F478021

General Info

Members Datasets Scaffolds Average Seq Length
732 326 732 303

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10078099|Ga0081455_100780993
Length 340
Sequence MGYAPKALHRRLETCITSPLRETDKVSRLRTFLFVTAACVIFGLAAIWILTLPSIVPATALPAHTPNLADGETMFNIGGCSSCHAVPNNSPEEVDRKRLGGGLALKSPFGVFYAPNISPDSKDGIGSWSEANFVTALWKGTSEHGANLYPAFPYTSYRYMQLKDVRDLFAYLKTLPPVQGRSRRHELSFPFNERRLLGIWKLLFLGEKPFVPDPSKSAQYNRGAYLVNGPGHCAECHSPRNILGGIIDGQRFAGGSPDGNEWAPNITPVGLRGGDEDWSEKDVASFLADGMTPSGDFAGGSMAEVIRNTSLLAPEDRSAIAAYVAALPPRQGPTPPPKKD

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
168 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
220 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
314 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
317 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
318 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
319 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
320 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
321 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.28
Nodule 0
Rhizoplane 8.33
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001140 3300003215 Bacteria 16088
2 Ga0065707_10109104 3300005295 Bacteria 2482
3 Ga0070658_10142249 3300005327 Bacteria 2004
4 Ga0070658_10160279 3300005327 Bacteria 1887
5 Ga0070683_100076411 3300005329 Bacteria 3130
6 Ga0070683_100214136 3300005329 Bacteria 1830
7 Ga0070690_100094018 3300005330 Bacteria 1978
8 Ga0070690_100185446 3300005330 Bacteria 1439
9 Ga0070670_100012852 3300005331 Bacteria 7167
10 Ga0070670_100021459 3300005331 Bacteria 5555
11 Ga0070666_10004919 3300005335 Bacteria 8167
12 Ga0070680_100019308 3300005336 Bacteria 5401
13 Ga0070680_100046860 3300005336 Bacteria 3518
14 Ga0070680_100125863 3300005336 Bacteria 2141
15 Ga0070680_100169045 3300005336 Bacteria 1839
16 Ga0068868_100136190 3300005338 Bacteria 2013
17 Ga0070660_100008537 3300005339 Bacteria 7172
18 Ga0070660_100094953 3300005339 Bacteria 2356
19 Ga0070689_100006481 3300005340 Bacteria 8106
20 Ga0070661_100033043 3300005344 Bacteria 3747
21 Ga0070668_100259082 3300005347 Bacteria 1446
22 Ga0070669_100052137 3300005353 Bacteria 2992
23 Ga0070669_100173160 3300005353 Bacteria 1684
24 Ga0070675_100125186 3300005354 Bacteria 2186
25 Ga0070671_100027257 3300005355 Bacteria 4701
26 Ga0070671_100027439 3300005355 Bacteria 4688
27 Ga0070671_100098915 3300005355 Bacteria 2447
28 Ga0070671_100106570 3300005355 Bacteria 2353
29 Ga0070671_100175793 3300005355 Bacteria 1812
30 Ga0070674_100010649 3300005356 Bacteria 5570
31 Ga0070674_100126342 3300005356 Bacteria 1900
32 Ga0070673_100027086 3300005364 Bacteria 4245
33 Ga0070688_100026349 3300005365 Bacteria 3454
34 Ga0070688_100116827 3300005365 Bacteria 1781
35 Ga0070659_100138454 3300005366 Bacteria 1981
36 Ga0070667_100012009 3300005367 Bacteria 7170
37 Ga0070667_100117578 3300005367 Bacteria 2309
38 Ga0070667_100184188 3300005367 Bacteria 1848
39 Ga0070709_10015959 3300005434 Bacteria 4278
40 Ga0070709_10032741 3300005434 Bacteria 3137
41 Ga0070709_10047527 3300005434 Bacteria 2674
42 Ga0070714_100115564 3300005435 Bacteria 2382
43 Ga0070714_100166152 3300005435 Bacteria 2000
44 Ga0070714_100257700 3300005435 Bacteria 1614
45 Ga0070714_100260277 3300005435 Bacteria 1606
46 Ga0070714_100394035 3300005435 Unclassified 1308
47 Ga0070713_100050644 3300005436 Bacteria 3431
48 Ga0070713_100263807 3300005436 Unclassified 1575
49 Ga0070710_10032225 3300005437 Bacteria 2838
50 Ga0070710_10080001 3300005437 Bacteria 1906
51 Ga0070663_100046829 3300005455 Bacteria 3062
52 Ga0070663_100068729 3300005455 Bacteria 2572
53 Ga0070678_100043785 3300005456 Bacteria 3191
54 Ga0070678_100221472 3300005456 Bacteria 1573
55 Ga0070662_100075462 3300005457 Bacteria 2497
56 Ga0070681_10180078 3300005458 Bacteria 2035
57 Ga0070681_10504365 3300005458 Bacteria 1123
58 Ga0070685_10219873 3300005466 Bacteria 1244
59 Ga0070706_100113119 3300005467 Bacteria 2528
60 Ga0070698_100084450 3300005471 Bacteria 3163
61 Ga0070699_100300282 3300005518 Bacteria 1441
62 Ga0070679_100021262 3300005530 Bacteria 6331
63 Ga0070679_100067619 3300005530 Bacteria 3563
64 Ga0070679_100160367 3300005530 Bacteria 2224
65 Ga0070679_100169791 3300005530 Bacteria 2154
66 Ga0070684_100170309 3300005535 Bacteria 1978
67 Ga0068853_100523613 3300005539 Bacteria 1121
68 Ga0070672_100476719 3300005543 Bacteria 1077
69 Ga0070686_100017887 3300005544 Bacteria 4149
70 Ga0070686_100054093 3300005544 Bacteria 2566
71 Ga0070695_100221348 3300005545 Unclassified 1364
72 Ga0070696_100324784 3300005546 Bacteria 1185
73 Ga0070665_100104069 3300005548 Bacteria 2841
74 Ga0068855_100029137 3300005563 Bacteria 6602
75 Ga0068855_100176238 3300005563 Bacteria 2419
76 Ga0068855_100563935 3300005563 Bacteria 1231
77 Ga0070664_100380480 3300005564 Bacteria 1288
78 Ga0068856_100100864 3300005614 Bacteria 2880
79 Ga0068856_100102358 3300005614 Bacteria 2857
80 Ga0068856_100492591 3300005614 Bacteria 1246
81 Ga0070702_100037096 3300005615 Bacteria 2705
82 Ga0068852_100035849 3300005616 Bacteria 4143
83 Ga0068852_100541192 3300005616 Bacteria 1164
84 Ga0068859_100190897 3300005617 Bacteria 2133
85 Ga0068864_100030481 3300005618 Bacteria 4572
86 Ga0068864_100247610 3300005618 Bacteria 1653
87 Ga0068866_10029100 3300005718 Bacteria 2639
88 Ga0068858_100040742 3300005842 Bacteria 4308
89 Ga0068858_100405655 3300005842 Bacteria 1310
90 Ga0068860_100198490 3300005843 Bacteria 1943
91 Ga0068862_100579436 3300005844 Bacteria 1075
92 Ga0081455_10000438 3300005937 Bacteria 54690
93 Ga0081455_10012637 3300005937 Bacteria 8408
94 Ga0081455_10078099 3300005937 Bacteria 2721
95 Ga0081455_10125469 3300005937 Bacteria 2015
96 Ga0081538_10003052 3300005981 Bacteria 15956
97 Ga0081540_1016887 3300005983 Bacteria 4544
98 Ga0070717_10000145 3300006028 Bacteria 52677
99 Ga0070717_10050241 3300006028 Bacteria 3426
100 Ga0070717_10083228 3300006028 Bacteria 2690
101 Ga0075365_10020435 3300006038 Bacteria 4105
102 Ga0075368_10020965 3300006042 Bacteria 2479
103 Ga0075368_10079985 3300006042 Bacteria 1329
104 Ga0075363_100125084 3300006048 Bacteria 1439
105 Ga0070715_10009786 3300006163 Bacteria 3393
106 Ga0070716_100003681 3300006173 Bacteria 7254
107 Ga0070712_100009070 3300006175 Bacteria 6263
108 Ga0070712_100071306 3300006175 Bacteria 2485
109 Ga0070712_100263636 3300006175 Bacteria 1381
110 Ga0075367_10034214 3300006178 Bacteria 2934
111 Ga0075367_10048103 3300006178 Bacteria 2511
112 Ga0075367_10090012 3300006178 Bacteria 1866
113 Ga0075367_10283599 3300006178 Bacteria 1041
114 Ga0075427_10007028 3300006194 Bacteria 1648
115 Ga0075366_10001361 3300006195 Bacteria 12206
116 Ga0075366_10242131 3300006195 Bacteria 1100
117 Ga0097621_100028219 3300006237 Bacteria 4423
118 Ga0068871_100005724 3300006358 Bacteria 8725
119 Ga0068871_100011946 3300006358 Bacteria 6392
120 Ga0075428_100132548 3300006844 Bacteria 2710
121 Ga0075430_100088188 3300006846 Bacteria 2596
122 Ga0075430_100089677 3300006846 Bacteria 2572
123 Ga0075431_100010236 3300006847 Bacteria 9427
124 Ga0075431_100138807 3300006847 Unclassified 2506
125 Ga0075431_100270929 3300006847 Bacteria 1720
126 Ga0075433_10001918 3300006852 Bacteria 15641
127 Ga0075433_10264811 3300006852 Bacteria 1523
128 Ga0075434_100003101 3300006871 Bacteria 14794
129 Ga0075434_100003168 3300006871 Bacteria 14664
130 Ga0075434_100027058 3300006871 Bacteria 5629
131 Ga0075434_100248991 3300006871 Bacteria 1796
132 Ga0075429_100028007 3300006880 Bacteria 4890
133 Ga0075429_100063595 3300006880 Bacteria 3214
134 Ga0068865_100007622 3300006881 Bacteria 6666
135 Ga0075436_100028648 3300006914 Bacteria 3830
136 Ga0075436_100147960 3300006914 Bacteria 1652
137 Ga0097620_100190898 3300006931 Bacteria 2133
138 Ga0075435_100010352 3300007076 Bacteria 6819
139 Ga0075435_100044759 3300007076 Bacteria 3546
140 Ga0075435_100174513 3300007076 Bacteria 1814
141 Ga0099795_10046226 3300007788 Bacteria 1568
142 Ga0105251_10027198 3300009011 Bacteria 2903
143 Ga0105240_10461707 3300009093 Bacteria 1419
144 Ga0105240_10640371 3300009093 Bacteria 1166
145 Ga0111539_10009267 3300009094 Bacteria 12439
146 Ga0111539_10041314 3300009094 Bacteria 5546
147 Ga0111539_10101847 3300009094 Bacteria 3371
148 Ga0105247_10040966 3300009101 Bacteria 2833
149 Ga0114129_10002620 3300009147 Bacteria 25037
150 Ga0105243_10021600 3300009148 Bacteria 4886
