 3300047315 | Bacteria | 3325 |
| 516 | Ga0495581_0076674 | 3300047315 | Bacteria | 1934 |
| 517 | Ga0495581_0108684 | 3300047315 | Bacteria | 1612 |
| 518 | Ga0495604_0000007 | 3300047317 | Bacteria | 412174 |
| 519 | Ga0495604_0012881 | 3300047317 | Bacteria | 6661 |
| 520 | Ga0495604_0025099 | 3300047317 | Bacteria | 4751 |
| 521 | Ga0495604_0036455 | 3300047317 | Bacteria | 3877 |
| 522 | Ga0495604_0156951 | 3300047317 | Bacteria | 1611 |
| 523 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 524 | Ga0495674_0002597 | 3300047319 | Bacteria | 17589 |
| 525 | Ga0495674_0047646 | 3300047319 | Bacteria | 3798 |
| 526 | Ga0495674_0130824 | 3300047319 | Bacteria | 2114 |
| 527 | Ga0495674_0168509 | 3300047319 | Bacteria | 1828 |
| 528 | Ga0495674_0173387 | 3300047319 | Bacteria | 1799 |
| 529 | Ga0495676_0028084 | 3300047321 | Bacteria | 4814 |
| 530 | Ga0495676_0058811 | 3300047321 | Bacteria | 3022 |
| 531 | Ga0495676_0108857 | 3300047321 | Bacteria | 2037 |
| 532 | Ga0495676_0206567 | 3300047321 | Bacteria | 1361 |
| 533 | Ga0495676_0304691 | 3300047321 | Bacteria | 1074 |
| 534 | Ga0495680_0001123 | 3300047322 | Bacteria | 29537 |
| 535 | Ga0495680_0002456 | 3300047322 | Bacteria | 18966 |
| 536 | Ga0495680_0006886 | 3300047322 | Bacteria | 10493 |
| 537 | Ga0495680_0014973 | 3300047322 | Bacteria | 6698 |
| 538 | Ga0495680_0048245 | 3300047322 | Bacteria | 3345 |
| 539 | Ga0495680_0161385 | 3300047322 | Bacteria | 1627 |
| 540 | Ga0495675_0012559 | 3300047444 | Bacteria | 5329 |
| 541 | Ga0495675_0079347 | 3300047444 | Bacteria | 2067 |
| 542 | Ga0495679_026145 | 3300047446 | Unclassified | 1942 |
| 543 | Ga0495684_0000027 | 3300047471 | Bacteria | 124367 |
| 544 | Ga0495684_0002588 | 3300047471 | Bacteria | 14376 |
| 545 | Ga0495684_0006984 | 3300047471 | Bacteria | 8767 |
| 546 | Ga0495684_0007306 | 3300047471 | Bacteria | 8561 |
| 547 | Ga0495684_0013953 | 3300047471 | Bacteria | 6180 |
| 548 | Ga0495684_0049415 | 3300047471 | Bacteria | 3213 |
| 549 | Ga0495684_0085286 | 3300047471 | Bacteria | 2395 |
| 550 | Ga0495593_0009027 | 3300047673 | Bacteria | 5787 |
| 551 | Ga0495593_0028777 | 3300047673 | Bacteria | 3050 |
| 552 | Ga0495593_0061380 | 3300047673 | Bacteria | 1966 |
| 553 | Ga0495602_0000004 | 3300048088 | Bacteria | 326932 |
| 554 | Ga0495602_0036446 | 3300048088 | Bacteria | 4578 |
| 555 | Ga0495614_0039752 | 3300048089 | Bacteria | 2019 |
| 556 | Ga0496100_0005158 | 3300048903 | Bacteria | 7008 |
| 557 | Ga0496100_0060556 | 3300048903 | Bacteria | 2491 |
| 558 | Ga0496100_0095448 | 3300048903 | Bacteria | 2038 |
| 559 | Ga0496101_0045110 | 3300048904 | Bacteria | 3156 |
| 560 | Ga0496101_0045395 | 3300048904 | Bacteria | 3147 |
| 561 | Ga0496101_0325934 | 3300048904 | Bacteria | 1205 |
| 562 | Ga0496102_0019080 | 3300048905 | Bacteria | 6036 |
| 563 | Ga0496102_0176603 | 3300048905 | Bacteria | 2011 |
| 564 | Ga0496102_0179495 | 3300048905 | Bacteria | 1994 |
| 565 | Ga0496103_0010024 | 3300048906 | Bacteria | 5600 |
| 566 | Ga0496104_0000562 | 3300048907 | Bacteria | 31660 |
| 567 | Ga0496104_0001263 | 3300048907 | Bacteria | 21783 |
| 568 | Ga0496104_0016166 | 3300048907 | Bacteria | 6772 |
| 569 | Ga0496104_0021653 | 3300048907 | Bacteria | 5903 |
| 570 | Ga0496104_0043494 | 3300048907 | Bacteria | 4219 |
| 571 | Ga0496104_0046531 | 3300048907 | Plasmid | 4086 |
| 572 | Ga0496104_0051047 | 3300048907 | Bacteria | 3902 |
| 573 | Ga0496104_0171634 | 3300048907 | Bacteria | 2079 |
| 574 | Ga0496105_0009982 | 3300048908 | Bacteria | 7449 |
| 575 | Ga0496105_0032929 | 3300048908 | Bacteria | 4254 |
| 576 | Ga0496105_0040908 | 3300048908 | Bacteria | 3821 |
| 577 | Ga0496105_0049778 | 3300048908 | Bacteria | 3460 |
| 578 | Ga0496105_0125268 | 3300048908 | Bacteria | 2118 |
| 579 | Ga0496106_0004426 | 3300048909 | Bacteria | 10409 |
| 580 | Ga0496106_0026044 | 3300048909 | Bacteria | 4352 |
| 581 | Ga0496106_0033517 | 3300048909 | Bacteria | 3832 |
| 582 | Ga0496107_0010626 | 3300048910 | Bacteria | 6400 |
| 583 | Ga0496107_0056936 | 3300048910 | Bacteria | 2825 |
| 584 | Ga0496107_0246284 | 3300048910 | Bacteria | 1330 |
| 585 | Ga0496108_0003177 | 3300048911 | Bacteria | 13221 |
| 586 | Ga0496108_0006351 | 3300048911 | Bacteria | 9581 |
| 587 | Ga0496108_0032189 | 3300048911 | Bacteria | 4354 |
| 588 | Ga0496108_0095214 | 3300048911 | Bacteria | 2535 |
| 589 | Ga0496108_0145269 | 3300048911 | Bacteria | 2045 |
| 590 | Ga0496108_0155207 | 3300048911 | Bacteria | 1976 |
| 591 | Ga0496108_0527646 | 3300048911 | Bacteria | 1031 |
| 592 | Ga0496109_0010249 | 3300048912 | Bacteria | 8003 |
| 593 | Ga0496109_0063465 | 3300048912 | Bacteria | 3379 |
| 594 | Ga0496109_0115593 | 3300048912 | Bacteria | 2496 |
| 595 | Ga0496110_0005949 | 3300048913 | Bacteria | 9600 |
| 596 | Ga0496110_0010442 | 3300048913 | Bacteria | 7551 |
| 597 | Ga0496110_0077701 | 3300048913 | Bacteria | 2953 |
| 598 | Ga0496110_0187722 | 3300048913 | Bacteria | 1877 |
| 599 | Ga0496110_0265508 | 3300048913 | Unclassified | 1562 |
| 600 | Ga0496111_0007695 | 3300048914 | Bacteria | 7086 |
| 601 | Ga0496111_0065672 | 3300048914 | Unclassified | 2634 |
| 602 | Ga0496112_0040219 | 3300048915 | Bacteria | 4571 |
| 603 | Ga0496112_0055982 | 3300048915 | Bacteria | 3880 |
| 604 | Ga0496112_0063761 | 3300048915 | Bacteria | 3635 |
| 605 | Ga0496112_0075408 | 3300048915 | Bacteria | 3335 |
| 606 | Ga0496113_0003312 | 3300048916 | Bacteria | 9619 |
| 607 | Ga0496113_0008306 | 3300048916 | Bacteria | 6758 |
| 608 | Ga0496113_0078603 | 3300048916 | Bacteria | 2524 |
| 609 | Ga0496114_0043271 | 3300048917 | Bacteria | 3734 |
| 610 | Ga0496114_0078272 | 3300048917 | Bacteria | 2789 |
| 611 | Ga0496114_0107053 | 3300048917 | Bacteria | 2393 |
| 612 | Ga0496114_0289303 | 3300048917 | Bacteria | 1445 |
| 613 | Ga0496115_0029402 | 3300048918 | Bacteria | 4315 |
| 614 | Ga0496115_0045589 | 3300048918 | Bacteria | 3501 |
| 615 | Ga0496115_0242454 | 3300048918 | Bacteria | 1485 |
| 616 | Ga0496115_0269683 | 3300048918 | Bacteria | 1398 |
| 617 | Ga0501031_0013124 | 3300049568 | Bacteria | 5405 |
| 618 | Ga0501031_0049006 | 3300049568 | Bacteria | 2752 |
| 619 | Ga0501032_0038885 | 3300049569 | Bacteria | 3238 |
| 620 | Ga0501033_0069637 | 3300049570 | Bacteria | 2585 |
| 621 | Ga0501034_0168129 | 3300049571 | Bacteria | 2161 |
| 622 | Ga0501034_0183588 | 3300049571 | Bacteria | 2056 |
| 623 | Ga0501034_0207610 | 3300049571 | Bacteria | 1914 |
| 624 | Ga0501034_0284510 | 3300049571 | Bacteria | 1593 |
| 625 | Ga0501036_0010381 | 3300049572 | Bacteria | 7688 |
| 626 | Ga0501036_0190420 | 3300049572 | Bacteria | 1726 |
| 627 | Ga0501037_0061031 | 3300049573 | Bacteria | 2749 |
| 628 | Ga0501038_0101814 | 3300049574 | Bacteria | 2391 |
| 629 | Ga0501038_0140723 | 3300049574 | Bacteria | 1974 |
| 630 | Ga0501039_0061110 | 3300049575 | Bacteria | 2918 |
| 631 | Ga0501039_0228921 | 3300049575 | Bacteria | 1461 |
| 632 | Ga0501040_0067103 | 3300049576 | Bacteria | 2472 |
| 633 | Ga0501043_0130034 | 3300049579 | Bacteria | 1973 |
| 634 | Ga0501046_0085272 | 3300049580 | Bacteria | 2436 |
| 635 | Ga0501047_0004258 | 3300049581 | Bacteria | 13475 |
| 636 | Ga0501047_0027586 | 3300049581 | Bacteria | 5470 |
| 637 | Ga0501047_0075887 | 3300049581 | Bacteria | 3235 |
| 638 | Ga0501047_0093555 | 3300049581 | Bacteria | 2885 |
| 639 | Ga0501047_0123862 | 3300049581 | Bacteria | 2465 |
| 640 | Ga0501047_0246229 | 3300049581 | Bacteria | 1637 |
| 641 | Ga0501067_0018878 | 3300049583 | Bacteria | 3815 |
| 642 | Ga0501069_0081927 | 3300049585 | Bacteria | 1818 |
| 643 | Ga0501070_0122017 | 3300049586 | Bacteria | 2154 |
| 644 | Ga0501071_0044022 | 3300049587 | Bacteria | 3202 |
| 645 | Ga0501072_0003155 | 3300049588 | Bacteria | 12407 |
| 646 | Ga0501072_0035078 | 3300049588 | Bacteria | 3932 |
| 647 | Ga0501073_0050072 | 3300049589 | Bacteria | 2928 |
| 648 | Ga0501074_0044581 | 3300049590 | Bacteria | 3210 |
| 649 | Ga0501075_0026735 | 3300049591 | Bacteria | 4250 |
| 650 | Ga0501076_0313659 | 3300049592 | Bacteria | 1286 |
| 651 | Ga0501077_0036395 | 3300049593 | Bacteria | 3135 |
| 652 | Ga0501079_0159044 | 3300049741 | Bacteria | 1761 |
| 653 | Ga0501079_0278825 | 3300049741 | Bacteria | 1307 |
| 654 | Ga0501080_0027409 | 3300049742 | Bacteria | 5296 |
| 655 | Ga0501081_0274681 | 3300049743 | Unclassified | 1233 |
| 656 | Ga0501083_0078158 | 3300049744 | Bacteria | 2195 |
| 657 | Ga0501083_0140351 | 3300049744 | Bacteria | 1582 |
| 658 | Ga0501035_0008134 | 3300049822 | Bacteria | 9777 |
| 659 | Ga0501035_0009844 | 3300049822 | Bacteria | 8879 |
| 660 | Ga0501044_0000678 | 3300049823 | Bacteria | 41178 |