151 Ga0105241_10008642 3300009174 Bacteria 7487
152 Ga0105242_10008481 3300009176 Bacteria 7892
153 Ga0105248_10061485 3300009177 Bacteria 4217
154 Ga0105248_10075049 3300009177 Bacteria 3800
155 Ga0105248_10614035 3300009177 Bacteria 1227
156 Ga0105237_10041268 3300009545 Bacteria 4654
157 Ga0105237_10137752 3300009545 Bacteria 2435
158 Ga0105238_10010345 3300009551 Bacteria 9360
159 Ga0105238_10037336 3300009551 Bacteria 4939
160 Ga0105238_10193691 3300009551 Bacteria 2008
161 Ga0105238_10196033 3300009551 Bacteria 1996
162 Ga0105239_10274765 3300010375 Bacteria 1896
163 Ga0105239_10580658 3300010375 Bacteria 1278
164 Ga0105246_10031236 3300011119 Bacteria 3523
165 Ga0105246_10385015 3300011119 Bacteria 1160
166 Ga0157373_10329043 3300013100 Bacteria 1088
167 Ga0157370_10037827 3300013104 Bacteria 4672
168 Ga0157370_10148763 3300013104 Bacteria 2180
169 Ga0157374_10046005 3300013296 Bacteria 4040
170 Ga0157378_10045148 3300013297 Bacteria 3915
171 Ga0157378_10114051 3300013297 Bacteria 2482
172 Ga0157378_10299102 3300013297 Bacteria 1557
173 Ga0163162_10043235 3300013306 Bacteria 4511
174 Ga0163162_10195346 3300013306 Bacteria 2152
175 Ga0163162_10435449 3300013306 Bacteria 1443
176 Ga0157372_10084201 3300013307 Bacteria 3604
177 Ga0157375_10091254 3300013308 Bacteria 3107
178 Ga0157375_10234030 3300013308 Bacteria 1996
179 Ga0163163_10035877 3300014325 Unclassified 4814
180 Ga0163163_10064618 3300014325 Bacteria 3631
181 Ga0157380_10018225 3300014326 Bacteria 5209
182 Ga0157380_10183978 3300014326 Bacteria 1838
183 Ga0157380_10290599 3300014326 Bacteria 1501
184 Ga0157380_10335969 3300014326 Bacteria 1407
185 Ga0197907_10636662 3300020069 Bacteria 2027
186 Ga0206354_10791022 3300020081 Bacteria 1164
187 Ga0206353_11305831 3300020082 Bacteria 2079
188 Ga0213876_10001824 3300021384 Bacteria 12862
189 Ga0213876_10054220 3300021384 Bacteria 2117
190 Ga0213875_10027032 3300021388 Bacteria 2730
191 Ga0224572_1000634 3300024225 Bacteria 4381
192 Ga0209758_1000741 3300025297 Bacteria 47516
193 Ga0207692_10002671 3300025898 Bacteria 6862
194 Ga0207692_10219545 3300025898 Bacteria 1126
195 Ga0207692_10243676 3300025898 Bacteria 1074
196 Ga0207642_10066461 3300025899 Bacteria 1698
197 Ga0207688_10089649 3300025901 Bacteria 1765
198 Ga0207680_10008757 3300025903 Bacteria 4985
199 Ga0207685_10002216 3300025905 Bacteria 4395
200 Ga0207685_10024188 3300025905 Bacteria 2079
201 Ga0207699_10034141 3300025906 Bacteria 2882
202 Ga0207699_10141493 3300025906 Bacteria 1582
203 Ga0207705_10063491 3300025909 Bacteria 2668
204 Ga0207705_10141179 3300025909 Bacteria 1799
205 Ga0207684_10379665 3300025910 Bacteria 1215
206 Ga0207654_10065902 3300025911 Bacteria 2134
207 Ga0207654_10165019 3300025911 Bacteria 1434
208 Ga0207707_10051087 3300025912 Bacteria 3600
209 Ga0207707_10111500 3300025912 Bacteria 2392
210 Ga0207707_10160155 3300025912 Bacteria 1968
211 Ga0207693_10001807 3300025915 Bacteria 18754
212 Ga0207693_10008161 3300025915 Bacteria 8580
213 Ga0207693_10055389 3300025915 Bacteria 3111
214 Ga0207693_10270398 3300025915 Bacteria 1332
215 Ga0207693_10423038 3300025915 Unclassified 1041
216 Ga0207663_10067485 3300025916 Bacteria 2294
217 Ga0207660_10019987 3300025917 Bacteria 4487
218 Ga0207660_10247386 3300025917 Bacteria 1406
219 Ga0207662_10111363 3300025918 Bacteria 1707
220 Ga0207657_10004688 3300025919 Bacteria 14436
221 Ga0207657_10052916 3300025919 Bacteria 3521
222 Ga0207649_10162261 3300025920 Bacteria 1550
223 Ga0207652_10017799 3300025921 Bacteria 5820
224 Ga0207652_10099816 3300025921 Bacteria 2562
225 Ga0207652_10136848 3300025921 Bacteria 2188
226 Ga0207681_10042227 3300025923 Bacteria 3045
227 Ga0207694_10032862 3300025924 Bacteria 3974
228 Ga0207694_10053754 3300025924 Bacteria 3124
229 Ga0207694_10131465 3300025924 Bacteria 2007
230 Ga0207650_10325680 3300025925 Bacteria 1259
231 Ga0207659_10114781 3300025926 Bacteria 2053
232 Ga0207659_10270084 3300025926 Bacteria 1387
233 Ga0207687_10117712 3300025927 Bacteria 1982
234 Ga0207700_10002538 3300025928 Bacteria 10476
235 Ga0207700_10060797 3300025928 Bacteria 2862
236 Ga0207700_10066202 3300025928 Bacteria 2761
237 Ga0207664_10079431 3300025929 Bacteria 2663
238 Ga0207664_10081567 3300025929 Bacteria 2632
239 Ga0207664_10116714 3300025929 Bacteria 2227
240 Ga0207644_10011229 3300025931 Bacteria 5920
241 Ga0207644_10014393 3300025931 Bacteria 5292
242 Ga0207690_10083259 3300025932 Bacteria 2240
243 Ga0207706_10017852 3300025933 Bacteria 6390
244 Ga0207706_10077798 3300025933 Bacteria 2917
245 Ga0207686_10016968 3300025934 Bacteria 4093
246 Ga0207686_10106508 3300025934 Bacteria 1882
247 Ga0207709_10023456 3300025935 Bacteria 3512
248 Ga0207670_10025042 3300025936 Bacteria 3739
249 Ga0207670_10229806 3300025936 Bacteria 1424
250 Ga0207669_10101372 3300025937 Bacteria 1904
251 Ga0207665_10000265 3300025939 Bacteria 36482
252 Ga0207691_10089653 3300025940 Bacteria 2757
253 Ga0207691_10224554 3300025940 Bacteria 1628
254 Ga0207711_10194540 3300025941 Bacteria 1849
255 Ga0207689_10046493 3300025942 Bacteria 3587
256 Ga0207661_10155948 3300025944 Bacteria 1978
257 Ga0207667_10114444 3300025949 Bacteria 2780
258 Ga0207667_10132921 3300025949 Bacteria 2563
259 Ga0207651_10020560 3300025960 Bacteria 3987
260 Ga0207651_10080430 3300025960 Bacteria 2345
261 Ga0207668_10229079 3300025972 Bacteria 1497
262 Ga0207703_10094114 3300026035 Bacteria 2525
263 Ga0207678_10006465 3300026067 Bacteria 10398
264 Ga0207641_10051603 3300026088 Bacteria 3483
265 Ga0207648_10064010 3300026089 Bacteria 3205
266 Ga0207676_10011939 3300026095 Bacteria 6216
267 Ga0207676_10018713 3300026095 Bacteria 5041
268 Ga0207683_10065445 3300026121 Bacteria 3205
269 Ga0207683_10277588 3300026121 Bacteria 1531
270 Ga0207698_10238304 3300026142 Bacteria 1656
271 Ga0207698_10495856 3300026142 Bacteria 1187
272 Ga0207698_10514861 3300026142 Bacteria 1167
273 Ga0209813_10028236 3300027866 Bacteria 1635
274 Ga0207428_10060942 3300027907 Bacteria 2989
275 Ga0207428_10243434 3300027907 Bacteria 1343
276 Ga0207428_10383373 3300027907 Bacteria 1031
277 Ga0268266_10012360 3300028379 Bacteria 7383
278 Ga0268264_10325648 3300028381 Bacteria 1454
279 Ga0265337_1000408 3300028556 Bacteria 23003
280 Ga0265338_10019657 3300028800 Bacteria 7148
281 Ga0265338_10021763 3300028800 Bacteria 6666
282 Ga0265330_10023812 3300031235 Bacteria 2779
283 Ga0265325_10000053 3300031241 Bacteria 77918
284 Ga0265325_10000693 3300031241 Bacteria 24565
285 Ga0265325_10007800 3300031241 Bacteria 6374
286 Ga0265340_10134698 3300031247 Bacteria 1131
287 Ga0265339_10000080 3300031249 Bacteria 83570
288 Ga0265339_10036217 3300031249 Bacteria 2763
289 Ga0265339_10059630 3300031249 Bacteria 2057
290 Ga0265313_10000027 3300031595 Bacteria 133281
291 Ga0265313_10000330 3300031595 Bacteria 51547
292 Ga0265313_10010419 3300031595 Bacteria 5876
293 Ga0265313_10014816 3300031595 Bacteria 4583
294 Ga0265313_10038835 3300031595 Bacteria 2367
295 Ga0265342_10000518 3300031712 Bacteria 41040
296 Ga0265342_10005933 3300031712 Bacteria 9197
297 Ga0373926_0010622 3300035083 Bacteria 3087
298 Ga0373926_0012939 3300035083 Bacteria 2826
299 Ga0373926_0020903 3300035083 Bacteria 2263
300 Ga0373934_0059495 3300035086 Bacteria 1521
301 Ga0373944_0004008 3300035089 Bacteria 3815
302 Ga0373944_0037495 3300035089 Bacteria 1485
303 Ga0373952_0006089 3300035092 Bacteria 2225
304 Ga0373923_0004385 3300035111 Bacteria 4676
305 Ga0373923_0006177 3300035111 Bacteria 4122
306 Ga0373923_0070956 3300035111 Bacteria 1496
307 Ga0373932_0009230 3300035112 Bacteria 2368
308 Ga0373936_0026391 3300035113 Bacteria 2274
309 Ga0373939_0009096 3300035114 Bacteria 2455
310 Ga0373945_0008773 3300035116 Bacteria 3300
311 Ga0373953_0012233 3300035117 Bacteria 3035
312 Ga0373954_0002335 3300035118 Bacteria 7919
313 Ga0373954_0032919 3300035118 Bacteria 2398
314 Ga0373956_0046447 3300035119 Bacteria 1940
315 Ga0373957_0003196 3300035120 Bacteria 4805
316 Ga0373960_0042512 3300035121 Bacteria 1320
317 Ga0373943_0012016 3300035170 Bacteria 3897
318 Ga0373943_0021746 3300035170 Bacteria 2964
319 Ga0373943_0022083 3300035170 Bacteria 2944
320 Ga0373943_0024286 3300035170 Bacteria 2825
321 Ga0373943_0081446 3300035170 Bacteria 1660
322 Ga0373946_0012124 3300035171 Bacteria 3224
323 Ga0373946_0017656 3300035171 Bacteria 2732
324 Ga0373946_0044646 3300035171 Unclassified 1830