| 661 | Ga0501044_0036346 | 3300049823 | Bacteria | 5153 |
| 662 | Ga0501044_0093943 | 3300049823 | Bacteria | 3024 |
| 663 | Ga0501044_0125724 | 3300049823 | Bacteria | 2562 |
| 664 | Ga0501044_0159501 | 3300049823 | Bacteria | 2233 |
| 665 | Ga0501044_0389154 | 3300049823 | Bacteria | 1308 |
| 666 | Ga0501045_0084414 | 3300049824 | Bacteria | 2343 |
| 667 | nmdc:mga0k408_2291_c1 | 3300050493 | Bacteria | 10211 |
| 668 | nmdc:mga06z11_33731_c1 | 3300050494 | Bacteria | 2506 |
| 669 | nmdc:mga04h51_28014_c1 | 3300050495 | Bacteria | 1755 |
| 670 | nmdc:mga05p37_2004_c1 | 3300050507 | Bacteria | 23770 |
| 671 | nmdc:mga09592_16801_c1 | 3300050508 | Bacteria | 5989 |
| 672 | nmdc:mga0qj67_229351_c1 | 3300050509 | Bacteria | 1507 |
| 673 | nmdc:mga0qj67_96594_c1 | 3300050509 | Bacteria | 2379 |
| 674 | nmdc:mga06r32_475510_c1 | 3300050510 | Bacteria | 1228 |
| 675 | nmdc:mga06r32_9412_c1 | 3300050510 | Bacteria | 8814 |
| 676 | nmdc:mga08y16_127411_c1 | 3300050511 | Bacteria | 2648 |
| 677 | nmdc:mga08y16_14054_c1 | 3300050511 | Bacteria | 8426 |
| 678 | nmdc:mga08y16_156211_c1 | 3300050511 | Bacteria | 2370 |
| 679 | nmdc:mga0n895_10236_c1 | 3300050512 | Bacteria | 8262 |
| 680 | nmdc:mga0n895_103114_c1 | 3300050512 | Bacteria | 2864 |
| 681 | nmdc:mga0n895_110900_c1 | 3300050512 | Bacteria | 2759 |
| 682 | nmdc:mga0n895_126318_c1 | 3300050512 | Bacteria | 2582 |
| 683 | nmdc:mga0n895_15555_c1 | 3300050512 | Bacteria | 6943 |
| 684 | nmdc:mga0n895_454051_c1 | 3300050512 | Bacteria | 1294 |
| 685 | nmdc:mga0rr50_17088_c1 | 3300050513 | Bacteria | 4833 |
| 686 | nmdc:mga0rr50_36083_c1 | 3300050513 | Bacteria | 3557 |
| 687 | nmdc:mga0a205_233265_c1 | 3300050515 | Bacteria | 1723 |
| 688 | nmdc:mga0a205_8096_c1 | 3300050515 | Bacteria | 9552 |
| 689 | nmdc:mga0a205_81153_c1 | 3300050515 | Bacteria | 3133 |
| 690 | Ga0495601_0000006 | 3300053077 | Bacteria | 373770 |
| 691 | Ga0495601_0002675 | 3300053077 | Bacteria | 10095 |
| 692 | Ga0495601_0007858 | 3300053077 | Bacteria | 6278 |
| 693 | Ga0495601_0024875 | 3300053077 | Bacteria | 3688 |
| 694 | Ga0495601_0028456 | 3300053077 | Bacteria | 3461 |
| 695 | Ga0495601_0028943 | 3300053077 | Bacteria | 3433 |
| 696 | Ga0495601_0175586 | 3300053077 | Bacteria | 1400 |
| 697 | Ga0495612_0000004 | 3300053078 | Bacteria | 286946 |
| 698 | Ga0495612_0009160 | 3300053078 | Bacteria | 4016 |
| 699 | Ga0495612_0013401 | 3300053078 | Bacteria | 3302 |
| 700 | Ga0495612_0040548 | 3300053078 | Bacteria | 1897 |
| 701 | Ga0495612_0041614 | 3300053078 | Bacteria | 1874 |
| 702 | Ga0495655_0015752 | 3300053083 | Bacteria | 1614 |
| 703 | Ga0495595_0000006 | 3300053084 | Bacteria | 231295 |
| 704 | Ga0495595_0001305 | 3300053084 | Bacteria | 9703 |
| 705 | Ga0495595_0012396 | 3300053084 | Bacteria | 3583 |
| 706 | Ga0495595_0013412 | 3300053084 | Bacteria | 3462 |
| 707 | Ga0495595_0016552 | 3300053084 | Bacteria | 3158 |
| 708 | Ga0495595_0185582 | 3300053084 | Bacteria | 1032 |
| 709 | Ga0495619_0000011 | 3300053085 | Bacteria | 287128 |
| 710 | Ga0495619_0000663 | 3300053085 | Bacteria | 22537 |
| 711 | Ga0495619_0001380 | 3300053085 | Bacteria | 15969 |
| 712 | Ga0495619_0004123 | 3300053085 | Bacteria | 9287 |
| 713 | Ga0495619_0031842 | 3300053085 | Bacteria | 3418 |
| 714 | Ga0495619_0050745 | 3300053085 | Bacteria | 2739 |
| 715 | Ga0495619_0213479 | 3300053085 | Bacteria | 1336 |
| 716 | Ga0495619_0220305 | 3300053085 | Bacteria | 1314 |
| 717 | Ga0495619_0245575 | 3300053085 | Bacteria | 1240 |
| 718 | Ga0500651_0006323 | 3300053093 | Bacteria | 6814 |
| 719 | Ga0500641_0125525 | 3300053096 | Bacteria | 1107 |
| 720 | Ga0500650_0011582 | 3300053098 | Bacteria | 3638 |
| 721 | Ga0500593_014418 | 3300053117 | Bacteria | 3391 |
| 722 | Ga0500595_011732 | 3300053119 | Bacteria | 3415 |
| 723 | Ga0500604_0014525 | 3300053151 | Bacteria | 2145 |
| 724 | Ga0500616_0126874 | 3300053153 | Bacteria | 1210 |
| 725 | Ga0500645_000143 | 3300053730 | Bacteria | 56081 |
| 726 | Ga0501084_0024027 | 3300054114 | Bacteria | 5083 |
| 727 | Ga0501084_0144528 | 3300054114 | Bacteria | 2003 |
| 728 | Ga0501084_0202458 | 3300054114 | Bacteria | 1675 |
| 729 | Ga0501082_0088060 | 3300060353 | Bacteria | 2679 |
| 730 | Ga0501082_0560418 | 3300060353 | Bacteria | 999 |
| 731 | Ga0530510_0044903 | 3300061734 | Bacteria | 3194 |
| 732 | Ga0530510_0170185 | 3300061734 | Bacteria | 1614 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053078 | Ga0495612_0009160 | Ga0495612_0009160_3241_3984 | 245 |
| 2 | 3300025942 | Ga0207689_10046493 | Ga0207689_100464933 | 246 |
| 3 | 3300049581 | Ga0501047_0075887 | Ga0501047_0075887_2476_3222 | 246 |
| 4 | 3300046809 | Ga0495600_0129665 | Ga0495600_0129665_16_771 | 250 |
| 5 | 3300046529 | Ga0495652_0094220 | Ga0495652_0094220_87_860 | 255 |
| 6 | 3300047315 | Ga0495581_0108684 | Ga0495581_0108684_79_852 | 255 |
| 7 | 3300047321 | Ga0495676_0206567 | Ga0495676_0206567_40_813 | 255 |
| 8 | 3300047471 | Ga0495684_0085286 | Ga0495684_0085286_1575_2348 | 255 |
| 9 | 3300049741 | Ga0501079_0278825 | Ga0501079_0278825_515_1291 | 257 |
| 10 | 3300050509 | nmdc:mga0qj67_229351_c1 | nmdc:mga0qj67_229351_c1_693_1475 | 257 |
| 11 | 3300039447 | Ga0436361_0925931 | Ga0436361_0925931_11_790 | 258 |
| 12 | 3300042461 | Ga0439460_0056930 | Ga0439460_0056930_376_1155 | 258 |
| 13 | 3300046517 | Ga0495630_0000810 | Ga0495630_0000810_18129_18929 | 258 |
| 14 | 3300053151 | Ga0500604_0014525 | Ga0500604_0014525_1322_2110 | 258 |
| 15 | 3300024225 | Ga0224572_1000634 | Ga0224572_10006344 | 264 |
| 16 | 3300005435 | Ga0070714_100115564 | Ga0070714_1001155642 | 268 |
| 17 | 3300005616 | Ga0068852_100035849 | Ga0068852_1000358493 | 268 |
| 18 | 3300005563 | Ga0068855_100029137 | Ga0068855_1000291374 | 272 |
| 19 | 3300025909 | Ga0207705_10063491 | Ga0207705_100634912 | 272 |
| 20 | 3300025917 | Ga0207660_10019987 | Ga0207660_100199874 | 272 |
| 21 | 3300025919 | Ga0207657_10004688 | Ga0207657_100046883 | 272 |
| 22 | 3300025921 | Ga0207652_10017799 | Ga0207652_100177994 | 272 |
| 23 | 3300031712 | Ga0265342_10000518 | Ga0265342_1000051812 | 272 |
| 24 | 3300045836 | Ga0466958_0184088 | Ga0466958_0184088_14_835 | 272 |
| 25 | 3300049823 | Ga0501044_0125724 | Ga0501044_0125724_1720_2541 | 272 |
| 26 | 3300020081 | Ga0206354_10791022 | Ga0206354_107910221 | 273 |
| 27 | 3300028800 | Ga0265338_10019657 | Ga0265338_100196574 | 275 |
| 28 | 3300031235 | Ga0265330_10023812 | Ga0265330_100238123 | 275 |
| 29 | 3300031249 | Ga0265339_10036217 | Ga0265339_100362172 | 275 |
| 30 | 3300031712 | Ga0265342_10005933 | Ga0265342_100059335 | 275 |
| 31 | 3300048911 | Ga0496108_0527646 | Ga0496108_0527646_184_1014 | 275 |
| 32 | 3300025898 | Ga0207692_10243676 | Ga0207692_102436761 | 276 |
| 33 | 3300005336 | Ga0070680_100125863 | Ga0070680_1001258632 | 277 |
| 34 | 3300005530 | Ga0070679_100169791 | Ga0070679_1001697912 | 277 |
| 35 | 3300025921 | Ga0207652_10136848 | Ga0207652_101368483 | 277 |
| 36 | 3300049571 | Ga0501034_0168129 | Ga0501034_0168129_103_1017 | 279 |
| 37 | 3300049588 | Ga0501072_0035078 | Ga0501072_0035078_1613_2527 | 279 |
| 38 | 3300005614 | Ga0068856_100492591 | Ga0068856_1004925912 | 280 |
| 39 | 3300005336 | Ga0070680_100019308 | Ga0070680_1000193084 | 281 |
| 40 | 3300005563 | Ga0068855_100563935 | Ga0068855_1005639351 | 281 |
| 41 | 3300013104 | Ga0157370_10037827 | Ga0157370_100378273 | 281 |
| 42 | 3300020069 | Ga0197907_10636662 | Ga0197907_106366622 | 281 |
| 43 | 3300020082 | Ga0206353_11305831 | Ga0206353_113058312 | 281 |
| 44 | 3300025949 | Ga0207667_10114444 | Ga0207667_101144441 | 281 |
| 45 | 3300005327 | Ga0070658_10142249 | Ga0070658_101422493 | 283 |
| 46 | 3300005339 | Ga0070660_100008537 | Ga0070660_1000085374 | 283 |
| 47 | 3300005530 | Ga0070679_100067619 | Ga0070679_1000676193 | 283 |
| 48 | 3300026142 | Ga0207698_10238304 | Ga0207698_102383042 | 283 |
| 49 | 3300026142 | Ga0207698_10495856 | Ga0207698_104958562 | 283 |
| 50 | 3300031241 | Ga0265325_10000053 | Ga0265325_1000005365 | 284 |
| 51 | 3300031595 | Ga0265313_10014816 | Ga0265313_100148163 | 284 |
| 52 | 3300005530 | Ga0070679_100160367 | Ga0070679_1001603673 | 285 |
| 53 | 3300006852 | Ga0075433_10264811 | Ga0075433_102648112 | 285 |
| 54 | 3300006871 | Ga0075434_100248991 | Ga0075434_1002489912 | 285 |
| 55 | 3300025921 | Ga0207652_10099816 | Ga0207652_100998162 | 285 |
| 56 | 3300050512 | nmdc:mga0n895_110900_c1 | nmdc:mga0n895_110900_c1_1374_2306 | 285 |
| 57 | 3300050515 | nmdc:mga0a205_81153_c1 | nmdc:mga0a205_81153_c1_1838_2770 | 285 |
| 58 | 3300007076 | Ga0075435_100174513 | Ga0075435_1001745132 | 286 |
| 59 | 3300037068 | Ga0373925_0067422 | Ga0373925_0067422_641_1534 | 286 |