325 Ga0373955_0001741 3300035172 Bacteria 9333
326 Ga0373955_0006730 3300035172 Bacteria 5248
327 Ga0373924_0005515 3300035410 Bacteria 4487
328 Ga0373924_0013890 3300035410 Bacteria 3033
329 Ga0373931_0092748 3300035691 Bacteria 1685
330 Ga0373931_0198568 3300035691 Bacteria 1197
331 Ga0373935_0002963 3300035692 Bacteria 9781
332 Ga0373935_0010200 3300035692 Bacteria 5627
333 Ga0373935_0015752 3300035692 Bacteria 4573
334 Ga0373935_0020718 3300035692 Bacteria 4020
335 Ga0373935_0035403 3300035692 Bacteria 3116
336 Ga0373935_0036408 3300035692 Bacteria 3076
337 Ga0373927_0000755 3300035695 Bacteria 24701
338 Ga0373927_0016719 3300035695 Bacteria 4839
339 Ga0373927_0021678 3300035695 Bacteria 4210
340 Ga0373927_0022023 3300035695 Bacteria 4176
341 Ga0373927_0035459 3300035695 Bacteria 3244
342 Ga0373927_0111639 3300035695 Bacteria 1781
343 Ga0373927_0112291 3300035695 Bacteria 1776
344 Ga0373933_0001680 3300035724 Bacteria 12883
345 Ga0373933_0006411 3300035724 Bacteria 6404
346 Ga0373933_0107575 3300035724 Bacteria 1736
347 Ga0373947_0004314 3300035725 Bacteria 8356
348 Ga0373947_0005471 3300035725 Bacteria 7414
349 Ga0373947_0006848 3300035725 Bacteria 6609
350 Ga0373947_0010013 3300035725 Bacteria 5443
351 Ga0373947_0066744 3300035725 Bacteria 2196
352 Ga0373947_0075340 3300035725 Bacteria 2077
353 Ga0373937_0000293 3300036401 Bacteria 47507
354 Ga0373937_0002545 3300036401 Bacteria 15141
355 Ga0373937_0027264 3300036401 Bacteria 5166
356 Ga0373937_0049773 3300036401 Bacteria 3837
357 Ga0373937_0497320 3300036401 Bacteria 1158
358 Ga0373925_0000087 3300037068 Bacteria 99043
359 Ga0373925_0001685 3300037068 Bacteria 18592
360 Ga0373925_0025347 3300037068 Bacteria 4332
361 Ga0373925_0026243 3300037068 Bacteria 4262
362 Ga0373925_0032671 3300037068 Bacteria 3831
363 Ga0373925_0053236 3300037068 Bacteria 3025
364 Ga0373925_0067422 3300037068 Unclassified 2699
365 Ga0373925_0100521 3300037068 Bacteria 2222
366 Ga0373925_0170041 3300037068 Bacteria 1720
367 Ga0395898_0036506 3300037466 Bacteria 4879
368 Ga0436364_0748531 3300037853 Bacteria 2919
369 Ga0436364_0771233 3300037853 Bacteria 3155
370 Ga0395901_0033281 3300038443 Bacteria 5320
371 Ga0436365_0421213 3300039437 Bacteria 2218
372 Ga0436365_1622903 3300039437 Bacteria 4637
373 Ga0436365_1873205 3300039437 Bacteria 55177
374 Ga0436361_0925931 3300039447 Bacteria 1836
375 Ga0436362_0818986 3300039453 Bacteria 1226
376 Ga0439460_0056930 3300042461 Bacteria 1185
377 Ga0466963_0051933 3300044694 Bacteria 2719
378 Ga0466971_0077537 3300044719 Unclassified 1513
379 Ga0466957_0179186 3300044842 Bacteria 1383
380 Ga0466958_0077456 3300045836 Bacteria 2042
381 Ga0466958_0083889 3300045836 Bacteria 1964
382 Ga0466958_0184088 3300045836 Bacteria 1326
383 Ga0466967_0002647 3300045976 Bacteria 11293
384 Ga0466967_0129520 3300045976 Bacteria 2341
385 Ga0466967_0376621 3300045976 Bacteria 1378
386 Ga0495592_0019590 3300046454 Bacteria 5146
387 Ga0495592_0038235 3300046454 Bacteria 3611
388 Ga0495592_0072959 3300046454 Bacteria 2496
389 Ga0495603_0014097 3300046455 Bacteria 4835
390 Ga0495629_0000775 3300046459 Bacteria 25817
391 Ga0495629_0005478 3300046459 Bacteria 9475
392 Ga0495629_0011545 3300046459 Bacteria 6416
393 Ga0495629_0088232 3300046459 Bacteria 2163
394 Ga0495638_0030487 3300046460 Bacteria 3471
395 Ga0495641_0019903 3300046461 Bacteria 3419
396 Ga0495641_0049246 3300046461 Bacteria 1930
397 Ga0495651_0005539 3300046462 Bacteria 9628
398 Ga0495651_0028825 3300046462 Bacteria 4328
399 Ga0495651_0045111 3300046462 Bacteria 3415
400 Ga0495651_0094554 3300046462 Bacteria 2236
401 Ga0495651_0210504 3300046462 Bacteria 1353
402 Ga0495653_0000015 3300046463 Bacteria 213697
403 Ga0495653_0017397 3300046463 Bacteria 5847
404 Ga0495653_0038019 3300046463 Bacteria 3778
405 Ga0495653_0060219 3300046463 Bacteria 2877
406 Ga0495653_0124846 3300046463 Bacteria 1829
407 Ga0495580_0054761 3300046472 Bacteria 2812
408 Ga0495580_0068255 3300046472 Bacteria 2486
409 Ga0495582_0002289 3300046473 Bacteria 10717
410 Ga0495582_0028131 3300046473 Bacteria 3084
411 Ga0495605_0026611 3300046474 Bacteria 3006
412 Ga0495639_0001906 3300046475 Bacteria 9250
413 Ga0495639_0056809 3300046475 Bacteria 1787
414 Ga0495639_0129944 3300046475 Bacteria 1205
415 Ga0495662_0002924 3300046476 Bacteria 8628
416 Ga0495662_0006587 3300046476 Bacteria 5797
417 Ga0495662_0039510 3300046476 Bacteria 2279
418 Ga0495662_0165999 3300046476 Bacteria 1088
419 Ga0495664_0000001 3300046477 Bacteria 757730
420 Ga0495664_0000142 3300046477 Bacteria 35911
421 Ga0495664_0014165 3300046477 Bacteria 4518
422 Ga0495594_0061294 3300046499 Bacteria 2082
423 Ga0495608_0000135 3300046511 Bacteria 53120
424 Ga0495608_0016441 3300046511 Bacteria 5120
425 Ga0495608_0121575 3300046511 Bacteria 1674
426 Ga0495608_0229456 3300046511 Bacteria 1163
427 Ga0495618_0000052 3300046514 Bacteria 85440
428 Ga0495618_0000471 3300046514 Bacteria 28723
429 Ga0495618_0008311 3300046514 Bacteria 6285
430 Ga0495618_0010590 3300046514 Bacteria 5579
431 Ga0495618_0049870 3300046514 Bacteria 2643
432 Ga0495628_0000005 3300046516 Bacteria 420969
433 Ga0495628_0049349 3300046516 Bacteria 3333
434 Ga0495630_0000810 3300046517 Bacteria 21970
435 Ga0495630_0036902 3300046517 Bacteria 3654
436 Ga0495630_0343365 3300046517 Unclassified 1142
437 Ga0495644_0000386 3300046523 Bacteria 19971
438 Ga0495666_0046182 3300046526 Bacteria 2100
439 Ga0495666_0142316 3300046526 Unclassified 1117
440 Ga0495666_0147559 3300046526 Bacteria 1095
441 Ga0495652_0000001 3300046529 Bacteria 1045081
442 Ga0495652_0015686 3300046529 Bacteria 6782
443 Ga0495652_0094220 3300046529 Bacteria 2442
444 Ga0495652_0102291 3300046529 Bacteria 2321
445 Ga0495665_0011071 3300046531 Bacteria 4881
446 Ga0495665_0014033 3300046531 Bacteria 4326
447 Ga0495665_0083043 3300046531 Bacteria 1684
448 Ga0495640_0000006 3300046533 Bacteria 285419
449 Ga0495640_0003772 3300046533 Bacteria 12157
450 Ga0495640_0035965 3300046533 Bacteria 3502
451 Ga0495640_0045036 3300046533 Bacteria 3063
452 Ga0495640_0045816 3300046533 Bacteria 3033
453 Ga0495640_0076940 3300046533 Bacteria 2225
454 Ga0495640_0252389 3300046533 Bacteria 1104
455 Ga0495587_0000012 3300046536 Bacteria 197088
456 Ga0495587_0073090 3300046536 Bacteria 1992
457 Ga0495645_0000014 3300046543 Bacteria 172712
458 Ga0495645_0009924 3300046543 Bacteria 6663
459 Ga0495645_0166155 3300046543 Bacteria 1522
460 Ga0495667_0000001 3300046559 Bacteria 834831
461 Ga0495667_0008415 3300046559 Bacteria 7000
462 Ga0495667_0020257 3300046559 Bacteria 4488
463 Ga0495667_0030679 3300046559 Bacteria 3612
464 Ga0495656_0000650 3300046615 Bacteria 11110
465 Ga0495634_0000412 3300046642 Bacteria 42303
466 Ga0495634_0005395 3300046642 Bacteria 9849
467 Ga0495634_0009029 3300046642 Bacteria 7375
468 Ga0495634_0168651 3300046642 Bacteria 1377
469 Ga0495634_0219946 3300046642 Bacteria 1172
470 Ga0495635_0000007 3300046663 Bacteria 278786
471 Ga0495635_0002818 3300046663 Bacteria 11934
472 Ga0495635_0011967 3300046663 Bacteria 6078
473 Ga0495635_0056121 3300046663 Bacteria 2712
474 Ga0495659_0007001 3300046664 Bacteria 3571
475 Ga0495588_0020559 3300046674 Bacteria 3247
476 Ga0495588_0037530 3300046674 Bacteria 2462
477 Ga0495588_0092353 3300046674 Bacteria 1586
478 Ga0495657_0000727 3300046675 Bacteria 29568
479 Ga0495657_0031511 3300046675 Bacteria 3706
480 Ga0495657_0079268 3300046675 Bacteria 2127
481 Ga0495657_0150747 3300046675 Unclassified 1444
482 Ga0495599_0000002 3300046678 Bacteria 348168
483 Ga0495599_0014166 3300046678 Bacteria 4936
484 Ga0495599_0049670 3300046678 Bacteria 2629
485 Ga0495599_0104615 3300046678 Bacteria 1763
486 Ga0495623_0000316 3300046679 Bacteria 31267
487 Ga0495623_0030361 3300046679 Bacteria 3476
488 Ga0495623_0049791 3300046679 Bacteria 2655
489 Ga0495646_0000024 3300046680 Bacteria 107836
490 Ga0495646_0015685 3300046680 Bacteria 4808
491 Ga0495646_0122061 3300046680 Bacteria 1473
492 Ga0495647_0001516 3300046681 Bacteria 7173
493 Ga0495647_0005856 3300046681 Bacteria 4045
494 Ga0495647_0043513 3300046681 Unclassified 1718
495 Ga0495658_0001879 3300046683 Bacteria 10728
496 Ga0495658_0004566 3300046683 Bacteria 6809
497 Ga0495658_0018833 3300046683 Bacteria 3596
498 Ga0495658_0025734 3300046683 Bacteria 3148
499 Ga0495658_0231711 3300046683 Bacteria 1158
500 Ga0495613_0009325 3300046689 Bacteria 7284
501 Ga0495613_0055042 3300046689 Bacteria 2924
502 Ga0495613_0058735 3300046689 Bacteria 2822
503 Ga0495613_0075985 3300046689 Bacteria 2445
504 Ga0495613_0112125 3300046689 Bacteria 1964
505 Ga0495624_0031072 3300046690 Bacteria 3475
506 Ga0495624_0066228 3300046690 Bacteria 2255
507 Ga0495624_0106044 3300046690 Bacteria 1729
508 Ga0495670_0000894 3300046691 Bacteria 14410
509 Ga0495600_0000199 3300046809 Bacteria 34659
510 Ga0495600_0005943 3300046809 Bacteria 7385
511 Ga0495600_0018126 3300046809 Bacteria 4483
512 Ga0495600_0074410 3300046809 Bacteria 2218
513 Ga0495600_0129665 3300046809 Bacteria 1640
514 Ga0495581_0007126 3300047315 Bacteria 6476
515 Ga0495581_0027077 3300047315 Bacteria 3325
516 Ga0495581_0076674 3300047315 Bacteria 1934
517 Ga0495581_0108684 3300047315 Bacteria 1612
518 Ga0495604_0000007 3300047317 Bacteria 412174
519 Ga0495604_0012881 3300047317 Bacteria 6661
520 Ga0495604_0025099 3300047317 Bacteria 4751
521 Ga0495604_0036455 3300047317 Bacteria 3877
522 Ga0495604_0156951 3300047317 Bacteria 1611
523 Ga0495674_0000001 3300047319 Bacteria 778665
524 Ga0495674_0002597 3300047319 Bacteria 17589
525 Ga0495674_0047646 3300047319 Bacteria 3798
526 Ga0495674_0130824 3300047319 Bacteria 2114
527 Ga0495674_0168509 3300047319 Bacteria 1828
528 Ga0495674_0173387 3300047319 Bacteria 1799
529 Ga0495676_0028084 3300047321 Bacteria 4814
530 Ga0495676_0058811 3300047321 Bacteria 3022
531 Ga0495676_0108857 3300047321 Bacteria 2037
532 Ga0495676_0206567 3300047321 Bacteria 1361
533 Ga0495676_0304691 3300047321 Bacteria 1074
534 Ga0495680_0001123 3300047322 Bacteria 29537
535 Ga0495680_0002456 3300047322 Bacteria 18966
536 Ga0495680_0006886 3300047322 Bacteria 10493
537 Ga0495680_0014973 3300047322 Bacteria 6698
538 Ga0495680_0048245 3300047322 Bacteria 3345
539 Ga0495680_0161385 3300047322 Bacteria 1627
540 Ga0495675_0012559 3300047444 Bacteria 5329
541 Ga0495675_0079347 3300047444 Bacteria 2067
542 Ga0495679_026145 3300047446 Unclassified 1942
543 Ga0495684_0000027 3300047471 Bacteria 124367
544 Ga0495684_0002588 3300047471 Bacteria 14376
545 Ga0495684_0006984 3300047471 Bacteria 8767
546 Ga0495684_0007306 3300047471 Bacteria 8561
547 Ga0495684_0013953 3300047471 Bacteria 6180
548 Ga0495684_0049415 3300047471 Bacteria 3213
549 Ga0495684_0085286 3300047471 Bacteria 2395
550 Ga0495593_0009027 3300047673 Bacteria 5787
551 Ga0495593_0028777 3300047673 Bacteria 3050
552 Ga0495593_0061380 3300047673 Bacteria 1966
553 Ga0495602_0000004 3300048088 Bacteria 326932
554 Ga0495602_0036446 3300048088 Bacteria 4578
555 Ga0495614_0039752 3300048089 Bacteria 2019
556 Ga0496100_0005158 3300048903 Bacteria 7008
557 Ga0496100_0060556 3300048903 Bacteria 2491
558 Ga0496100_0095448 3300048903 Bacteria 2038
559 Ga0496101_0045110 3300048904 Bacteria 3156
560 Ga0496101_0045395 3300048904 Bacteria 3147
561 Ga0496101_0325934 3300048904 Bacteria 1205
562 Ga0496102_0019080 3300048905 Bacteria 6036
563 Ga0496102_0176603 3300048905 Bacteria 2011
564 Ga0496102_0179495 3300048905 Bacteria 1994
565 Ga0496103_0010024 3300048906 Bacteria 5600
566 Ga0496104_0000562 3300048907 Bacteria 31660
567 Ga0496104_0001263 3300048907 Bacteria 21783
568 Ga0496104_0016166 3300048907 Bacteria 6772
569 Ga0496104_0021653 3300048907 Bacteria 5903
570 Ga0496104_0043494 3300048907 Bacteria 4219
571 Ga0496104_0046531 3300048907 Plasmid 4086
572 Ga0496104_0051047 3300048907 Bacteria 3902
573 Ga0496104_0171634 3300048907 Bacteria 2079
574 Ga0496105_0009982 3300048908 Bacteria 7449
575 Ga0496105_0032929 3300048908 Bacteria 4254
576 Ga0496105_0040908 3300048908 Bacteria 3821
577 Ga0496105_0049778 3300048908 Bacteria 3460
578 Ga0496105_0125268 3300048908 Bacteria 2118
579 Ga0496106_0004426 3300048909 Bacteria 10409
580 Ga0496106_0026044 3300048909 Bacteria 4352
581 Ga0496106_0033517 3300048909 Bacteria 3832
582 Ga0496107_0010626 3300048910 Bacteria 6400
583 Ga0496107_0056936 3300048910 Bacteria 2825
584 Ga0496107_0246284 3300048910 Bacteria 1330
585 Ga0496108_0003177 3300048911 Bacteria 13221
586 Ga0496108_0006351 3300048911 Bacteria 9581
587 Ga0496108_0032189 3300048911 Bacteria 4354
588 Ga0496108_0095214 3300048911 Bacteria 2535
589 Ga0496108_0145269 3300048911 Bacteria 2045
590 Ga0496108_0155207 3300048911 Bacteria 1976
591 Ga0496108_0527646 3300048911 Bacteria 1031
592 Ga0496109_0010249 3300048912 Bacteria 8003
593 Ga0496109_0063465 3300048912 Bacteria 3379
594 Ga0496109_0115593 3300048912 Bacteria 2496
595 Ga0496110_0005949 3300048913 Bacteria 9600
596 Ga0496110_0010442 3300048913 Bacteria 7551
597 Ga0496110_0077701 3300048913 Bacteria 2953
598 Ga0496110_0187722 3300048913 Bacteria 1877
599 Ga0496110_0265508 3300048913 Unclassified 1562
600 Ga0496111_0007695 3300048914 Bacteria 7086
601 Ga0496111_0065672 3300048914 Unclassified 2634
602 Ga0496112_0040219 3300048915 Bacteria 4571
603 Ga0496112_0055982 3300048915 Bacteria 3880
604 Ga0496112_0063761 3300048915 Bacteria 3635
605 Ga0496112_0075408 3300048915 Bacteria 3335
606 Ga0496113_0003312 3300048916 Bacteria 9619
607 Ga0496113_0008306 3300048916 Bacteria 6758
608 Ga0496113_0078603 3300048916 Bacteria 2524
609 Ga0496114_0043271 3300048917 Bacteria 3734
610 Ga0496114_0078272 3300048917 Bacteria 2789
611 Ga0496114_0107053 3300048917 Bacteria 2393
612 Ga0496114_0289303 3300048917 Bacteria 1445
613 Ga0496115_0029402 3300048918 Bacteria 4315
614 Ga0496115_0045589 3300048918 Bacteria 3501
615 Ga0496115_0242454 3300048918 Bacteria 1485
616 Ga0496115_0269683 3300048918 Bacteria 1398
617 Ga0501031_0013124 3300049568 Bacteria 5405
618 Ga0501031_0049006 3300049568 Bacteria 2752
619 Ga0501032_0038885 3300049569 Bacteria 3238
620 Ga0501033_0069637 3300049570 Bacteria 2585
621 Ga0501034_0168129 3300049571 Bacteria 2161
622 Ga0501034_0183588 3300049571 Bacteria 2056
623 Ga0501034_0207610 3300049571 Bacteria 1914
624 Ga0501034_0284510 3300049571 Bacteria 1593
625 Ga0501036_0010381 3300049572 Bacteria 7688
626 Ga0501036_0190420 3300049572 Bacteria 1726
627 Ga0501037_0061031 3300049573 Bacteria 2749
628 Ga0501038_0101814 3300049574 Bacteria 2391
629 Ga0501038_0140723 3300049574 Bacteria 1974
630 Ga0501039_0061110 3300049575 Bacteria 2918
631 Ga0501039_0228921 3300049575 Bacteria 1461
632 Ga0501040_0067103 3300049576 Bacteria 2472
633 Ga0501043_0130034 3300049579 Bacteria 1973
634 Ga0501046_0085272 3300049580 Bacteria 2436
635 Ga0501047_0004258 3300049581 Bacteria 13475
636 Ga0501047_0027586 3300049581 Bacteria 5470
637 Ga0501047_0075887 3300049581 Bacteria 3235
638 Ga0501047_0093555 3300049581 Bacteria 2885
639 Ga0501047_0123862 3300049581 Bacteria 2465
640 Ga0501047_0246229 3300049581 Bacteria 1637
641 Ga0501067_0018878 3300049583 Bacteria 3815
642 Ga0501069_0081927 3300049585 Bacteria 1818
643 Ga0501070_0122017 3300049586 Bacteria 2154
644 Ga0501071_0044022 3300049587 Bacteria 3202
645 Ga0501072_0003155 3300049588 Bacteria 12407
646 Ga0501072_0035078 3300049588 Bacteria 3932
647 Ga0501073_0050072 3300049589 Bacteria 2928
648 Ga0501074_0044581 3300049590 Bacteria 3210
649 Ga0501075_0026735 3300049591 Bacteria 4250
650 Ga0501076_0313659 3300049592 Bacteria 1286
651 Ga0501077_0036395 3300049593 Bacteria 3135
652 Ga0501079_0159044 3300049741 Bacteria 1761
653 Ga0501079_0278825 3300049741 Bacteria 1307
654 Ga0501080_0027409 3300049742 Bacteria 5296
655 Ga0501081_0274681 3300049743 Unclassified 1233
656 Ga0501083_0078158 3300049744 Bacteria 2195
657 Ga0501083_0140351 3300049744 Bacteria 1582
658 Ga0501035_0008134 3300049822 Bacteria 9777
659 Ga0501035_0009844 3300049822 Bacteria 8879
660 Ga0501044_0000678 3300049823 Bacteria 41178
661 Ga0501044_0036346 3300049823 Bacteria 5153
662 Ga0501044_0093943 3300049823 Bacteria 3024
663 Ga0501044_0125724 3300049823 Bacteria 2562
664 Ga0501044_0159501 3300049823 Bacteria 2233
665 Ga0501044_0389154 3300049823 Bacteria 1308
666 Ga0501045_0084414 3300049824 Bacteria 2343
667 nmdc:mga0k408_2291_c1 3300050493 Bacteria 10211
668 nmdc:mga06z11_33731_c1 3300050494 Bacteria 2506
669 nmdc:mga04h51_28014_c1 3300050495 Bacteria 1755
670 nmdc:mga05p37_2004_c1 3300050507 Bacteria 23770
671 nmdc:mga09592_16801_c1 3300050508 Bacteria 5989
672 nmdc:mga0qj67_229351_c1 3300050509 Bacteria 1507
673 nmdc:mga0qj67_96594_c1 3300050509 Bacteria 2379
674 nmdc:mga06r32_475510_c1 3300050510 Bacteria 1228
675 nmdc:mga06r32_9412_c1 3300050510 Bacteria 8814
676 nmdc:mga08y16_127411_c1 3300050511 Bacteria 2648