| 60 | 3300061734 | Ga0530510_0170185 | Ga0530510_0170185_380_1246 | 286 |
| 61 | 3300005329 | Ga0070683_100214136 | Ga0070683_1002141362 | 287 |
| 62 | 3300005563 | Ga0068855_100176238 | Ga0068855_1001762383 | 287 |
| 63 | 3300025909 | Ga0207705_10141179 | Ga0207705_101411793 | 287 |
| 64 | 3300025944 | Ga0207661_10155948 | Ga0207661_101559482 | 287 |
| 65 | 3300025949 | Ga0207667_10132921 | Ga0207667_101329212 | 287 |
| 66 | 3300050515 | nmdc:mga0a205_233265_c1 | nmdc:mga0a205_233265_c1_674_1540 | 287 |
| 67 | 3300005614 | Ga0068856_100100864 | Ga0068856_1001008642 | 288 |
| 68 | 3300049823 | Ga0501044_0093943 | Ga0501044_0093943_841_1755 | 290 |
| 69 | 3300049823 | Ga0501044_0389154 | Ga0501044_0389154_251_1177 | 291 |
| 70 | 3300053096 | Ga0500641_0125525 | Ga0500641_0125525_207_1085 | 291 |
| 71 | 3300006914 | Ga0075436_100147960 | Ga0075436_1001479602 | 292 |
| 72 | 3300010375 | Ga0105239_10580658 | Ga0105239_105806581 | 292 |
| 73 | 3300005329 | Ga0070683_100076411 | Ga0070683_1000764112 | 293 |
| 74 | 3300009094 | Ga0111539_10101847 | Ga0111539_101018473 | 293 |
| 75 | 3300027907 | Ga0207428_10383373 | Ga0207428_103833731 | 293 |
| 76 | 3300039437 | Ga0436365_0421213 | Ga0436365_0421213_218_1129 | 293 |
| 77 | 3300046683 | Ga0495658_0231711 | Ga0495658_0231711_165_1082 | 293 |
| 78 | 3300048907 | Ga0496104_0051047 | Ga0496104_0051047_135_1049 | 293 |
| 79 | 3300048908 | Ga0496105_0032929 | Ga0496105_0032929_343_1257 | 293 |
| 80 | 3300048911 | Ga0496108_0032189 | Ga0496108_0032189_3190_4104 | 293 |
| 81 | 3300048913 | Ga0496110_0265508 | Ga0496110_0265508_179_1093 | 293 |
| 82 | 3300048915 | Ga0496112_0055982 | Ga0496112_0055982_2202_3116 | 293 |
| 83 | 3300049583 | Ga0501067_0018878 | Ga0501067_0018878_2838_3749 | 293 |
| 84 | 3300050511 | nmdc:mga08y16_156211_c1 | nmdc:mga08y16_156211_c1_1105_2019 | 293 |
| 85 | 3300050512 | nmdc:mga0n895_454051_c1 | nmdc:mga0n895_454051_c1_278_1192 | 293 |
| 86 | 3300005366 | Ga0070659_100138454 | Ga0070659_1001384541 | 294 |
| 87 | 3300005545 | Ga0070695_100221348 | Ga0070695_1002213482 | 294 |
| 88 | 3300005564 | Ga0070664_100380480 | Ga0070664_1003804802 | 294 |
| 89 | 3300006358 | Ga0068871_100005724 | Ga0068871_10000572410 | 294 |
| 90 | 3300009011 | Ga0105251_10027198 | Ga0105251_100271982 | 294 |
| 91 | 3300009148 | Ga0105243_10021600 | Ga0105243_100216003 | 294 |
| 92 | 3300009176 | Ga0105242_10008481 | Ga0105242_100084815 | 294 |
| 93 | 3300013297 | Ga0157378_10299102 | Ga0157378_102991022 | 294 |
| 94 | 3300025901 | Ga0207688_10089649 | Ga0207688_100896492 | 294 |
| 95 | 3300025911 | Ga0207654_10165019 | Ga0207654_101650192 | 294 |
| 96 | 3300031249 | Ga0265339_10059630 | Ga0265339_100596302 | 294 |
| 97 | 3300031595 | Ga0265313_10038835 | Ga0265313_100388351 | 294 |
| 98 | 3300035092 | Ga0373952_0006089 | Ga0373952_0006089_339_1253 | 294 |
| 99 | 3300035112 | Ga0373932_0009230 | Ga0373932_0009230_792_1706 | 294 |
| 100 | 3300035170 | Ga0373943_0081446 | Ga0373943_0081446_143_1057 | 294 |
| 101 | 3300035692 | Ga0373935_0015752 | Ga0373935_0015752_1338_2252 | 294 |
| 102 | 3300035695 | Ga0373927_0035459 | Ga0373927_0035459_83_997 | 294 |
| 103 | 3300035725 | Ga0373947_0005471 | Ga0373947_0005471_1270_2184 | 294 |
| 104 | 3300037068 | Ga0373925_0026243 | Ga0373925_0026243_696_1610 | 294 |
| 105 | 3300046459 | Ga0495629_0000775 | Ga0495629_0000775_1380_2294 | 294 |
| 106 | 3300046476 | Ga0495662_0165999 | Ga0495662_0165999_127_1041 | 294 |
| 107 | 3300046683 | Ga0495658_0001879 | Ga0495658_0001879_2462_3376 | 294 |
| 108 | 3300046689 | Ga0495613_0009325 | Ga0495613_0009325_5309_6223 | 294 |
| 109 | 3300047321 | Ga0495676_0108857 | Ga0495676_0108857_487_1401 | 294 |
| 110 | 3300047322 | Ga0495680_0014973 | Ga0495680_0014973_955_1869 | 294 |
| 111 | 3300047673 | Ga0495593_0009027 | Ga0495593_0009027_3778_4692 | 294 |
| 112 | 3300049581 | Ga0501047_0093555 | Ga0501047_0093555_926_1840 | 294 |
| 113 | 3300053085 | Ga0495619_0001380 | Ga0495619_0001380_2285_3199 | 294 |
| 114 | 3300005467 | Ga0070706_100113119 | Ga0070706_1001131193 | 295 |
| 115 | 3300005471 | Ga0070698_100084450 | Ga0070698_1000844502 | 295 |
| 116 | 3300005518 | Ga0070699_100300282 | Ga0070699_1003002821 | 295 |
| 117 | 3300021384 | Ga0213876_10001824 | Ga0213876_100018247 | 295 |
| 118 | 3300025910 | Ga0207684_10379665 | Ga0207684_103796651 | 295 |
| 119 | 3300031595 | Ga0265313_10000027 | Ga0265313_1000002743 | 295 |
| 120 | 3300035089 | Ga0373944_0037495 | Ga0373944_0037495_439_1329 | 295 |
| 121 | 3300035111 | Ga0373923_0070956 | Ga0373923_0070956_248_1138 | 295 |
| 122 | 3300035170 | Ga0373943_0022083 | Ga0373943_0022083_804_1694 | 295 |
| 123 | 3300035692 | Ga0373935_0010200 | Ga0373935_0010200_3837_4727 | 295 |
| 124 | 3300035695 | Ga0373927_0022023 | Ga0373927_0022023_734_1624 | 295 |
| 125 | 3300036401 | Ga0373937_0049773 | Ga0373937_0049773_1235_2125 | 295 |
| 126 | 3300037068 | Ga0373925_0025347 | Ga0373925_0025347_2209_3099 | 295 |
| 127 | 3300039437 | Ga0436365_1873205 | Ga0436365_1873205_7516_8406 | 295 |
| 128 | 3300039453 | Ga0436362_0818986 | Ga0436362_0818986_261_1151 | 295 |
| 129 | 3300046459 | Ga0495629_0005478 | Ga0495629_0005478_1540_2430 | 295 |
| 130 | 3300046472 | Ga0495580_0068255 | Ga0495580_0068255_1546_2436 | 295 |
| 131 | 3300046473 | Ga0495582_0002289 | Ga0495582_0002289_8522_9412 | 295 |
| 132 | 3300046475 | Ga0495639_0129944 | Ga0495639_0129944_220_1110 | 295 |
| 133 | 3300046531 | Ga0495665_0011071 | Ga0495665_0011071_165_1055 | 295 |
| 134 | 3300046663 | Ga0495635_0011967 | Ga0495635_0011967_2614_3504 | 295 |
| 135 | 3300046674 | Ga0495588_0092353 | Ga0495588_0092353_48_938 | 295 |
| 136 | 3300046681 | Ga0495647_0001516 | Ga0495647_0001516_1754_2644 | 295 |
| 137 | 3300046683 | Ga0495658_0004566 | Ga0495658_0004566_2575_3465 | 295 |
| 138 | 3300046689 | Ga0495613_0058735 | Ga0495613_0058735_1562_2452 | 295 |
| 139 | 3300047315 | Ga0495581_0007126 | Ga0495581_0007126_2494_3384 | 295 |
| 140 | 3300047471 | Ga0495684_0013953 | Ga0495684_0013953_1274_2164 | 295 |
| 141 | 3300053085 | Ga0495619_0004123 | Ga0495619_0004123_5829_6719 | 295 |
| 142 | 3300005937 | Ga0081455_10012637 | Ga0081455_100126373 | 296 |
| 143 | 3300005937 | Ga0081455_10125469 | Ga0081455_101254692 | 296 |
| 144 | 3300006194 | Ga0075427_10007028 | Ga0075427_100070282 | 296 |
| 145 | 3300006846 | Ga0075430_100089677 | Ga0075430_1000896772 | 296 |
| 146 | 3300006852 | Ga0075433_10001918 | Ga0075433_100019189 | 296 |
| 147 | 3300006871 | Ga0075434_100003168 | Ga0075434_1000031682 | 296 |
| 148 | 3300006880 | Ga0075429_100063595 | Ga0075429_1000635953 | 296 |
| 149 | 3300007076 | Ga0075435_100010352 | Ga0075435_1000103527 | 296 |
| 150 | 3300009147 | Ga0114129_10002620 | Ga0114129_100026204 | 296 |
| 151 | 3300025918 | Ga0207662_10111363 | Ga0207662_101113632 | 296 |
| 152 | 3300031241 | Ga0265325_10000693 | Ga0265325_1000069314 | 296 |
| 153 | 3300046642 | Ga0495634_0168651 | Ga0495634_0168651_254_1147 | 296 |
| 154 | 3300046675 | Ga0495657_0150747 | Ga0495657_0150747_397_1290 | 296 |
| 155 | 3300047319 | Ga0495674_0173387 | Ga0495674_0173387_876_1769 | 296 |
| 156 | 3300047322 | Ga0495680_0048245 | Ga0495680_0048245_1893_2786 | 296 |
| 157 | 3300048907 | Ga0496104_0001263 | Ga0496104_0001263_8800_9693 | 296 |
| 158 | 3300048918 | Ga0496115_0045589 | Ga0496115_0045589_842_1735 | 296 |
| 159 | 3300050507 | nmdc:mga05p37_2004_c1 | nmdc:mga05p37_2004_c1_17723_18616 | 296 |
| 160 | 3300050509 | nmdc:mga0qj67_96594_c1 | nmdc:mga0qj67_96594_c1_622_1515 | 296 |
| 161 | 3300050512 | nmdc:mga0n895_126318_c1 | nmdc:mga0n895_126318_c1_513_1406 | 296 |
| 162 | 3300050512 | nmdc:mga0n895_15555_c1 | nmdc:mga0n895_15555_c1_3523_4416 | 296 |
| 163 | 3300050513 | nmdc:mga0rr50_17088_c1 | nmdc:mga0rr50_17088_c1_985_1878 | 296 |
| 164 | 3300050515 | nmdc:mga0a205_8096_c1 | nmdc:mga0a205_8096_c1_3709_4602 | 296 |
| 165 | 3300053084 | Ga0495595_0016552 | Ga0495595_0016552_365_1258 | 296 |
| 166 | 3300053084 | Ga0495595_0185582 | Ga0495595_0185582_99_992 | 296 |
| 167 | 3300053085 | Ga0495619_0220305 | Ga0495619_0220305_29_922 | 296 |
| 168 | 3300009177 | Ga0105248_10061485 | Ga0105248_100614853 | 297 |
| 169 | 3300009551 | Ga0105238_10037336 | Ga0105238_100373362 | 297 |
| 170 | 3300025924 | Ga0207694_10032862 | Ga0207694_100328623 | 297 |
| 171 | 3300048910 | Ga0496107_0246284 | Ga0496107_0246284_329_1222 | 297 |
| 172 | 3300053117 | Ga0500593_014418 | Ga0500593_014418_1193_2125 | 297 |
| 173 | 3300005353 | Ga0070669_100173160 | Ga0070669_1001731602 | 298 |
| 174 | 3300005356 | Ga0070674_100126342 | Ga0070674_1001263422 | 298 |
| 175 | 3300005981 | Ga0081538_10003052 | Ga0081538_100030522 | 298 |