677 nmdc:mga08y16_14054_c1 3300050511 Bacteria 8426
678 nmdc:mga08y16_156211_c1 3300050511 Bacteria 2370
679 nmdc:mga0n895_10236_c1 3300050512 Bacteria 8262
680 nmdc:mga0n895_103114_c1 3300050512 Bacteria 2864
681 nmdc:mga0n895_110900_c1 3300050512 Bacteria 2759
682 nmdc:mga0n895_126318_c1 3300050512 Bacteria 2582
683 nmdc:mga0n895_15555_c1 3300050512 Bacteria 6943
684 nmdc:mga0n895_454051_c1 3300050512 Bacteria 1294
685 nmdc:mga0rr50_17088_c1 3300050513 Bacteria 4833
686 nmdc:mga0rr50_36083_c1 3300050513 Bacteria 3557
687 nmdc:mga0a205_233265_c1 3300050515 Bacteria 1723
688 nmdc:mga0a205_8096_c1 3300050515 Bacteria 9552
689 nmdc:mga0a205_81153_c1 3300050515 Bacteria 3133
690 Ga0495601_0000006 3300053077 Bacteria 373770
691 Ga0495601_0002675 3300053077 Bacteria 10095
692 Ga0495601_0007858 3300053077 Bacteria 6278
693 Ga0495601_0024875 3300053077 Bacteria 3688
694 Ga0495601_0028456 3300053077 Bacteria 3461
695 Ga0495601_0028943 3300053077 Bacteria 3433
696 Ga0495601_0175586 3300053077 Bacteria 1400
697 Ga0495612_0000004 3300053078 Bacteria 286946
698 Ga0495612_0009160 3300053078 Bacteria 4016
699 Ga0495612_0013401 3300053078 Bacteria 3302
700 Ga0495612_0040548 3300053078 Bacteria 1897
701 Ga0495612_0041614 3300053078 Bacteria 1874
702 Ga0495655_0015752 3300053083 Bacteria 1614
703 Ga0495595_0000006 3300053084 Bacteria 231295
704 Ga0495595_0001305 3300053084 Bacteria 9703
705 Ga0495595_0012396 3300053084 Bacteria 3583
706 Ga0495595_0013412 3300053084 Bacteria 3462
707 Ga0495595_0016552 3300053084 Bacteria 3158
708 Ga0495595_0185582 3300053084 Bacteria 1032
709 Ga0495619_0000011 3300053085 Bacteria 287128
710 Ga0495619_0000663 3300053085 Bacteria 22537
711 Ga0495619_0001380 3300053085 Bacteria 15969
712 Ga0495619_0004123 3300053085 Bacteria 9287
713 Ga0495619_0031842 3300053085 Bacteria 3418
714 Ga0495619_0050745 3300053085 Bacteria 2739
715 Ga0495619_0213479 3300053085 Bacteria 1336
716 Ga0495619_0220305 3300053085 Bacteria 1314
717 Ga0495619_0245575 3300053085 Bacteria 1240
718 Ga0500651_0006323 3300053093 Bacteria 6814
719 Ga0500641_0125525 3300053096 Bacteria 1107
720 Ga0500650_0011582 3300053098 Bacteria 3638
721 Ga0500593_014418 3300053117 Bacteria 3391
722 Ga0500595_011732 3300053119 Bacteria 3415
723 Ga0500604_0014525 3300053151 Bacteria 2145
724 Ga0500616_0126874 3300053153 Bacteria 1210
725 Ga0500645_000143 3300053730 Bacteria 56081
726 Ga0501084_0024027 3300054114 Bacteria 5083
727 Ga0501084_0144528 3300054114 Bacteria 2003
728 Ga0501084_0202458 3300054114 Bacteria 1675
729 Ga0501082_0088060 3300060353 Bacteria 2679
730 Ga0501082_0560418 3300060353 Bacteria 999
731 Ga0530510_0044903 3300061734 Bacteria 3194
732 Ga0530510_0170185 3300061734 Bacteria 1614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053078 Ga0495612_0009160 Ga0495612_0009160_3241_3984 245
2 3300025942 Ga0207689_10046493 Ga0207689_100464933 246
3 3300049581 Ga0501047_0075887 Ga0501047_0075887_2476_3222 246
4 3300046809 Ga0495600_0129665 Ga0495600_0129665_16_771 250
5 3300046529 Ga0495652_0094220 Ga0495652_0094220_87_860 255
6 3300047315 Ga0495581_0108684 Ga0495581_0108684_79_852 255
7 3300047321 Ga0495676_0206567 Ga0495676_0206567_40_813 255
8 3300047471 Ga0495684_0085286 Ga0495684_0085286_1575_2348 255
9 3300049741 Ga0501079_0278825 Ga0501079_0278825_515_1291 257
10 3300050509 nmdc:mga0qj67_229351_c1 nmdc:mga0qj67_229351_c1_693_1475 257
11 3300039447 Ga0436361_0925931 Ga0436361_0925931_11_790 258
12 3300042461 Ga0439460_0056930 Ga0439460_0056930_376_1155 258
13 3300046517 Ga0495630_0000810 Ga0495630_0000810_18129_18929 258
14 3300053151 Ga0500604_0014525 Ga0500604_0014525_1322_2110 258
15 3300024225 Ga0224572_1000634 Ga0224572_10006344 264
16 3300005435 Ga0070714_100115564 Ga0070714_1001155642 268
17 3300005616 Ga0068852_100035849 Ga0068852_1000358493 268
18 3300005563 Ga0068855_100029137 Ga0068855_1000291374 272
19 3300025909 Ga0207705_10063491 Ga0207705_100634912 272
20 3300025917 Ga0207660_10019987 Ga0207660_100199874 272
21 3300025919 Ga0207657_10004688 Ga0207657_100046883 272
22 3300025921 Ga0207652_10017799 Ga0207652_100177994 272
23 3300031712 Ga0265342_10000518 Ga0265342_1000051812 272
24 3300045836 Ga0466958_0184088 Ga0466958_0184088_14_835 272
25 3300049823 Ga0501044_0125724 Ga0501044_0125724_1720_2541 272
26 3300020081 Ga0206354_10791022 Ga0206354_107910221 273
27 3300028800 Ga0265338_10019657 Ga0265338_100196574 275
28 3300031235 Ga0265330_10023812 Ga0265330_100238123 275
29 3300031249 Ga0265339_10036217 Ga0265339_100362172 275
30 3300031712 Ga0265342_10005933 Ga0265342_100059335 275
31 3300048911 Ga0496108_0527646 Ga0496108_0527646_184_1014 275
32 3300025898 Ga0207692_10243676 Ga0207692_102436761 276
33 3300005336 Ga0070680_100125863 Ga0070680_1001258632 277
34 3300005530 Ga0070679_100169791 Ga0070679_1001697912 277
35 3300025921 Ga0207652_10136848 Ga0207652_101368483 277
36 3300049571 Ga0501034_0168129 Ga0501034_0168129_103_1017 279
37 3300049588 Ga0501072_0035078 Ga0501072_0035078_1613_2527 279
38 3300005614 Ga0068856_100492591 Ga0068856_1004925912 280
39 3300005336 Ga0070680_100019308 Ga0070680_1000193084 281
40 3300005563 Ga0068855_100563935 Ga0068855_1005639351 281
41 3300013104 Ga0157370_10037827 Ga0157370_100378273 281
42 3300020069 Ga0197907_10636662 Ga0197907_106366622 281
43 3300020082 Ga0206353_11305831 Ga0206353_113058312 281
44 3300025949 Ga0207667_10114444 Ga0207667_101144441 281
45 3300005327 Ga0070658_10142249 Ga0070658_101422493 283
46 3300005339 Ga0070660_100008537 Ga0070660_1000085374 283
47 3300005530 Ga0070679_100067619 Ga0070679_1000676193 283
48 3300026142 Ga0207698_10238304 Ga0207698_102383042 283
49 3300026142 Ga0207698_10495856 Ga0207698_104958562 283
50 3300031241 Ga0265325_10000053 Ga0265325_1000005365 284
51 3300031595 Ga0265313_10014816 Ga0265313_100148163 284
52 3300005530 Ga0070679_100160367 Ga0070679_1001603673 285
53 3300006852 Ga0075433_10264811 Ga0075433_102648112 285
54 3300006871 Ga0075434_100248991 Ga0075434_1002489912 285
55 3300025921 Ga0207652_10099816 Ga0207652_100998162 285
56 3300050512 nmdc:mga0n895_110900_c1 nmdc:mga0n895_110900_c1_1374_2306 285
57 3300050515 nmdc:mga0a205_81153_c1 nmdc:mga0a205_81153_c1_1838_2770 285
58 3300007076 Ga0075435_100174513 Ga0075435_1001745132 286
59 3300037068 Ga0373925_0067422 Ga0373925_0067422_641_1534 286
60 3300061734 Ga0530510_0170185 Ga0530510_0170185_380_1246 286
61 3300005329 Ga0070683_100214136 Ga0070683_1002141362 287
62 3300005563 Ga0068855_100176238 Ga0068855_1001762383 287
63 3300025909 Ga0207705_10141179 Ga0207705_101411793 287
64 3300025944 Ga0207661_10155948 Ga0207661_101559482 287
65 3300025949 Ga0207667_10132921 Ga0207667_101329212 287
66 3300050515 nmdc:mga0a205_233265_c1 nmdc:mga0a205_233265_c1_674_1540 287
67 3300005614 Ga0068856_100100864 Ga0068856_1001008642 288
68 3300049823 Ga0501044_0093943 Ga0501044_0093943_841_1755 290
69 3300049823 Ga0501044_0389154 Ga0501044_0389154_251_1177 291
70 3300053096 Ga0500641_0125525 Ga0500641_0125525_207_1085 291
71 3300006914 Ga0075436_100147960 Ga0075436_1001479602 292
72 3300010375 Ga0105239_10580658 Ga0105239_105806581 292
73 3300005329 Ga0070683_100076411 Ga0070683_1000764112 293
74 3300009094 Ga0111539_10101847 Ga0111539_101018473 293
75 3300027907 Ga0207428_10383373 Ga0207428_103833731 293
76 3300039437 Ga0436365_0421213 Ga0436365_0421213_218_1129 293
77 3300046683 Ga0495658_0231711 Ga0495658_0231711_165_1082 293
78 3300048907 Ga0496104_0051047 Ga0496104_0051047_135_1049 293
79 3300048908 Ga0496105_0032929 Ga0496105_0032929_343_1257 293
80 3300048911 Ga0496108_0032189 Ga0496108_0032189_3190_4104 293
81 3300048913 Ga0496110_0265508 Ga0496110_0265508_179_1093 293
82 3300048915 Ga0496112_0055982 Ga0496112_0055982_2202_3116 293
83 3300049583 Ga0501067_0018878 Ga0501067_0018878_2838_3749 293
84 3300050511 nmdc:mga08y16_156211_c1 nmdc:mga08y16_156211_c1_1105_2019 293
85 3300050512 nmdc:mga0n895_454051_c1 nmdc:mga0n895_454051_c1_278_1192 293
86 3300005366 Ga0070659_100138454 Ga0070659_1001384541 294
87 3300005545 Ga0070695_100221348 Ga0070695_1002213482 294
88 3300005564 Ga0070664_100380480 Ga0070664_1003804802 294
89 3300006358 Ga0068871_100005724 Ga0068871_10000572410 294
90 3300009011 Ga0105251_10027198 Ga0105251_100271982 294
91 3300009148 Ga0105243_10021600 Ga0105243_100216003 294
92 3300009176 Ga0105242_10008481 Ga0105242_100084815 294