| 176 | 3300025915 | Ga0207693_10270398 | Ga0207693_102703982 | 298 |
| 177 | 3300044719 | Ga0466971_0077537 | Ga0466971_0077537_50_1021 | 298 |
| 178 | 3300045836 | Ga0466958_0083889 | Ga0466958_0083889_785_1693 | 298 |
| 179 | 3300048907 | Ga0496104_0043494 | Ga0496104_0043494_1754_2653 | 298 |
| 180 | 3300048908 | Ga0496105_0125268 | Ga0496105_0125268_1038_1937 | 298 |
| 181 | 3300048911 | Ga0496108_0145269 | Ga0496108_0145269_395_1294 | 298 |
| 182 | 3300049571 | Ga0501034_0284510 | Ga0501034_0284510_169_1080 | 298 |
| 183 | 3300049744 | Ga0501083_0078158 | Ga0501083_0078158_527_1468 | 298 |
| 184 | 3300050512 | nmdc:mga0n895_10236_c1 | nmdc:mga0n895_10236_c1_6732_7634 | 298 |
| 185 | 3300005355 | Ga0070671_100106570 | Ga0070671_1001065701 | 299 |
| 186 | 3300037466 | Ga0395898_0036506 | Ga0395898_0036506_2014_2925 | 299 |
| 187 | 3300038443 | Ga0395901_0033281 | Ga0395901_0033281_3527_4438 | 299 |
| 188 | 3300044842 | Ga0466957_0179186 | Ga0466957_0179186_343_1254 | 299 |
| 189 | 3300045836 | Ga0466958_0077456 | Ga0466958_0077456_112_1023 | 299 |
| 190 | 3300045976 | Ga0466967_0002647 | Ga0466967_0002647_8221_9132 | 299 |
| 191 | 3300053093 | Ga0500651_0006323 | Ga0500651_0006323_4418_5326 | 299 |
| 192 | 3300053730 | Ga0500645_000143 | Ga0500645_000143_30370_31281 | 299 |
| 193 | 3300005295 | Ga0065707_10109104 | Ga0065707_101091042 | 300 |
| 194 | 3300005330 | Ga0070690_100094018 | Ga0070690_1000940182 | 300 |
| 195 | 3300005331 | Ga0070670_100012852 | Ga0070670_1000128523 | 300 |
| 196 | 3300005347 | Ga0070668_100259082 | Ga0070668_1002590822 | 300 |
| 197 | 3300005355 | Ga0070671_100027257 | Ga0070671_1000272574 | 300 |
| 198 | 3300005367 | Ga0070667_100184188 | Ga0070667_1001841882 | 300 |
| 199 | 3300005434 | Ga0070709_10032741 | Ga0070709_100327412 | 300 |
| 200 | 3300005543 | Ga0070672_100476719 | Ga0070672_1004767191 | 300 |
| 201 | 3300006028 | Ga0070717_10050241 | Ga0070717_100502413 | 300 |
| 202 | 3300006042 | Ga0075368_10020965 | Ga0075368_100209652 | 300 |
| 203 | 3300006178 | Ga0075367_10034214 | Ga0075367_100342143 | 300 |
| 204 | 3300007788 | Ga0099795_10046226 | Ga0099795_100462262 | 300 |
| 205 | 3300014325 | Ga0163163_10035877 | Ga0163163_100358771 | 300 |
| 206 | 3300014326 | Ga0157380_10183978 | Ga0157380_101839782 | 300 |
| 207 | 3300025906 | Ga0207699_10141493 | Ga0207699_101414931 | 300 |
| 208 | 3300025915 | Ga0207693_10055389 | Ga0207693_100553892 | 300 |
| 209 | 3300025925 | Ga0207650_10325680 | Ga0207650_103256801 | 300 |
| 210 | 3300025929 | Ga0207664_10116714 | Ga0207664_101167142 | 300 |
| 211 | 3300025932 | Ga0207690_10083259 | Ga0207690_100832592 | 300 |
| 212 | 3300025940 | Ga0207691_10089653 | Ga0207691_100896533 | 300 |
| 213 | 3300025960 | Ga0207651_10020560 | Ga0207651_100205603 | 300 |
| 214 | 3300025972 | Ga0207668_10229079 | Ga0207668_102290792 | 300 |
| 215 | 3300027866 | Ga0209813_10028236 | Ga0209813_100282362 | 300 |
| 216 | 3300035691 | Ga0373931_0198568 | Ga0373931_0198568_105_1016 | 300 |
| 217 | 3300048905 | Ga0496102_0176603 | Ga0496102_0176603_238_1194 | 300 |
| 218 | 3300048907 | Ga0496104_0000562 | Ga0496104_0000562_150_1064 | 300 |
| 219 | 3300048907 | Ga0496104_0046531 | Ga0496104_0046531_1772_2686 | 300 |
| 220 | 3300048908 | Ga0496105_0040908 | Ga0496105_0040908_2878_3792 | 300 |
| 221 | 3300048911 | Ga0496108_0006351 | Ga0496108_0006351_8305_9219 | 300 |
| 222 | 3300048914 | Ga0496111_0065672 | Ga0496111_0065672_1229_2143 | 300 |
| 223 | 3300048915 | Ga0496112_0063761 | Ga0496112_0063761_1759_2715 | 300 |
| 224 | 3300048916 | Ga0496113_0008306 | Ga0496113_0008306_501_1415 | 300 |
| 225 | 3300050495 | nmdc:mga04h51_28014_c1 | nmdc:mga04h51_28014_c1_174_1121 | 300 |
| 226 | 3300005330 | Ga0070690_100185446 | Ga0070690_1001854462 | 301 |
| 227 | 3300005331 | Ga0070670_100021459 | Ga0070670_1000214593 | 301 |
| 228 | 3300005335 | Ga0070666_10004919 | Ga0070666_100049195 | 301 |
| 229 | 3300005344 | Ga0070661_100033043 | Ga0070661_1000330433 | 301 |
| 230 | 3300005355 | Ga0070671_100027439 | Ga0070671_1000274393 | 301 |
| 231 | 3300005355 | Ga0070671_100175793 | Ga0070671_1001757931 | 301 |
| 232 | 3300005364 | Ga0070673_100027086 | Ga0070673_1000270863 | 301 |
| 233 | 3300005365 | Ga0070688_100116827 | Ga0070688_1001168272 | 301 |
| 234 | 3300005367 | Ga0070667_100012009 | Ga0070667_1000120094 | 301 |
| 235 | 3300005367 | Ga0070667_100117578 | Ga0070667_1001175781 | 301 |
| 236 | 3300005434 | Ga0070709_10015959 | Ga0070709_100159595 | 301 |
| 237 | 3300005435 | Ga0070714_100166152 | Ga0070714_1001661522 | 301 |
| 238 | 3300005435 | Ga0070714_100257700 | Ga0070714_1002577001 | 301 |
| 239 | 3300005436 | Ga0070713_100050644 | Ga0070713_1000506442 | 301 |
| 240 | 3300005437 | Ga0070710_10032225 | Ga0070710_100322253 | 301 |
| 241 | 3300005437 | Ga0070710_10080001 | Ga0070710_100800012 | 301 |
| 242 | 3300005455 | Ga0070663_100046829 | Ga0070663_1000468292 | 301 |
| 243 | 3300005455 | Ga0070663_100068729 | Ga0070663_1000687293 | 301 |
| 244 | 3300005456 | Ga0070678_100043785 | Ga0070678_1000437852 | 301 |
| 245 | 3300005457 | Ga0070662_100075462 | Ga0070662_1000754622 | 301 |
| 246 | 3300005544 | Ga0070686_100017887 | Ga0070686_1000178872 | 301 |
| 247 | 3300005544 | Ga0070686_100054093 | Ga0070686_1000540932 | 301 |
| 248 | 3300005546 | Ga0070696_100324784 | Ga0070696_1003247841 | 301 |
| 249 | 3300005548 | Ga0070665_100104069 | Ga0070665_1001040692 | 301 |
| 250 | 3300005614 | Ga0068856_100102358 | Ga0068856_1001023583 | 301 |
| 251 | 3300005615 | Ga0070702_100037096 | Ga0070702_1000370962 | 301 |
| 252 | 3300005616 | Ga0068852_100541192 | Ga0068852_1005411921 | 301 |
| 253 | 3300005618 | Ga0068864_100247610 | Ga0068864_1002476102 | 301 |
| 254 | 3300005718 | Ga0068866_10029100 | Ga0068866_100291002 | 301 |
| 255 | 3300005842 | Ga0068858_100040742 | Ga0068858_1000407422 | 301 |
| 256 | 3300005843 | Ga0068860_100198490 | Ga0068860_1001984902 | 301 |
| 257 | 3300006028 | Ga0070717_10000145 | Ga0070717_1000014526 | 301 |
| 258 | 3300006038 | Ga0075365_10020435 | Ga0075365_100204353 | 301 |
| 259 | 3300006048 | Ga0075363_100125084 | Ga0075363_1001250842 | 301 |
| 260 | 3300006163 | Ga0070715_10009786 | Ga0070715_100097863 | 301 |
| 261 | 3300006173 | Ga0070716_100003681 | Ga0070716_1000036818 | 301 |
| 262 | 3300006175 | Ga0070712_100071306 | Ga0070712_1000713062 | 301 |
| 263 | 3300006175 | Ga0070712_100263636 | Ga0070712_1002636362 | 301 |
| 264 | 3300006237 | Ga0097621_100028219 | Ga0097621_1000282192 | 301 |
| 265 | 3300006358 | Ga0068871_100011946 | Ga0068871_1000119466 | 301 |
| 266 | 3300006871 | Ga0075434_100003101 | Ga0075434_10000310115 | 301 |
| 267 | 3300006871 | Ga0075434_100027058 | Ga0075434_1000270586 | 301 |
| 268 | 3300006881 | Ga0068865_100007622 | Ga0068865_1000076224 | 301 |
| 269 | 3300007076 | Ga0075435_100044759 | Ga0075435_1000447595 | 301 |
| 270 | 3300009093 | Ga0105240_10461707 | Ga0105240_104617071 | 301 |
| 271 | 3300009101 | Ga0105247_10040966 | Ga0105247_100409661 | 301 |
| 272 | 3300009174 | Ga0105241_10008642 | Ga0105241_100086427 | 301 |
| 273 | 3300009177 | Ga0105248_10075049 | Ga0105248_100750492 | 301 |
| 274 | 3300009545 | Ga0105237_10041268 | Ga0105237_100412682 | 301 |
| 275 | 3300009545 | Ga0105237_10137752 | Ga0105237_101377523 | 301 |
| 276 | 3300010375 | Ga0105239_10274765 | Ga0105239_102747651 | 301 |
| 277 | 3300011119 | Ga0105246_10031236 | Ga0105246_100312364 | 301 |
| 278 | 3300013100 | Ga0157373_10329043 | Ga0157373_103290431 | 301 |
| 279 | 3300013296 | Ga0157374_10046005 | Ga0157374_100460054 | 301 |
| 280 | 3300013297 | Ga0157378_10045148 | Ga0157378_100451483 | 301 |
| 281 | 3300013306 | Ga0163162_10043235 | Ga0163162_100432354 | 301 |
| 282 | 3300013307 | Ga0157372_10084201 | Ga0157372_100842013 | 301 |
| 283 | 3300013308 | Ga0157375_10091254 | Ga0157375_100912542 | 301 |
| 284 | 3300025898 | Ga0207692_10002671 | Ga0207692_100026715 | 301 |
| 285 | 3300025898 | Ga0207692_10219545 | Ga0207692_102195451 | 301 |
| 286 | 3300025899 | Ga0207642_10066461 | Ga0207642_100664612 | 301 |
| 287 | 3300025903 | Ga0207680_10008757 | Ga0207680_100087574 | 301 |
| 288 | 3300025905 | Ga0207685_10002216 | Ga0207685_100022164 | 301 |
| 289 | 3300025906 | Ga0207699_10034141 | Ga0207699_100341414 | 301 |
| 290 | 3300025911 | Ga0207654_10065902 | Ga0207654_100659023 | 301 |
| 291 | 3300025915 | Ga0207693_10008161 | Ga0207693_1000816110 | 301 |
| 292 | 3300025916 | Ga0207663_10067485 | Ga0207663_100674851 | 301 |
| 293 | 3300025920 | Ga0207649_10162261 | Ga0207649_101622612 | 301 |
| 294 | 3300025924 | Ga0207694_10053754 | Ga0207694_100537543 | 301 |
| 295 | 3300025927 | Ga0207687_10117712 | Ga0207687_101177122 | 301 |
| 296 | 3300025928 | Ga0207700_10002538 | Ga0207700_100025384 | 301 |
| 297 | 3300025928 | Ga0207700_10060797 | Ga0207700_100607973 | 301 |
| 298 | 3300025929 | Ga0207664_10081567 | Ga0207664_100815672 | 301 |
| 299 | 3300025931 | Ga0207644_10011229 | Ga0207644_100112294 | 301 |
| 300 | 3300025933 | Ga0207706_10017852 | Ga0207706_100178527 | 301 |
| 301 | 3300025933 | Ga0207706_10077798 | Ga0207706_100777983 | 301 |
| 302 | 3300025934 | Ga0207686_10016968 | Ga0207686_100169684 | 301 |
| 303 | 3300025934 | Ga0207686_10106508 | Ga0207686_101065082 | 301 |
| 304 | 3300025935 | Ga0207709_10023456 | Ga0207709_100234562 | 301 |
| 305 | 3300025936 | Ga0207670_10229806 | Ga0207670_102298062 | 301 |
| 306 | 3300025939 | Ga0207665_10000265 | Ga0207665_1000026513 | 301 |
| 307 | 3300025940 | Ga0207691_10224554 | Ga0207691_102245542 | 301 |
| 308 | 3300025941 | Ga0207711_10194540 | Ga0207711_101945402 | 301 |
| 309 | 3300025960 | Ga0207651_10080430 | Ga0207651_100804303 | 301 |
| 310 | 3300026035 | Ga0207703_10094114 | Ga0207703_100941142 | 301 |
| 311 | 3300026067 | Ga0207678_10006465 | Ga0207678_100064653 | 301 |
| 312 | 3300026088 | Ga0207641_10051603 | Ga0207641_100516034 | 301 |
| 313 | 3300026095 | Ga0207676_10018713 | Ga0207676_100187132 | 301 |
| 314 | 3300026121 | Ga0207683_10065445 | Ga0207683_100654453 | 301 |
| 315 | 3300026142 | Ga0207698_10514861 | Ga0207698_105148611 | 301 |
| 316 | 3300028379 | Ga0268266_10012360 | Ga0268266_100123605 | 301 |
| 317 | 3300028381 | Ga0268264_10325648 | Ga0268264_103256482 | 301 |
| 318 | 3300035083 | Ga0373926_0010622 | Ga0373926_0010622_105_1019 | 301 |
| 319 | 3300035083 | Ga0373926_0020903 | Ga0373926_0020903_1100_2020 | 301 |
| 320 | 3300035089 | Ga0373944_0004008 | Ga0373944_0004008_228_1142 | 301 |
| 321 | 3300035111 | Ga0373923_0004385 | Ga0373923_0004385_3325_4239 | 301 |
| 322 | 3300035114 | Ga0373939_0009096 | Ga0373939_0009096_1166_2080 | 301 |
| 323 | 3300035116 | Ga0373945_0008773 | Ga0373945_0008773_1109_2029 | 301 |
| 324 | 3300035120 | Ga0373957_0003196 | Ga0373957_0003196_1074_1994 | 301 |
| 325 | 3300035170 | Ga0373943_0021746 | Ga0373943_0021746_658_1578 | 301 |
| 326 | 3300035170 | Ga0373943_0024286 | Ga0373943_0024286_1347_2261 | 301 |
| 327 | 3300035171 | Ga0373946_0017656 | Ga0373946_0017656_65_985 | 301 |
| 328 | 3300035410 | Ga0373924_0013890 | Ga0373924_0013890_367_1281 | 301 |
| 329 | 3300035692 | Ga0373935_0036408 | Ga0373935_0036408_260_1180 | 301 |
| 330 | 3300035695 | Ga0373927_0111639 | Ga0373927_0111639_687_1607 | 301 |
| 331 | 3300035724 | Ga0373933_0107575 | Ga0373933_0107575_560_1480 | 301 |
| 332 | 3300035725 | Ga0373947_0010013 | Ga0373947_0010013_878_1798 | 301 |
| 333 | 3300035725 | Ga0373947_0075340 | Ga0373947_0075340_275_1189 | 301 |
| 334 | 3300036401 | Ga0373937_0027264 | Ga0373937_0027264_2682_3596 | 301 |
| 335 | 3300037068 | Ga0373925_0100521 | Ga0373925_0100521_578_1498 | 301 |
| 336 | 3300037068 | Ga0373925_0170041 | Ga0373925_0170041_301_1215 | 301 |
| 337 | 3300046454 | Ga0495592_0019590 | Ga0495592_0019590_753_1673 | 301 |
| 338 | 3300046455 | Ga0495603_0014097 | Ga0495603_0014097_817_1737 | 301 |
| 339 | 3300046459 | Ga0495629_0088232 | Ga0495629_0088232_174_1094 | 301 |
| 340 | 3300046461 | Ga0495641_0019903 | Ga0495641_0019903_1711_2625 | 301 |
| 341 | 3300046461 | Ga0495641_0049246 | Ga0495641_0049246_959_1879 | 301 |
| 342 | 3300046462 | Ga0495651_0028825 | Ga0495651_0028825_1843_2757 | 301 |
| 343 | 3300046462 | Ga0495651_0094554 | Ga0495651_0094554_1121_2041 | 301 |
| 344 | 3300046463 | Ga0495653_0038019 | Ga0495653_0038019_519_1433 | 301 |
| 345 | 3300046463 | Ga0495653_0060219 | Ga0495653_0060219_1355_2275 | 301 |
| 346 | 3300046472 | Ga0495580_0054761 | Ga0495580_0054761_515_1435 | 301 |
| 347 | 3300046473 | Ga0495582_0028131 | Ga0495582_0028131_236_1150 | 301 |
| 348 | 3300046475 | Ga0495639_0001906 | Ga0495639_0001906_4831_5745 | 301 |
| 349 | 3300046475 | Ga0495639_0056809 | Ga0495639_0056809_484_1404 | 301 |
| 350 | 3300046476 | Ga0495662_0006587 | Ga0495662_0006587_1161_2075 | 301 |
| 351 | 3300046476 | Ga0495662_0039510 | Ga0495662_0039510_141_1061 | 301 |
| 352 | 3300046477 | Ga0495664_0014165 | Ga0495664_0014165_1129_2049 | 301 |
| 353 | 3300046499 | Ga0495594_0061294 | Ga0495594_0061294_794_1708 | 301 |
| 354 | 3300046511 | Ga0495608_0229456 | Ga0495608_0229456_185_1105 | 301 |
| 355 | 3300046514 | Ga0495618_0010590 | Ga0495618_0010590_1679_2593 | 301 |
| 356 | 3300046514 | Ga0495618_0049870 | Ga0495618_0049870_1556_2476 | 301 |
| 357 | 3300046523 | Ga0495644_0000386 | Ga0495644_0000386_6857_7771 | 301 |
| 358 | 3300046526 | Ga0495666_0142316 | Ga0495666_0142316_77_997 | 301 |
| 359 | 3300046529 | Ga0495652_0102291 | Ga0495652_0102291_783_1697 | 301 |
| 360 | 3300046531 | Ga0495665_0014033 | Ga0495665_0014033_2949_3869 | 301 |
| 361 | 3300046531 | Ga0495665_0083043 | Ga0495665_0083043_443_1357 | 301 |
| 362 | 3300046533 | Ga0495640_0045816 | Ga0495640_0045816_937_1851 | 301 |
| 363 | 3300046533 | Ga0495640_0076940 | Ga0495640_0076940_1146_2066 | 301 |
| 364 | 3300046543 | Ga0495645_0166155 | Ga0495645_0166155_166_1080 | 301 |
| 365 | 3300046559 | Ga0495667_0008415 | Ga0495667_0008415_2146_3060 | 301 |
| 366 | 3300046615 | Ga0495656_0000650 | Ga0495656_0000650_8794_9708 | 301 |
| 367 | 3300046642 | Ga0495634_0219946 | Ga0495634_0219946_16_930 | 301 |
| 368 | 3300046663 | Ga0495635_0056121 | Ga0495635_0056121_1217_2131 | 301 |
| 369 | 3300046664 | Ga0495659_0007001 | Ga0495659_0007001_2109_3023 | 301 |
| 370 | 3300046674 | Ga0495588_0020559 | Ga0495588_0020559_1143_2063 | 301 |
| 371 | 3300046674 | Ga0495588_0037530 | Ga0495588_0037530_1337_2251 | 301 |
| 372 | 3300046675 | Ga0495657_0031511 | Ga0495657_0031511_2405_3325 | 301 |
| 373 | 3300046678 | Ga0495599_0014166 | Ga0495599_0014166_3520_4434 | 301 |
| 374 | 3300046678 | Ga0495599_0049670 | Ga0495599_0049670_1651_2571 | 301 |
| 375 | 3300046679 | Ga0495623_0030361 | Ga0495623_0030361_2521_3441 | 301 |
| 376 | 3300046681 | Ga0495647_0005856 | Ga0495647_0005856_391_1311 | 301 |
| 377 | 3300046681 | Ga0495647_0043513 | Ga0495647_0043513_220_1134 | 301 |
| 378 | 3300046683 | Ga0495658_0025734 | Ga0495658_0025734_842_1762 | 301 |
| 379 | 3300046689 | Ga0495613_0055042 | Ga0495613_0055042_1606_2520 | 301 |
| 380 | 3300046689 | Ga0495613_0112125 | Ga0495613_0112125_607_1527 | 301 |
| 381 | 3300046690 | Ga0495624_0066228 | Ga0495624_0066228_823_1737 | 301 |
| 382 | 3300046691 | Ga0495670_0000894 | Ga0495670_0000894_11068_11982 | 301 |
| 383 | 3300046809 | Ga0495600_0005943 | Ga0495600_0005943_6140_7054 | 301 |
| 384 | 3300046809 | Ga0495600_0018126 | Ga0495600_0018126_3044_3964 | 301 |
| 385 | 3300047317 | Ga0495604_0025099 | Ga0495604_0025099_226_1140 | 301 |
| 386 | 3300047317 | Ga0495604_0036455 | Ga0495604_0036455_654_1574 | 301 |
| 387 | 3300047319 | Ga0495674_0130824 | Ga0495674_0130824_646_1566 | 301 |
| 388 | 3300047319 | Ga0495674_0168509 | Ga0495674_0168509_224_1138 | 301 |
| 389 | 3300047321 | Ga0495676_0058811 | Ga0495676_0058811_1378_2298 | 301 |
| 390 | 3300047322 | Ga0495680_0002456 | Ga0495680_0002456_10827_11741 | 301 |
| 391 | 3300047446 | Ga0495679_026145 | Ga0495679_026145_345_1259 | 301 |
| 392 | 3300047471 | Ga0495684_0006984 | Ga0495684_0006984_6290_7204 | 301 |
| 393 | 3300047673 | Ga0495593_0028777 | Ga0495593_0028777_1197_2117 | 301 |
| 394 | 3300048088 | Ga0495602_0036446 | Ga0495602_0036446_177_1097 | 301 |
| 395 | 3300048089 | Ga0495614_0039752 | Ga0495614_0039752_768_1688 | 301 |
| 396 | 3300048903 | Ga0496100_0060556 | Ga0496100_0060556_122_1036 | 301 |
| 397 | 3300048903 | Ga0496100_0095448 | Ga0496100_0095448_873_1793 | 301 |
| 398 | 3300048904 | Ga0496101_0045110 | Ga0496101_0045110_1962_2876 | 301 |
| 399 | 3300048905 | Ga0496102_0179495 | Ga0496102_0179495_250_1164 | 301 |
| 400 | 3300048906 | Ga0496103_0010024 | Ga0496103_0010024_3251_4165 | 301 |
| 401 | 3300048907 | Ga0496104_0021653 | Ga0496104_0021653_2822_3742 | 301 |
| 402 | 3300048907 | Ga0496104_0171634 | Ga0496104_0171634_1070_1984 | 301 |
| 403 | 3300048908 | Ga0496105_0009982 | Ga0496105_0009982_1790_2704 | 301 |
| 404 | 3300048909 | Ga0496106_0026044 | Ga0496106_0026044_1113_2027 | 301 |
| 405 | 3300048910 | Ga0496107_0056936 | Ga0496107_0056936_122_1036 | 301 |
| 406 | 3300048911 | Ga0496108_0155207 | Ga0496108_0155207_122_1036 | 301 |
| 407 | 3300048912 | Ga0496109_0115593 | Ga0496109_0115593_1487_2401 | 301 |
| 408 | 3300048913 | Ga0496110_0077701 | Ga0496110_0077701_1790_2704 | 301 |
| 409 | 3300048915 | Ga0496112_0075408 | Ga0496112_0075408_96_1010 | 301 |