93 3300013297 Ga0157378_10299102 Ga0157378_102991022 294
94 3300025901 Ga0207688_10089649 Ga0207688_100896492 294
95 3300025911 Ga0207654_10165019 Ga0207654_101650192 294
96 3300031249 Ga0265339_10059630 Ga0265339_100596302 294
97 3300031595 Ga0265313_10038835 Ga0265313_100388351 294
98 3300035092 Ga0373952_0006089 Ga0373952_0006089_339_1253 294
99 3300035112 Ga0373932_0009230 Ga0373932_0009230_792_1706 294
100 3300035170 Ga0373943_0081446 Ga0373943_0081446_143_1057 294
101 3300035692 Ga0373935_0015752 Ga0373935_0015752_1338_2252 294
102 3300035695 Ga0373927_0035459 Ga0373927_0035459_83_997 294
103 3300035725 Ga0373947_0005471 Ga0373947_0005471_1270_2184 294
104 3300037068 Ga0373925_0026243 Ga0373925_0026243_696_1610 294
105 3300046459 Ga0495629_0000775 Ga0495629_0000775_1380_2294 294
106 3300046476 Ga0495662_0165999 Ga0495662_0165999_127_1041 294
107 3300046683 Ga0495658_0001879 Ga0495658_0001879_2462_3376 294
108 3300046689 Ga0495613_0009325 Ga0495613_0009325_5309_6223 294
109 3300047321 Ga0495676_0108857 Ga0495676_0108857_487_1401 294
110 3300047322 Ga0495680_0014973 Ga0495680_0014973_955_1869 294
111 3300047673 Ga0495593_0009027 Ga0495593_0009027_3778_4692 294
112 3300049581 Ga0501047_0093555 Ga0501047_0093555_926_1840 294
113 3300053085 Ga0495619_0001380 Ga0495619_0001380_2285_3199 294
114 3300005467 Ga0070706_100113119 Ga0070706_1001131193 295
115 3300005471 Ga0070698_100084450 Ga0070698_1000844502 295
116 3300005518 Ga0070699_100300282 Ga0070699_1003002821 295
117 3300021384 Ga0213876_10001824 Ga0213876_100018247 295
118 3300025910 Ga0207684_10379665 Ga0207684_103796651 295
119 3300031595 Ga0265313_10000027 Ga0265313_1000002743 295
120 3300035089 Ga0373944_0037495 Ga0373944_0037495_439_1329 295
121 3300035111 Ga0373923_0070956 Ga0373923_0070956_248_1138 295
122 3300035170 Ga0373943_0022083 Ga0373943_0022083_804_1694 295
123 3300035692 Ga0373935_0010200 Ga0373935_0010200_3837_4727 295
124 3300035695 Ga0373927_0022023 Ga0373927_0022023_734_1624 295
125 3300036401 Ga0373937_0049773 Ga0373937_0049773_1235_2125 295
126 3300037068 Ga0373925_0025347 Ga0373925_0025347_2209_3099 295
127 3300039437 Ga0436365_1873205 Ga0436365_1873205_7516_8406 295
128 3300039453 Ga0436362_0818986 Ga0436362_0818986_261_1151 295
129 3300046459 Ga0495629_0005478 Ga0495629_0005478_1540_2430 295
130 3300046472 Ga0495580_0068255 Ga0495580_0068255_1546_2436 295
131 3300046473 Ga0495582_0002289 Ga0495582_0002289_8522_9412 295
132 3300046475 Ga0495639_0129944 Ga0495639_0129944_220_1110 295
133 3300046531 Ga0495665_0011071 Ga0495665_0011071_165_1055 295
134 3300046663 Ga0495635_0011967 Ga0495635_0011967_2614_3504 295
135 3300046674 Ga0495588_0092353 Ga0495588_0092353_48_938 295
136 3300046681 Ga0495647_0001516 Ga0495647_0001516_1754_2644 295
137 3300046683 Ga0495658_0004566 Ga0495658_0004566_2575_3465 295
138 3300046689 Ga0495613_0058735 Ga0495613_0058735_1562_2452 295
139 3300047315 Ga0495581_0007126 Ga0495581_0007126_2494_3384 295
140 3300047471 Ga0495684_0013953 Ga0495684_0013953_1274_2164 295
141 3300053085 Ga0495619_0004123 Ga0495619_0004123_5829_6719 295
142 3300005937 Ga0081455_10012637 Ga0081455_100126373 296
143 3300005937 Ga0081455_10125469 Ga0081455_101254692 296
144 3300006194 Ga0075427_10007028 Ga0075427_100070282 296
145 3300006846 Ga0075430_100089677 Ga0075430_1000896772 296
146 3300006852 Ga0075433_10001918 Ga0075433_100019189 296
147 3300006871 Ga0075434_100003168 Ga0075434_1000031682 296
148 3300006880 Ga0075429_100063595 Ga0075429_1000635953 296
149 3300007076 Ga0075435_100010352 Ga0075435_1000103527 296
150 3300009147 Ga0114129_10002620 Ga0114129_100026204 296
151 3300025918 Ga0207662_10111363 Ga0207662_101113632 296
152 3300031241 Ga0265325_10000693 Ga0265325_1000069314 296
153 3300046642 Ga0495634_0168651 Ga0495634_0168651_254_1147 296
154 3300046675 Ga0495657_0150747 Ga0495657_0150747_397_1290 296
155 3300047319 Ga0495674_0173387 Ga0495674_0173387_876_1769 296
156 3300047322 Ga0495680_0048245 Ga0495680_0048245_1893_2786 296
157 3300048907 Ga0496104_0001263 Ga0496104_0001263_8800_9693 296
158 3300048918 Ga0496115_0045589 Ga0496115_0045589_842_1735 296
159 3300050507 nmdc:mga05p37_2004_c1 nmdc:mga05p37_2004_c1_17723_18616 296
160 3300050509 nmdc:mga0qj67_96594_c1 nmdc:mga0qj67_96594_c1_622_1515 296
161 3300050512 nmdc:mga0n895_126318_c1 nmdc:mga0n895_126318_c1_513_1406 296
162 3300050512 nmdc:mga0n895_15555_c1 nmdc:mga0n895_15555_c1_3523_4416 296
163 3300050513 nmdc:mga0rr50_17088_c1 nmdc:mga0rr50_17088_c1_985_1878 296
164 3300050515 nmdc:mga0a205_8096_c1 nmdc:mga0a205_8096_c1_3709_4602 296
165 3300053084 Ga0495595_0016552 Ga0495595_0016552_365_1258 296
166 3300053084 Ga0495595_0185582 Ga0495595_0185582_99_992 296
167 3300053085 Ga0495619_0220305 Ga0495619_0220305_29_922 296
168 3300009177 Ga0105248_10061485 Ga0105248_100614853 297
169 3300009551 Ga0105238_10037336 Ga0105238_100373362 297
170 3300025924 Ga0207694_10032862 Ga0207694_100328623 297
171 3300048910 Ga0496107_0246284 Ga0496107_0246284_329_1222 297
172 3300053117 Ga0500593_014418 Ga0500593_014418_1193_2125 297
173 3300005353 Ga0070669_100173160 Ga0070669_1001731602 298
174 3300005356 Ga0070674_100126342 Ga0070674_1001263422 298
175 3300005981 Ga0081538_10003052 Ga0081538_100030522 298
176 3300025915 Ga0207693_10270398 Ga0207693_102703982 298
177 3300044719 Ga0466971_0077537 Ga0466971_0077537_50_1021 298
178 3300045836 Ga0466958_0083889 Ga0466958_0083889_785_1693 298
179 3300048907 Ga0496104_0043494 Ga0496104_0043494_1754_2653 298
180 3300048908 Ga0496105_0125268 Ga0496105_0125268_1038_1937 298
181 3300048911 Ga0496108_0145269 Ga0496108_0145269_395_1294 298
182 3300049571 Ga0501034_0284510 Ga0501034_0284510_169_1080 298
183 3300049744 Ga0501083_0078158 Ga0501083_0078158_527_1468 298
184 3300050512 nmdc:mga0n895_10236_c1 nmdc:mga0n895_10236_c1_6732_7634 298
185 3300005355 Ga0070671_100106570 Ga0070671_1001065701 299
186 3300037466 Ga0395898_0036506 Ga0395898_0036506_2014_2925 299
187 3300038443 Ga0395901_0033281 Ga0395901_0033281_3527_4438 299
188 3300044842 Ga0466957_0179186 Ga0466957_0179186_343_1254 299
189 3300045836 Ga0466958_0077456 Ga0466958_0077456_112_1023 299
190 3300045976 Ga0466967_0002647 Ga0466967_0002647_8221_9132 299
191 3300053093 Ga0500651_0006323 Ga0500651_0006323_4418_5326 299
192 3300053730 Ga0500645_000143 Ga0500645_000143_30370_31281 299
193 3300005295 Ga0065707_10109104 Ga0065707_101091042 300
194 3300005330 Ga0070690_100094018 Ga0070690_1000940182 300
195 3300005331 Ga0070670_100012852 Ga0070670_1000128523 300
196 3300005347 Ga0070668_100259082 Ga0070668_1002590822 300
197 3300005355 Ga0070671_100027257 Ga0070671_1000272574 300
198 3300005367 Ga0070667_100184188 Ga0070667_1001841882 300
199 3300005434 Ga0070709_10032741 Ga0070709_100327412 300
200 3300005543 Ga0070672_100476719 Ga0070672_1004767191 300
201 3300006028 Ga0070717_10050241 Ga0070717_100502413 300
202 3300006042 Ga0075368_10020965 Ga0075368_100209652 300
203 3300006178 Ga0075367_10034214 Ga0075367_100342143 300
204 3300007788 Ga0099795_10046226 Ga0099795_100462262 300
205 3300014325 Ga0163163_10035877 Ga0163163_100358771 300
206 3300014326 Ga0157380_10183978 Ga0157380_101839782 300
207 3300025906 Ga0207699_10141493 Ga0207699_101414931 300
208 3300025915 Ga0207693_10055389 Ga0207693_100553892 300
209 3300025925 Ga0207650_10325680 Ga0207650_103256801 300
210 3300025929 Ga0207664_10116714 Ga0207664_101167142 300
211 3300025932 Ga0207690_10083259 Ga0207690_100832592 300
212 3300025940 Ga0207691_10089653 Ga0207691_100896533 300
213 3300025960 Ga0207651_10020560 Ga0207651_100205603 300
214 3300025972 Ga0207668_10229079 Ga0207668_102290792 300
215 3300027866 Ga0209813_10028236 Ga0209813_100282362 300
216 3300035691 Ga0373931_0198568 Ga0373931_0198568_105_1016 300
217 3300048905 Ga0496102_0176603 Ga0496102_0176603_238_1194 300
218 3300048907 Ga0496104_0000562 Ga0496104_0000562_150_1064 300
219 3300048907 Ga0496104_0046531 Ga0496104_0046531_1772_2686 300
220 3300048908 Ga0496105_0040908 Ga0496105_0040908_2878_3792 300
221 3300048911 Ga0496108_0006351 Ga0496108_0006351_8305_9219 300
222 3300048914 Ga0496111_0065672 Ga0496111_0065672_1229_2143 300
223 3300048915 Ga0496112_0063761 Ga0496112_0063761_1759_2715 300
224 3300048916 Ga0496113_0008306 Ga0496113_0008306_501_1415 300
225 3300050495 nmdc:mga04h51_28014_c1 nmdc:mga04h51_28014_c1_174_1121 300
226 3300005330 Ga0070690_100185446 Ga0070690_1001854462 301