| 410 | 3300048916 | Ga0496113_0003312 | Ga0496113_0003312_5633_6547 | 301 |
| 411 | 3300048917 | Ga0496114_0078272 | Ga0496114_0078272_575_1495 | 301 |
| 412 | 3300048917 | Ga0496114_0289303 | Ga0496114_0289303_389_1303 | 301 |
| 413 | 3300048918 | Ga0496115_0242454 | Ga0496115_0242454_183_1103 | 301 |
| 414 | 3300048918 | Ga0496115_0269683 | Ga0496115_0269683_96_1010 | 301 |
| 415 | 3300049586 | Ga0501070_0122017 | Ga0501070_0122017_903_1826 | 301 |
| 416 | 3300050512 | nmdc:mga0n895_103114_c1 | nmdc:mga0n895_103114_c1_224_1141 | 301 |
| 417 | 3300050513 | nmdc:mga0rr50_36083_c1 | nmdc:mga0rr50_36083_c1_1797_2714 | 301 |
| 418 | 3300053077 | Ga0495601_0024875 | Ga0495601_0024875_1300_2220 | 301 |
| 419 | 3300053077 | Ga0495601_0028943 | Ga0495601_0028943_1430_2344 | 301 |
| 420 | 3300053078 | Ga0495612_0041614 | Ga0495612_0041614_604_1518 | 301 |
| 421 | 3300053084 | Ga0495595_0001305 | Ga0495595_0001305_809_1723 | 301 |
| 422 | 3300053084 | Ga0495595_0013412 | Ga0495595_0013412_634_1554 | 301 |
| 423 | 3300053085 | Ga0495619_0031842 | Ga0495619_0031842_1878_2798 | 301 |
| 424 | 3300053085 | Ga0495619_0050745 | Ga0495619_0050745_1810_2724 | 301 |
| 425 | 3300053085 | Ga0495619_0213479 | Ga0495619_0213479_407_1321 | 301 |
| 426 | 3300053085 | Ga0495619_0245575 | Ga0495619_0245575_18_938 | 301 |
| 427 | 3300053098 | Ga0500650_0011582 | Ga0500650_0011582_185_1186 | 301 |
| 428 | 3300005336 | Ga0070680_100169045 | Ga0070680_1001690453 | 302 |
| 429 | 3300005435 | Ga0070714_100394035 | Ga0070714_1003940352 | 302 |
| 430 | 3300009551 | Ga0105238_10193691 | Ga0105238_101936912 | 302 |
| 431 | 3300025912 | Ga0207707_10111500 | Ga0207707_101115002 | 302 |
| 432 | 3300025917 | Ga0207660_10247386 | Ga0207660_102473862 | 302 |
| 433 | 3300025924 | Ga0207694_10131465 | Ga0207694_101314652 | 302 |
| 434 | 3300025928 | Ga0207700_10066202 | Ga0207700_100662023 | 302 |
| 435 | 3300049568 | Ga0501031_0013124 | Ga0501031_0013124_167_1117 | 302 |
| 436 | 3300005338 | Ga0068868_100136190 | Ga0068868_1001361901 | 303 |
| 437 | 3300005354 | Ga0070675_100125186 | Ga0070675_1001251861 | 303 |
| 438 | 3300005356 | Ga0070674_100010649 | Ga0070674_1000106497 | 303 |
| 439 | 3300005434 | Ga0070709_10047527 | Ga0070709_100475273 | 303 |
| 440 | 3300005436 | Ga0070713_100263807 | Ga0070713_1002638072 | 303 |
| 441 | 3300005456 | Ga0070678_100221472 | Ga0070678_1002214721 | 303 |
| 442 | 3300005535 | Ga0070684_100170309 | Ga0070684_1001703092 | 303 |
| 443 | 3300005937 | Ga0081455_10000438 | Ga0081455_1000043836 | 303 |
| 444 | 3300005937 | Ga0081455_10078099 | Ga0081455_100780993 | 303 |
| 445 | 3300005983 | Ga0081540_1016887 | Ga0081540_10168874 | 303 |
| 446 | 3300006028 | Ga0070717_10083228 | Ga0070717_100832281 | 303 |
| 447 | 3300006175 | Ga0070712_100009070 | Ga0070712_1000090703 | 303 |
| 448 | 3300006846 | Ga0075430_100088188 | Ga0075430_1000881882 | 303 |
| 449 | 3300006847 | Ga0075431_100010236 | Ga0075431_1000102368 | 303 |
| 450 | 3300006880 | Ga0075429_100028007 | Ga0075429_1000280073 | 303 |
| 451 | 3300006914 | Ga0075436_100028648 | Ga0075436_1000286485 | 303 |
| 452 | 3300009093 | Ga0105240_10640371 | Ga0105240_106403711 | 303 |
| 453 | 3300009551 | Ga0105238_10010345 | Ga0105238_1001034510 | 303 |
| 454 | 3300013308 | Ga0157375_10234030 | Ga0157375_102340302 | 303 |
| 455 | 3300014326 | Ga0157380_10018225 | Ga0157380_100182254 | 303 |
| 456 | 3300021384 | Ga0213876_10054220 | Ga0213876_100542202 | 303 |
| 457 | 3300025905 | Ga0207685_10024188 | Ga0207685_100241882 | 303 |
| 458 | 3300025915 | Ga0207693_10001807 | Ga0207693_1000180710 | 303 |
| 459 | 3300025915 | Ga0207693_10423038 | Ga0207693_104230381 | 303 |
| 460 | 3300025926 | Ga0207659_10114781 | Ga0207659_101147811 | 303 |
| 461 | 3300025929 | Ga0207664_10079431 | Ga0207664_100794312 | 303 |
| 462 | 3300025937 | Ga0207669_10101372 | Ga0207669_101013722 | 303 |
| 463 | 3300026121 | Ga0207683_10277588 | Ga0207683_102775882 | 303 |
| 464 | 3300028556 | Ga0265337_1000408 | Ga0265337_10004088 | 303 |
| 465 | 3300031241 | Ga0265325_10007800 | Ga0265325_100078004 | 303 |
| 466 | 3300031247 | Ga0265340_10134698 | Ga0265340_101346981 | 303 |
| 467 | 3300031595 | Ga0265313_10010419 | Ga0265313_100104191 | 303 |
| 468 | 3300035083 | Ga0373926_0012939 | Ga0373926_0012939_1246_2181 | 303 |
| 469 | 3300035086 | Ga0373934_0059495 | Ga0373934_0059495_490_1407 | 303 |
| 470 | 3300035111 | Ga0373923_0006177 | Ga0373923_0006177_1405_2340 | 303 |
| 471 | 3300035113 | Ga0373936_0026391 | Ga0373936_0026391_418_1365 | 303 |
| 472 | 3300035118 | Ga0373954_0002335 | Ga0373954_0002335_5776_6711 | 303 |
| 473 | 3300035119 | Ga0373956_0046447 | Ga0373956_0046447_574_1491 | 303 |
| 474 | 3300035170 | Ga0373943_0012016 | Ga0373943_0012016_2656_3603 | 303 |
| 475 | 3300035171 | Ga0373946_0012124 | Ga0373946_0012124_318_1265 | 303 |
| 476 | 3300035172 | Ga0373955_0001741 | Ga0373955_0001741_5110_6045 | 303 |
| 477 | 3300035172 | Ga0373955_0006730 | Ga0373955_0006730_3477_4394 | 303 |
| 478 | 3300035692 | Ga0373935_0002963 | Ga0373935_0002963_6856_7791 | 303 |
| 479 | 3300035695 | Ga0373927_0000755 | Ga0373927_0000755_14899_15846 | 303 |
| 480 | 3300035695 | Ga0373927_0016719 | Ga0373927_0016719_1872_2807 | 303 |
| 481 | 3300035724 | Ga0373933_0001680 | Ga0373933_0001680_5552_6469 | 303 |
| 482 | 3300035724 | Ga0373933_0006411 | Ga0373933_0006411_1293_2228 | 303 |
| 483 | 3300035725 | Ga0373947_0004314 | Ga0373947_0004314_390_1337 | 303 |
| 484 | 3300035725 | Ga0373947_0006848 | Ga0373947_0006848_1217_2152 | 303 |
| 485 | 3300036401 | Ga0373937_0000293 | Ga0373937_0000293_5720_6655 | 303 |
| 486 | 3300036401 | Ga0373937_0002545 | Ga0373937_0002545_238_1155 | 303 |
| 487 | 3300037068 | Ga0373925_0000087 | Ga0373925_0000087_95508_96443 | 303 |
| 488 | 3300037068 | Ga0373925_0001685 | Ga0373925_0001685_15063_16010 | 303 |
| 489 | 3300039437 | Ga0436365_1622903 | Ga0436365_1622903_1063_2013 | 303 |
| 490 | 3300046454 | Ga0495592_0072959 | Ga0495592_0072959_1516_2451 | 303 |
| 491 | 3300046459 | Ga0495629_0011545 | Ga0495629_0011545_4426_5361 | 303 |
| 492 | 3300046462 | Ga0495651_0005539 | Ga0495651_0005539_1420_2355 | 303 |
| 493 | 3300046462 | Ga0495651_0210504 | Ga0495651_0210504_336_1286 | 303 |
| 494 | 3300046463 | Ga0495653_0000015 | Ga0495653_0000015_12627_13562 | 303 |
| 495 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_8599_9534 | 303 |
| 496 | 3300046511 | Ga0495608_0000135 | Ga0495608_0000135_38236_39171 | 303 |
| 497 | 3300046511 | Ga0495608_0121575 | Ga0495608_0121575_636_1586 | 303 |
| 498 | 3300046514 | Ga0495618_0000052 | Ga0495618_0000052_62862_63797 | 303 |
| 499 | 3300046516 | Ga0495628_0000005 | Ga0495628_0000005_260600_261535 | 303 |
| 500 | 3300046516 | Ga0495628_0049349 | Ga0495628_0049349_1209_2159 | 303 |
| 501 | 3300046517 | Ga0495630_0343365 | Ga0495630_0343365_179_1126 | 303 |
| 502 | 3300046526 | Ga0495666_0046182 | Ga0495666_0046182_1133_2080 | 303 |
| 503 | 3300046526 | Ga0495666_0147559 | Ga0495666_0147559_60_1010 | 303 |
| 504 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_817631_818566 | 303 |
| 505 | 3300046533 | Ga0495640_0000006 | Ga0495640_0000006_265267_266202 | 303 |
| 506 | 3300046533 | Ga0495640_0045036 | Ga0495640_0045036_1933_2880 | 303 |
| 507 | 3300046533 | Ga0495640_0252389 | Ga0495640_0252389_82_1032 | 303 |
| 508 | 3300046536 | Ga0495587_0000012 | Ga0495587_0000012_159272_160207 | 303 |
| 509 | 3300046543 | Ga0495645_0000014 | Ga0495645_0000014_166684_167619 | 303 |
| 510 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_657599_658534 | 303 |
| 511 | 3300046559 | Ga0495667_0020257 | Ga0495667_0020257_528_1445 | 303 |
| 512 | 3300046559 | Ga0495667_0030679 | Ga0495667_0030679_2328_3278 | 303 |
| 513 | 3300046642 | Ga0495634_0000412 | Ga0495634_0000412_3543_4478 | 303 |
| 514 | 3300046663 | Ga0495635_0000007 | Ga0495635_0000007_33133_34068 | 303 |
| 515 | 3300046675 | Ga0495657_0000727 | Ga0495657_0000727_4751_5686 | 303 |
| 516 | 3300046675 | Ga0495657_0079268 | Ga0495657_0079268_650_1567 | 303 |
| 517 | 3300046678 | Ga0495599_0000002 | Ga0495599_0000002_100185_101120 | 303 |
| 518 | 3300046678 | Ga0495599_0104615 | Ga0495599_0104615_168_1118 | 303 |
| 519 | 3300046679 | Ga0495623_0000316 | Ga0495623_0000316_912_1847 | 303 |
| 520 | 3300046679 | Ga0495623_0049791 | Ga0495623_0049791_1443_2360 | 303 |
| 521 | 3300046680 | Ga0495646_0000024 | Ga0495646_0000024_98455_99390 | 303 |
| 522 | 3300046683 | Ga0495658_0018833 | Ga0495658_0018833_1245_2195 | 303 |
| 523 | 3300046689 | Ga0495613_0075985 | Ga0495613_0075985_389_1336 | 303 |
| 524 | 3300046690 | Ga0495624_0031072 | Ga0495624_0031072_518_1465 | 303 |