227 3300005331 Ga0070670_100021459 Ga0070670_1000214593 301
228 3300005335 Ga0070666_10004919 Ga0070666_100049195 301
229 3300005344 Ga0070661_100033043 Ga0070661_1000330433 301
230 3300005355 Ga0070671_100027439 Ga0070671_1000274393 301
231 3300005355 Ga0070671_100175793 Ga0070671_1001757931 301
232 3300005364 Ga0070673_100027086 Ga0070673_1000270863 301
233 3300005365 Ga0070688_100116827 Ga0070688_1001168272 301
234 3300005367 Ga0070667_100012009 Ga0070667_1000120094 301
235 3300005367 Ga0070667_100117578 Ga0070667_1001175781 301
236 3300005434 Ga0070709_10015959 Ga0070709_100159595 301
237 3300005435 Ga0070714_100166152 Ga0070714_1001661522 301
238 3300005435 Ga0070714_100257700 Ga0070714_1002577001 301
239 3300005436 Ga0070713_100050644 Ga0070713_1000506442 301
240 3300005437 Ga0070710_10032225 Ga0070710_100322253 301
241 3300005437 Ga0070710_10080001 Ga0070710_100800012 301
242 3300005455 Ga0070663_100046829 Ga0070663_1000468292 301
243 3300005455 Ga0070663_100068729 Ga0070663_1000687293 301
244 3300005456 Ga0070678_100043785 Ga0070678_1000437852 301
245 3300005457 Ga0070662_100075462 Ga0070662_1000754622 301
246 3300005544 Ga0070686_100017887 Ga0070686_1000178872 301
247 3300005544 Ga0070686_100054093 Ga0070686_1000540932 301
248 3300005546 Ga0070696_100324784 Ga0070696_1003247841 301
249 3300005548 Ga0070665_100104069 Ga0070665_1001040692 301
250 3300005614 Ga0068856_100102358 Ga0068856_1001023583 301
251 3300005615 Ga0070702_100037096 Ga0070702_1000370962 301
252 3300005616 Ga0068852_100541192 Ga0068852_1005411921 301
253 3300005618 Ga0068864_100247610 Ga0068864_1002476102 301
254 3300005718 Ga0068866_10029100 Ga0068866_100291002 301
255 3300005842 Ga0068858_100040742 Ga0068858_1000407422 301
256 3300005843 Ga0068860_100198490 Ga0068860_1001984902 301
257 3300006028 Ga0070717_10000145 Ga0070717_1000014526 301
258 3300006038 Ga0075365_10020435 Ga0075365_100204353 301
259 3300006048 Ga0075363_100125084 Ga0075363_1001250842 301
260 3300006163 Ga0070715_10009786 Ga0070715_100097863 301
261 3300006173 Ga0070716_100003681 Ga0070716_1000036818 301
262 3300006175 Ga0070712_100071306 Ga0070712_1000713062 301
263 3300006175 Ga0070712_100263636 Ga0070712_1002636362 301
264 3300006237 Ga0097621_100028219 Ga0097621_1000282192 301
265 3300006358 Ga0068871_100011946 Ga0068871_1000119466 301
266 3300006871 Ga0075434_100003101 Ga0075434_10000310115 301
267 3300006871 Ga0075434_100027058 Ga0075434_1000270586 301
268 3300006881 Ga0068865_100007622 Ga0068865_1000076224 301
269 3300007076 Ga0075435_100044759 Ga0075435_1000447595 301
270 3300009093 Ga0105240_10461707 Ga0105240_104617071 301
271 3300009101 Ga0105247_10040966 Ga0105247_100409661 301
272 3300009174 Ga0105241_10008642 Ga0105241_100086427 301
273 3300009177 Ga0105248_10075049 Ga0105248_100750492 301
274 3300009545 Ga0105237_10041268 Ga0105237_100412682 301
275 3300009545 Ga0105237_10137752 Ga0105237_101377523 301
276 3300010375 Ga0105239_10274765 Ga0105239_102747651 301
277 3300011119 Ga0105246_10031236 Ga0105246_100312364 301
278 3300013100 Ga0157373_10329043 Ga0157373_103290431 301
279 3300013296 Ga0157374_10046005 Ga0157374_100460054 301
280 3300013297 Ga0157378_10045148 Ga0157378_100451483 301
281 3300013306 Ga0163162_10043235 Ga0163162_100432354 301
282 3300013307 Ga0157372_10084201 Ga0157372_100842013 301
283 3300013308 Ga0157375_10091254 Ga0157375_100912542 301
284 3300025898 Ga0207692_10002671 Ga0207692_100026715 301
285 3300025898 Ga0207692_10219545 Ga0207692_102195451 301
286 3300025899 Ga0207642_10066461 Ga0207642_100664612 301
287 3300025903 Ga0207680_10008757 Ga0207680_100087574 301
288 3300025905 Ga0207685_10002216 Ga0207685_100022164 301
289 3300025906 Ga0207699_10034141 Ga0207699_100341414 301
290 3300025911 Ga0207654_10065902 Ga0207654_100659023 301
291 3300025915 Ga0207693_10008161 Ga0207693_1000816110 301
292 3300025916 Ga0207663_10067485 Ga0207663_100674851 301
293 3300025920 Ga0207649_10162261 Ga0207649_101622612 301
294 3300025924 Ga0207694_10053754 Ga0207694_100537543 301
295 3300025927 Ga0207687_10117712 Ga0207687_101177122 301
296 3300025928 Ga0207700_10002538 Ga0207700_100025384 301
297 3300025928 Ga0207700_10060797 Ga0207700_100607973 301
298 3300025929 Ga0207664_10081567 Ga0207664_100815672 301
299 3300025931 Ga0207644_10011229 Ga0207644_100112294 301
300 3300025933 Ga0207706_10017852 Ga0207706_100178527 301
301 3300025933 Ga0207706_10077798 Ga0207706_100777983 301
302 3300025934 Ga0207686_10016968 Ga0207686_100169684 301
303 3300025934 Ga0207686_10106508 Ga0207686_101065082 301
304 3300025935 Ga0207709_10023456 Ga0207709_100234562 301
305 3300025936 Ga0207670_10229806 Ga0207670_102298062 301
306 3300025939 Ga0207665_10000265 Ga0207665_1000026513 301
307 3300025940 Ga0207691_10224554 Ga0207691_102245542 301
308 3300025941 Ga0207711_10194540 Ga0207711_101945402 301
309 3300025960 Ga0207651_10080430 Ga0207651_100804303 301
310 3300026035 Ga0207703_10094114 Ga0207703_100941142 301
311 3300026067 Ga0207678_10006465 Ga0207678_100064653 301
312 3300026088 Ga0207641_10051603 Ga0207641_100516034 301
313 3300026095 Ga0207676_10018713 Ga0207676_100187132 301
314 3300026121 Ga0207683_10065445 Ga0207683_100654453 301
315 3300026142 Ga0207698_10514861 Ga0207698_105148611 301
316 3300028379 Ga0268266_10012360 Ga0268266_100123605 301
317 3300028381 Ga0268264_10325648 Ga0268264_103256482 301
318 3300035083 Ga0373926_0010622 Ga0373926_0010622_105_1019 301
319 3300035083 Ga0373926_0020903 Ga0373926_0020903_1100_2020 301
320 3300035089 Ga0373944_0004008 Ga0373944_0004008_228_1142 301
321 3300035111 Ga0373923_0004385 Ga0373923_0004385_3325_4239 301
322 3300035114 Ga0373939_0009096 Ga0373939_0009096_1166_2080 301
323 3300035116 Ga0373945_0008773 Ga0373945_0008773_1109_2029 301
324 3300035120 Ga0373957_0003196 Ga0373957_0003196_1074_1994 301
325 3300035170 Ga0373943_0021746 Ga0373943_0021746_658_1578 301
326 3300035170 Ga0373943_0024286 Ga0373943_0024286_1347_2261 301
327 3300035171 Ga0373946_0017656 Ga0373946_0017656_65_985 301
328 3300035410 Ga0373924_0013890 Ga0373924_0013890_367_1281 301
329 3300035692 Ga0373935_0036408 Ga0373935_0036408_260_1180 301
330 3300035695 Ga0373927_0111639 Ga0373927_0111639_687_1607 301
331 3300035724 Ga0373933_0107575 Ga0373933_0107575_560_1480 301
332 3300035725 Ga0373947_0010013 Ga0373947_0010013_878_1798 301
333 3300035725 Ga0373947_0075340 Ga0373947_0075340_275_1189 301
334 3300036401 Ga0373937_0027264 Ga0373937_0027264_2682_3596 301
335 3300037068 Ga0373925_0100521 Ga0373925_0100521_578_1498 301
336 3300037068 Ga0373925_0170041 Ga0373925_0170041_301_1215 301
337 3300046454 Ga0495592_0019590 Ga0495592_0019590_753_1673 301
338 3300046455 Ga0495603_0014097 Ga0495603_0014097_817_1737 301
339 3300046459 Ga0495629_0088232 Ga0495629_0088232_174_1094 301
340 3300046461 Ga0495641_0019903 Ga0495641_0019903_1711_2625 301
341 3300046461 Ga0495641_0049246 Ga0495641_0049246_959_1879 301
342 3300046462 Ga0495651_0028825 Ga0495651_0028825_1843_2757 301
343 3300046462 Ga0495651_0094554 Ga0495651_0094554_1121_2041 301
344 3300046463 Ga0495653_0038019 Ga0495653_0038019_519_1433 301
345 3300046463 Ga0495653_0060219 Ga0495653_0060219_1355_2275 301
346 3300046472 Ga0495580_0054761 Ga0495580_0054761_515_1435 301
347 3300046473 Ga0495582_0028131 Ga0495582_0028131_236_1150 301
348 3300046475 Ga0495639_0001906 Ga0495639_0001906_4831_5745 301
349 3300046475 Ga0495639_0056809 Ga0495639_0056809_484_1404 301
350 3300046476 Ga0495662_0006587 Ga0495662_0006587_1161_2075 301
351 3300046476 Ga0495662_0039510 Ga0495662_0039510_141_1061 301
352 3300046477 Ga0495664_0014165 Ga0495664_0014165_1129_2049 301
353 3300046499 Ga0495594_0061294 Ga0495594_0061294_794_1708 301
354 3300046511 Ga0495608_0229456 Ga0495608_0229456_185_1105 301
355 3300046514 Ga0495618_0010590 Ga0495618_0010590_1679_2593 301
356 3300046514 Ga0495618_0049870 Ga0495618_0049870_1556_2476 301
357 3300046523 Ga0495644_0000386 Ga0495644_0000386_6857_7771 301
358 3300046526 Ga0495666_0142316 Ga0495666_0142316_77_997 301
359 3300046529 Ga0495652_0102291 Ga0495652_0102291_783_1697 301
360 3300046531 Ga0495665_0014033 Ga0495665_0014033_2949_3869 301
361 3300046531 Ga0495665_0083043 Ga0495665_0083043_443_1357 301
362 3300046533 Ga0495640_0045816 Ga0495640_0045816_937_1851 301
363 3300046533 Ga0495640_0076940 Ga0495640_0076940_1146_2066 301