| 525 | 3300046690 | Ga0495624_0106044 | Ga0495624_0106044_141_1076 | 303 |
| 526 | 3300046809 | Ga0495600_0000199 | Ga0495600_0000199_24514_25449 | 303 |
| 527 | 3300046809 | Ga0495600_0074410 | Ga0495600_0074410_136_1053 | 303 |
| 528 | 3300047315 | Ga0495581_0027077 | Ga0495581_0027077_285_1232 | 303 |
| 529 | 3300047315 | Ga0495581_0076674 | Ga0495581_0076674_913_1848 | 303 |
| 530 | 3300047317 | Ga0495604_0000007 | Ga0495604_0000007_184681_185616 | 303 |
| 531 | 3300047317 | Ga0495604_0012881 | Ga0495604_0012881_5058_6008 | 303 |
| 532 | 3300047317 | Ga0495604_0156951 | Ga0495604_0156951_249_1166 | 303 |
| 533 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_208536_209471 | 303 |
| 534 | 3300047321 | Ga0495676_0028084 | Ga0495676_0028084_2718_3665 | 303 |
| 535 | 3300047321 | Ga0495676_0304691 | Ga0495676_0304691_11_940 | 303 |
| 536 | 3300047322 | Ga0495680_0001123 | Ga0495680_0001123_7144_8079 | 303 |
| 537 | 3300047322 | Ga0495680_0161385 | Ga0495680_0161385_608_1558 | 303 |
| 538 | 3300047444 | Ga0495675_0012559 | Ga0495675_0012559_1390_2325 | 303 |
| 539 | 3300047444 | Ga0495675_0079347 | Ga0495675_0079347_320_1237 | 303 |
| 540 | 3300047471 | Ga0495684_0000027 | Ga0495684_0000027_26956_27891 | 303 |
| 541 | 3300047471 | Ga0495684_0007306 | Ga0495684_0007306_4335_5282 | 303 |
| 542 | 3300047471 | Ga0495684_0049415 | Ga0495684_0049415_1959_2906 | 303 |
| 543 | 3300047673 | Ga0495593_0061380 | Ga0495593_0061380_603_1550 | 303 |
| 544 | 3300048088 | Ga0495602_0000004 | Ga0495602_0000004_159315_160250 | 303 |
| 545 | 3300048903 | Ga0496100_0005158 | Ga0496100_0005158_2590_3537 | 303 |
| 546 | 3300048904 | Ga0496101_0045395 | Ga0496101_0045395_256_1203 | 303 |
| 547 | 3300048905 | Ga0496102_0019080 | Ga0496102_0019080_1812_2759 | 303 |
| 548 | 3300048907 | Ga0496104_0016166 | Ga0496104_0016166_3811_4758 | 303 |
| 549 | 3300048908 | Ga0496105_0049778 | Ga0496105_0049778_2267_3214 | 303 |
| 550 | 3300048909 | Ga0496106_0004426 | Ga0496106_0004426_5656_6603 | 303 |
| 551 | 3300048910 | Ga0496107_0010626 | Ga0496107_0010626_2856_3803 | 303 |
| 552 | 3300048911 | Ga0496108_0003177 | Ga0496108_0003177_7454_8401 | 303 |
| 553 | 3300048912 | Ga0496109_0010249 | Ga0496109_0010249_3248_4195 | 303 |
| 554 | 3300048912 | Ga0496109_0063465 | Ga0496109_0063465_2012_2959 | 303 |
| 555 | 3300048913 | Ga0496110_0005949 | Ga0496110_0005949_3750_4697 | 303 |
| 556 | 3300048913 | Ga0496110_0010442 | Ga0496110_0010442_1538_2485 | 303 |
| 557 | 3300048914 | Ga0496111_0007695 | Ga0496111_0007695_2784_3731 | 303 |
| 558 | 3300048916 | Ga0496113_0078603 | Ga0496113_0078603_357_1304 | 303 |
| 559 | 3300048917 | Ga0496114_0107053 | Ga0496114_0107053_357_1304 | 303 |
| 560 | 3300049572 | Ga0501036_0190420 | Ga0501036_0190420_64_987 | 303 |
| 561 | 3300049575 | Ga0501039_0061110 | Ga0501039_0061110_311_1234 | 303 |
| 562 | 3300049576 | Ga0501040_0067103 | Ga0501040_0067103_175_1098 | 303 |
| 563 | 3300049581 | Ga0501047_0123862 | Ga0501047_0123862_335_1249 | 303 |
| 564 | 3300049587 | Ga0501071_0044022 | Ga0501071_0044022_1987_2910 | 303 |
| 565 | 3300049589 | Ga0501073_0050072 | Ga0501073_0050072_1217_2131 | 303 |
| 566 | 3300049590 | Ga0501074_0044581 | Ga0501074_0044581_2241_3164 | 303 |
| 567 | 3300049591 | Ga0501075_0026735 | Ga0501075_0026735_15_938 | 303 |
| 568 | 3300049592 | Ga0501076_0313659 | Ga0501076_0313659_227_1150 | 303 |
| 569 | 3300049593 | Ga0501077_0036395 | Ga0501077_0036395_2119_3042 | 303 |
| 570 | 3300049741 | Ga0501079_0159044 | Ga0501079_0159044_391_1314 | 303 |
| 571 | 3300049742 | Ga0501080_0027409 | Ga0501080_0027409_471_1394 | 303 |
| 572 | 3300049744 | Ga0501083_0140351 | Ga0501083_0140351_621_1535 | 303 |
| 573 | 3300049824 | Ga0501045_0084414 | Ga0501045_0084414_286_1209 | 303 |
| 574 | 3300050508 | nmdc:mga09592_16801_c1 | nmdc:mga09592_16801_c1_2535_3458 | 303 |
| 575 | 3300050510 | nmdc:mga06r32_9412_c1 | nmdc:mga06r32_9412_c1_4697_5620 | 303 |
| 576 | 3300053077 | Ga0495601_0000006 | Ga0495601_0000006_48586_49521 | 303 |
| 577 | 3300053077 | Ga0495601_0175586 | Ga0495601_0175586_314_1231 | 303 |
| 578 | 3300053078 | Ga0495612_0000004 | Ga0495612_0000004_265139_266074 | 303 |
| 579 | 3300053083 | Ga0495655_0015752 | Ga0495655_0015752_50_994 | 303 |
| 580 | 3300053084 | Ga0495595_0000006 | Ga0495595_0000006_192585_193520 | 303 |
| 581 | 3300053085 | Ga0495619_0000011 | Ga0495619_0000011_166657_167592 | 303 |
| 582 | 3300054114 | Ga0501084_0024027 | Ga0501084_0024027_2231_3154 | 303 |
| 583 | 3300060353 | Ga0501082_0088060 | Ga0501082_0088060_269_1192 | 303 |
| 584 | 3300060353 | Ga0501082_0560418 | Ga0501082_0560418_15_938 | 303 |
| 585 | 3300061734 | Ga0530510_0044903 | Ga0530510_0044903_2217_3140 | 303 |
| 586 | 3300005327 | Ga0070658_10160279 | Ga0070658_101602791 | 304 |
| 587 | 3300005336 | Ga0070680_100046860 | Ga0070680_1000468605 | 304 |
| 588 | 3300005339 | Ga0070660_100094953 | Ga0070660_1000949531 | 304 |
| 589 | 3300005340 | Ga0070689_100006481 | Ga0070689_1000064813 | 304 |
| 590 | 3300005353 | Ga0070669_100052137 | Ga0070669_1000521372 | 304 |
| 591 | 3300005355 | Ga0070671_100098915 | Ga0070671_1000989153 | 304 |
| 592 | 3300005365 | Ga0070688_100026349 | Ga0070688_1000263493 | 304 |
| 593 | 3300005435 | Ga0070714_100260277 | Ga0070714_1002602772 | 304 |
| 594 | 3300005458 | Ga0070681_10180078 | Ga0070681_101800783 | 304 |
| 595 | 3300005458 | Ga0070681_10504365 | Ga0070681_105043651 | 304 |
| 596 | 3300005466 | Ga0070685_10219873 | Ga0070685_102198732 | 304 |
| 597 | 3300005530 | Ga0070679_100021262 | Ga0070679_1000212623 | 304 |
| 598 | 3300005617 | Ga0068859_100190897 | Ga0068859_1001908972 | 304 |
| 599 | 3300005618 | Ga0068864_100030481 | Ga0068864_1000304813 | 304 |
| 600 | 3300005842 | Ga0068858_100405655 | Ga0068858_1004056552 | 304 |
| 601 | 3300005844 | Ga0068862_100579436 | Ga0068862_1005794362 | 304 |
| 602 | 3300006042 | Ga0075368_10079985 | Ga0075368_100799851 | 304 |
| 603 | 3300006178 | Ga0075367_10048103 | Ga0075367_100481033 | 304 |
| 604 | 3300006178 | Ga0075367_10090012 | Ga0075367_100900122 | 304 |
| 605 | 3300006178 | Ga0075367_10283599 | Ga0075367_102835991 | 304 |
| 606 | 3300006195 | Ga0075366_10001361 | Ga0075366_100013614 | 304 |
| 607 | 3300006195 | Ga0075366_10242131 | Ga0075366_102421311 | 304 |
| 608 | 3300006847 | Ga0075431_100270929 | Ga0075431_1002709292 | 304 |
| 609 | 3300006931 | Ga0097620_100190898 | Ga0097620_1001908982 | 304 |
| 610 | 3300009094 | Ga0111539_10041314 | Ga0111539_100413142 | 304 |
| 611 | 3300009177 | Ga0105248_10614035 | Ga0105248_106140351 | 304 |
| 612 | 3300009551 | Ga0105238_10196033 | Ga0105238_101960332 | 304 |
| 613 | 3300011119 | Ga0105246_10385015 | Ga0105246_103850151 | 304 |
| 614 | 3300013104 | Ga0157370_10148763 | Ga0157370_101487631 | 304 |
| 615 | 3300013297 | Ga0157378_10114051 | Ga0157378_101140511 | 304 |
| 616 | 3300013306 | Ga0163162_10195346 | Ga0163162_101953461 | 304 |
| 617 | 3300013306 | Ga0163162_10435449 | Ga0163162_104354492 | 304 |
| 618 | 3300014325 | Ga0163163_10064618 | Ga0163163_100646183 | 304 |
| 619 | 3300014326 | Ga0157380_10290599 | Ga0157380_102905991 | 304 |
| 620 | 3300014326 | Ga0157380_10335969 | Ga0157380_103359691 | 304 |
| 621 | 3300021388 | Ga0213875_10027032 | Ga0213875_100270322 | 304 |
| 622 | 3300025912 | Ga0207707_10051087 | Ga0207707_100510871 | 304 |
| 623 | 3300025912 | Ga0207707_10160155 | Ga0207707_101601553 | 304 |
| 624 | 3300025919 | Ga0207657_10052916 | Ga0207657_100529162 | 304 |
| 625 | 3300025923 | Ga0207681_10042227 | Ga0207681_100422273 | 304 |
| 626 | 3300025926 | Ga0207659_10270084 | Ga0207659_102700842 | 304 |
| 627 | 3300025931 | Ga0207644_10014393 | Ga0207644_100143935 | 304 |
| 628 | 3300025936 | Ga0207670_10025042 | Ga0207670_100250423 | 304 |
| 629 | 3300026089 | Ga0207648_10064010 | Ga0207648_100640103 | 304 |
| 630 | 3300026095 | Ga0207676_10011939 | Ga0207676_100119394 | 304 |
| 631 | 3300027907 | Ga0207428_10243434 | Ga0207428_102434342 | 304 |
| 632 | 3300028800 | Ga0265338_10021763 | Ga0265338_100217638 | 304 |
| 633 | 3300031249 | Ga0265339_10000080 | Ga0265339_1000008025 | 304 |
| 634 | 3300031595 | Ga0265313_10000330 | Ga0265313_1000033030 | 304 |
| 635 | 3300035117 | Ga0373953_0012233 | Ga0373953_0012233_1331_2287 | 304 |
| 636 | 3300035118 | Ga0373954_0032919 | Ga0373954_0032919_303_1259 | 304 |
| 637 | 3300035121 | Ga0373960_0042512 | Ga0373960_0042512_362_1276 | 304 |
| 638 | 3300035171 | Ga0373946_0044646 | Ga0373946_0044646_365_1315 | 304 |
| 639 | 3300035410 | Ga0373924_0005515 | Ga0373924_0005515_1437_2393 | 304 |
| 640 | 3300035691 | Ga0373931_0092748 | Ga0373931_0092748_643_1557 | 304 |
| 641 | 3300035692 | Ga0373935_0020718 | Ga0373935_0020718_141_1097 | 304 |