364 3300046543 Ga0495645_0166155 Ga0495645_0166155_166_1080 301
365 3300046559 Ga0495667_0008415 Ga0495667_0008415_2146_3060 301
366 3300046615 Ga0495656_0000650 Ga0495656_0000650_8794_9708 301
367 3300046642 Ga0495634_0219946 Ga0495634_0219946_16_930 301
368 3300046663 Ga0495635_0056121 Ga0495635_0056121_1217_2131 301
369 3300046664 Ga0495659_0007001 Ga0495659_0007001_2109_3023 301
370 3300046674 Ga0495588_0020559 Ga0495588_0020559_1143_2063 301
371 3300046674 Ga0495588_0037530 Ga0495588_0037530_1337_2251 301
372 3300046675 Ga0495657_0031511 Ga0495657_0031511_2405_3325 301
373 3300046678 Ga0495599_0014166 Ga0495599_0014166_3520_4434 301
374 3300046678 Ga0495599_0049670 Ga0495599_0049670_1651_2571 301
375 3300046679 Ga0495623_0030361 Ga0495623_0030361_2521_3441 301
376 3300046681 Ga0495647_0005856 Ga0495647_0005856_391_1311 301
377 3300046681 Ga0495647_0043513 Ga0495647_0043513_220_1134 301
378 3300046683 Ga0495658_0025734 Ga0495658_0025734_842_1762 301
379 3300046689 Ga0495613_0055042 Ga0495613_0055042_1606_2520 301
380 3300046689 Ga0495613_0112125 Ga0495613_0112125_607_1527 301
381 3300046690 Ga0495624_0066228 Ga0495624_0066228_823_1737 301
382 3300046691 Ga0495670_0000894 Ga0495670_0000894_11068_11982 301
383 3300046809 Ga0495600_0005943 Ga0495600_0005943_6140_7054 301
384 3300046809 Ga0495600_0018126 Ga0495600_0018126_3044_3964 301
385 3300047317 Ga0495604_0025099 Ga0495604_0025099_226_1140 301
386 3300047317 Ga0495604_0036455 Ga0495604_0036455_654_1574 301
387 3300047319 Ga0495674_0130824 Ga0495674_0130824_646_1566 301
388 3300047319 Ga0495674_0168509 Ga0495674_0168509_224_1138 301
389 3300047321 Ga0495676_0058811 Ga0495676_0058811_1378_2298 301
390 3300047322 Ga0495680_0002456 Ga0495680_0002456_10827_11741 301
391 3300047446 Ga0495679_026145 Ga0495679_026145_345_1259 301
392 3300047471 Ga0495684_0006984 Ga0495684_0006984_6290_7204 301
393 3300047673 Ga0495593_0028777 Ga0495593_0028777_1197_2117 301
394 3300048088 Ga0495602_0036446 Ga0495602_0036446_177_1097 301
395 3300048089 Ga0495614_0039752 Ga0495614_0039752_768_1688 301
396 3300048903 Ga0496100_0060556 Ga0496100_0060556_122_1036 301
397 3300048903 Ga0496100_0095448 Ga0496100_0095448_873_1793 301
398 3300048904 Ga0496101_0045110 Ga0496101_0045110_1962_2876 301
399 3300048905 Ga0496102_0179495 Ga0496102_0179495_250_1164 301
400 3300048906 Ga0496103_0010024 Ga0496103_0010024_3251_4165 301
401 3300048907 Ga0496104_0021653 Ga0496104_0021653_2822_3742 301
402 3300048907 Ga0496104_0171634 Ga0496104_0171634_1070_1984 301
403 3300048908 Ga0496105_0009982 Ga0496105_0009982_1790_2704 301
404 3300048909 Ga0496106_0026044 Ga0496106_0026044_1113_2027 301
405 3300048910 Ga0496107_0056936 Ga0496107_0056936_122_1036 301
406 3300048911 Ga0496108_0155207 Ga0496108_0155207_122_1036 301
407 3300048912 Ga0496109_0115593 Ga0496109_0115593_1487_2401 301
408 3300048913 Ga0496110_0077701 Ga0496110_0077701_1790_2704 301
409 3300048915 Ga0496112_0075408 Ga0496112_0075408_96_1010 301
410 3300048916 Ga0496113_0003312 Ga0496113_0003312_5633_6547 301
411 3300048917 Ga0496114_0078272 Ga0496114_0078272_575_1495 301
412 3300048917 Ga0496114_0289303 Ga0496114_0289303_389_1303 301
413 3300048918 Ga0496115_0242454 Ga0496115_0242454_183_1103 301
414 3300048918 Ga0496115_0269683 Ga0496115_0269683_96_1010 301
415 3300049586 Ga0501070_0122017 Ga0501070_0122017_903_1826 301
416 3300050512 nmdc:mga0n895_103114_c1 nmdc:mga0n895_103114_c1_224_1141 301
417 3300050513 nmdc:mga0rr50_36083_c1 nmdc:mga0rr50_36083_c1_1797_2714 301
418 3300053077 Ga0495601_0024875 Ga0495601_0024875_1300_2220 301
419 3300053077 Ga0495601_0028943 Ga0495601_0028943_1430_2344 301
420 3300053078 Ga0495612_0041614 Ga0495612_0041614_604_1518 301
421 3300053084 Ga0495595_0001305 Ga0495595_0001305_809_1723 301
422 3300053084 Ga0495595_0013412 Ga0495595_0013412_634_1554 301
423 3300053085 Ga0495619_0031842 Ga0495619_0031842_1878_2798 301
424 3300053085 Ga0495619_0050745 Ga0495619_0050745_1810_2724 301
425 3300053085 Ga0495619_0213479 Ga0495619_0213479_407_1321 301
426 3300053085 Ga0495619_0245575 Ga0495619_0245575_18_938 301
427 3300053098 Ga0500650_0011582 Ga0500650_0011582_185_1186 301
428 3300005336 Ga0070680_100169045 Ga0070680_1001690453 302
429 3300005435 Ga0070714_100394035 Ga0070714_1003940352 302
430 3300009551 Ga0105238_10193691 Ga0105238_101936912 302
431 3300025912 Ga0207707_10111500 Ga0207707_101115002 302
432 3300025917 Ga0207660_10247386 Ga0207660_102473862 302
433 3300025924 Ga0207694_10131465 Ga0207694_101314652 302
434 3300025928 Ga0207700_10066202 Ga0207700_100662023 302
435 3300049568 Ga0501031_0013124 Ga0501031_0013124_167_1117 302
436 3300005338 Ga0068868_100136190 Ga0068868_1001361901 303
437 3300005354 Ga0070675_100125186 Ga0070675_1001251861 303
438 3300005356 Ga0070674_100010649 Ga0070674_1000106497 303
439 3300005434 Ga0070709_10047527 Ga0070709_100475273 303
440 3300005436 Ga0070713_100263807 Ga0070713_1002638072 303
441 3300005456 Ga0070678_100221472 Ga0070678_1002214721 303
442 3300005535 Ga0070684_100170309 Ga0070684_1001703092 303
443 3300005937 Ga0081455_10000438 Ga0081455_1000043836 303
444 3300005937 Ga0081455_10078099 Ga0081455_100780993 303
445 3300005983 Ga0081540_1016887 Ga0081540_10168874 303
446 3300006028 Ga0070717_10083228 Ga0070717_100832281 303
447 3300006175 Ga0070712_100009070 Ga0070712_1000090703 303
448 3300006846 Ga0075430_100088188 Ga0075430_1000881882 303
449 3300006847 Ga0075431_100010236 Ga0075431_1000102368 303
450 3300006880 Ga0075429_100028007 Ga0075429_1000280073 303
451 3300006914 Ga0075436_100028648 Ga0075436_1000286485 303
452 3300009093 Ga0105240_10640371 Ga0105240_106403711 303
453 3300009551 Ga0105238_10010345 Ga0105238_1001034510 303
454 3300013308 Ga0157375_10234030 Ga0157375_102340302 303
455 3300014326 Ga0157380_10018225 Ga0157380_100182254 303
456 3300021384 Ga0213876_10054220 Ga0213876_100542202 303
457 3300025905 Ga0207685_10024188 Ga0207685_100241882 303
458 3300025915 Ga0207693_10001807 Ga0207693_1000180710 303
459 3300025915 Ga0207693_10423038 Ga0207693_104230381 303
460 3300025926 Ga0207659_10114781 Ga0207659_101147811 303
461 3300025929 Ga0207664_10079431 Ga0207664_100794312 303
462 3300025937 Ga0207669_10101372 Ga0207669_101013722 303
463 3300026121 Ga0207683_10277588 Ga0207683_102775882 303
464 3300028556 Ga0265337_1000408 Ga0265337_10004088 303
465 3300031241 Ga0265325_10007800 Ga0265325_100078004 303
466 3300031247 Ga0265340_10134698 Ga0265340_101346981 303
467 3300031595 Ga0265313_10010419 Ga0265313_100104191 303
468 3300035083 Ga0373926_0012939 Ga0373926_0012939_1246_2181 303
469 3300035086 Ga0373934_0059495 Ga0373934_0059495_490_1407 303
470 3300035111 Ga0373923_0006177 Ga0373923_0006177_1405_2340 303
471 3300035113 Ga0373936_0026391 Ga0373936_0026391_418_1365 303
472 3300035118 Ga0373954_0002335 Ga0373954_0002335_5776_6711 303
473 3300035119 Ga0373956_0046447 Ga0373956_0046447_574_1491 303
474 3300035170 Ga0373943_0012016 Ga0373943_0012016_2656_3603 303
475 3300035171 Ga0373946_0012124 Ga0373946_0012124_318_1265 303
476 3300035172 Ga0373955_0001741 Ga0373955_0001741_5110_6045 303
477 3300035172 Ga0373955_0006730 Ga0373955_0006730_3477_4394 303
478 3300035692 Ga0373935_0002963 Ga0373935_0002963_6856_7791 303
479 3300035695 Ga0373927_0000755 Ga0373927_0000755_14899_15846 303
480 3300035695 Ga0373927_0016719 Ga0373927_0016719_1872_2807 303
481 3300035724 Ga0373933_0001680 Ga0373933_0001680_5552_6469 303
482 3300035724 Ga0373933_0006411 Ga0373933_0006411_1293_2228 303
483 3300035725 Ga0373947_0004314 Ga0373947_0004314_390_1337 303
484 3300035725 Ga0373947_0006848 Ga0373947_0006848_1217_2152 303
485 3300036401 Ga0373937_0000293 Ga0373937_0000293_5720_6655 303
486 3300036401 Ga0373937_0002545 Ga0373937_0002545_238_1155 303
487 3300037068 Ga0373925_0000087 Ga0373925_0000087_95508_96443 303
488 3300037068 Ga0373925_0001685 Ga0373925_0001685_15063_16010 303
489 3300039437 Ga0436365_1622903 Ga0436365_1622903_1063_2013 303
490 3300046454 Ga0495592_0072959 Ga0495592_0072959_1516_2451 303
491 3300046459 Ga0495629_0011545 Ga0495629_0011545_4426_5361 303
492 3300046462 Ga0495651_0005539 Ga0495651_0005539_1420_2355 303
493 3300046462 Ga0495651_0210504 Ga0495651_0210504_336_1286 303
494 3300046463 Ga0495653_0000015 Ga0495653_0000015_12627_13562 303
495 3300046477 Ga0495664_0000001 Ga0495664_0000001_8599_9534 303
496 3300046511 Ga0495608_0000135 