| 642 | 3300035692 | Ga0373935_0035403 | Ga0373935_0035403_1887_2837 | 304 |
| 643 | 3300035695 | Ga0373927_0021678 | Ga0373927_0021678_1310_2260 | 304 |
| 644 | 3300035695 | Ga0373927_0112291 | Ga0373927_0112291_626_1582 | 304 |
| 645 | 3300035725 | Ga0373947_0066744 | Ga0373947_0066744_64_1014 | 304 |
| 646 | 3300036401 | Ga0373937_0497320 | Ga0373937_0497320_173_1129 | 304 |
| 647 | 3300037068 | Ga0373925_0032671 | Ga0373925_0032671_1116_2066 | 304 |
| 648 | 3300037068 | Ga0373925_0053236 | Ga0373925_0053236_1693_2607 | 304 |
| 649 | 3300037853 | Ga0436364_0748531 | Ga0436364_0748531_605_1522 | 304 |
| 650 | 3300037853 | Ga0436364_0771233 | Ga0436364_0771233_1727_2668 | 304 |
| 651 | 3300044694 | Ga0466963_0051933 | Ga0466963_0051933_755_1738 | 304 |
| 652 | 3300045976 | Ga0466967_0129520 | Ga0466967_0129520_967_1950 | 304 |
| 653 | 3300045976 | Ga0466967_0376621 | Ga0466967_0376621_163_1095 | 304 |
| 654 | 3300046454 | Ga0495592_0038235 | Ga0495592_0038235_1512_2468 | 304 |
| 655 | 3300046460 | Ga0495638_0030487 | Ga0495638_0030487_58_981 | 304 |
| 656 | 3300046462 | Ga0495651_0045111 | Ga0495651_0045111_2235_3191 | 304 |
| 657 | 3300046463 | Ga0495653_0017397 | Ga0495653_0017397_1400_2356 | 304 |
| 658 | 3300046463 | Ga0495653_0124846 | Ga0495653_0124846_250_1200 | 304 |
| 659 | 3300046474 | Ga0495605_0026611 | Ga0495605_0026611_1315_2241 | 304 |
| 660 | 3300046476 | Ga0495662_0002924 | Ga0495662_0002924_3456_4406 | 304 |
| 661 | 3300046477 | Ga0495664_0000142 | Ga0495664_0000142_18127_19077 | 304 |
| 662 | 3300046511 | Ga0495608_0016441 | Ga0495608_0016441_2943_3899 | 304 |
| 663 | 3300046514 | Ga0495618_0000471 | Ga0495618_0000471_5024_5974 | 304 |
| 664 | 3300046514 | Ga0495618_0008311 | Ga0495618_0008311_557_1513 | 304 |
| 665 | 3300046517 | Ga0495630_0036902 | Ga0495630_0036902_2321_3277 | 304 |
| 666 | 3300046529 | Ga0495652_0015686 | Ga0495652_0015686_1870_2820 | 304 |
| 667 | 3300046533 | Ga0495640_0003772 | Ga0495640_0003772_8461_9417 | 304 |
| 668 | 3300046533 | Ga0495640_0035965 | Ga0495640_0035965_879_1829 | 304 |
| 669 | 3300046536 | Ga0495587_0073090 | Ga0495587_0073090_65_1021 | 304 |
| 670 | 3300046543 | Ga0495645_0009924 | Ga0495645_0009924_883_1833 | 304 |
| 671 | 3300046642 | Ga0495634_0005395 | Ga0495634_0005395_1274_2224 | 304 |
| 672 | 3300046642 | Ga0495634_0009029 | Ga0495634_0009029_2971_3927 | 304 |
| 673 | 3300046663 | Ga0495635_0002818 | Ga0495635_0002818_1282_2232 | 304 |
| 674 | 3300046680 | Ga0495646_0015685 | Ga0495646_0015685_1331_2287 | 304 |
| 675 | 3300046680 | Ga0495646_0122061 | Ga0495646_0122061_156_1106 | 304 |
| 676 | 3300047319 | Ga0495674_0002597 | Ga0495674_0002597_16190_17146 | 304 |
| 677 | 3300047319 | Ga0495674_0047646 | Ga0495674_0047646_1785_2735 | 304 |
| 678 | 3300047322 | Ga0495680_0006886 | Ga0495680_0006886_8911_9867 | 304 |
| 679 | 3300047471 | Ga0495684_0002588 | Ga0495684_0002588_1802_2752 | 304 |
| 680 | 3300048904 | Ga0496101_0325934 | Ga0496101_0325934_189_1103 | 304 |
| 681 | 3300048909 | Ga0496106_0033517 | Ga0496106_0033517_1554_2468 | 304 |
| 682 | 3300048911 | Ga0496108_0095214 | Ga0496108_0095214_592_1506 | 304 |
| 683 | 3300048913 | Ga0496110_0187722 | Ga0496110_0187722_350_1267 | 304 |
| 684 | 3300048915 | Ga0496112_0040219 | Ga0496112_0040219_2361_3275 | 304 |
| 685 | 3300048917 | Ga0496114_0043271 | Ga0496114_0043271_570_1484 | 304 |
| 686 | 3300048918 | Ga0496115_0029402 | Ga0496115_0029402_2674_3588 | 304 |
| 687 | 3300049568 | Ga0501031_0049006 | Ga0501031_0049006_873_1793 | 304 |
| 688 | 3300049569 | Ga0501032_0038885 | Ga0501032_0038885_976_1896 | 304 |
| 689 | 3300049570 | Ga0501033_0069637 | Ga0501033_0069637_635_1555 | 304 |
| 690 | 3300049571 | Ga0501034_0183588 | Ga0501034_0183588_457_1371 | 304 |
| 691 | 3300049571 | Ga0501034_0207610 | Ga0501034_0207610_566_1486 | 304 |
| 692 | 3300049572 | Ga0501036_0010381 | Ga0501036_0010381_5494_6414 | 304 |
| 693 | 3300049573 | Ga0501037_0061031 | Ga0501037_0061031_1139_2059 | 304 |
| 694 | 3300049574 | Ga0501038_0101814 | Ga0501038_0101814_268_1188 | 304 |
| 695 | 3300049574 | Ga0501038_0140723 | Ga0501038_0140723_294_1208 | 304 |
| 696 | 3300049575 | Ga0501039_0228921 | Ga0501039_0228921_324_1244 | 304 |
| 697 | 3300049579 | Ga0501043_0130034 | Ga0501043_0130034_221_1141 | 304 |
| 698 | 3300049580 | Ga0501046_0085272 | Ga0501046_0085272_1304_2230 | 304 |
| 699 | 3300049581 | Ga0501047_0004258 | Ga0501047_0004258_10856_11782 | 304 |
| 700 | 3300049581 | Ga0501047_0027586 | Ga0501047_0027586_2883_3803 | 304 |
| 701 | 3300049581 | Ga0501047_0246229 | Ga0501047_0246229_339_1253 | 304 |
| 702 | 3300049585 | Ga0501069_0081927 | Ga0501069_0081927_478_1392 | 304 |
| 703 | 3300049588 | Ga0501072_0003155 | Ga0501072_0003155_11214_12131 | 304 |
| 704 | 3300049822 | Ga0501035_0008134 | Ga0501035_0008134_1101_2027 | 304 |
| 705 | 3300049822 | Ga0501035_0009844 | Ga0501035_0009844_5725_6645 | 304 |
| 706 | 3300049823 | Ga0501044_0000678 | Ga0501044_0000678_3552_4466 | 304 |
| 707 | 3300049823 | Ga0501044_0036346 | Ga0501044_0036346_2670_3596 | 304 |
| 708 | 3300049823 | Ga0501044_0159501 | Ga0501044_0159501_566_1486 | 304 |
| 709 | 3300050493 | nmdc:mga0k408_2291_c1 | nmdc:mga0k408_2291_c1_6270_7184 | 304 |
| 710 | 3300050494 | nmdc:mga06z11_33731_c1 | nmdc:mga06z11_33731_c1_1062_1976 | 304 |
| 711 | 3300050511 | nmdc:mga08y16_127411_c1 | nmdc:mga08y16_127411_c1_1451_2368 | 304 |
| 712 | 3300053077 | Ga0495601_0002675 | Ga0495601_0002675_8395_9345 | 304 |
| 713 | 3300053077 | Ga0495601_0007858 | Ga0495601_0007858_5175_6131 | 304 |
| 714 | 3300053077 | Ga0495601_0028456 | Ga0495601_0028456_770_1684 | 304 |
| 715 | 3300053078 | Ga0495612_0013401 | Ga0495612_0013401_2198_3148 | 304 |
| 716 | 3300053078 | Ga0495612_0040548 | Ga0495612_0040548_492_1406 | 304 |
| 717 | 3300053084 | Ga0495595_0012396 | Ga0495595_0012396_1285_2199 | 304 |
| 718 | 3300053085 | Ga0495619_0000663 | Ga0495619_0000663_13015_13965 | 304 |
| 719 | 3300053119 | Ga0500595_011732 | Ga0500595_011732_1510_2427 | 304 |
| 720 | 3300053153 | Ga0500616_0126874 | Ga0500616_0126874_50_970 | 304 |
| 721 | 3300054114 | Ga0501084_0144528 | Ga0501084_0144528_1058_1975 | 304 |
| 722 | 3300054114 | Ga0501084_0202458 | Ga0501084_0202458_197_1111 | 304 |
| 723 | 3300006844 | Ga0075428_100132548 | Ga0075428_1001325484 | 305 |
| 724 | 3300006847 | Ga0075431_100138807 | Ga0075431_1001388071 | 305 |
| 725 | 3300009094 | Ga0111539_10009267 | Ga0111539_100092677 | 305 |
| 726 | 3300027907 | Ga0207428_10060942 | Ga0207428_100609424 | 305 |
| 727 | 3300049743 | Ga0501081_0274681 | Ga0501081_0274681_77_1012 | 305 |
| 728 | 3300050510 | nmdc:mga06r32_475510_c1 | nmdc:mga06r32_475510_c1_283_1218 | 305 |
| 729 | 3300050511 | nmdc:mga08y16_14054_c1 | nmdc:mga08y16_14054_c1_2052_2987 | 305 |
| 730 | 3300003215 | JGI25153J46596_10001140 | JGI25153J46596_100011404 | 306 |
| 731 | 3300005539 | Ga0068853_100523613 | Ga0068853_1005236131 | 306 |
| 732 | 3300025297 | Ga0209758_1000741 | Ga0209758_10007414 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7w2j-assembly1.cif.gz_C | cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.9068 | 44 | 303 |
| 8jek-assembly1.cif.gz_C | cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus | 0.9019 | 43 | 303 |
| 8gy2-assembly1.cif.gz_B | cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans | 0.8859 | 41 | 300 |
| 8gy3-assembly1.cif.gz_A | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.8616 | 13 | 294 |
| 8gy3-assembly1.cif.gz_A | cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans | 0.7952 | 13 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dvhA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6582 | 192 | 294 | 1.10.760.10 |
| 1dvhA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6378 | 192 | 294 | 1.10.760.10 |
| 1h9yA01 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6092 | 185 | 299 | 1.10.760.10 |
| 4wqaA02 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.6072 | 25 | 147 | 1.10.760.10 |
| 1k3gA00 | Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain | 0.5944 | 228 | 291 | 1.10.760.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431P530-F1-model_v4 | deleted | 0.9794 | 1 | 306 |
|
| AF-A0A258JFY8-F1-model_v4 | Alkylated DNA repair protein | 0.9749 | 1 | 230 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A537SH69-F1-model_v4 | C-type cytochrome | 0.9734 | 1 | 303 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A431P530-F1-model_v4 | deleted | 0.9731 | 1 | 306 |
|
| AF-A0A537SH69-F1-model_v4 | C-type cytochrome | 0.9702 | 1 | 303 |
GO:0009055
GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar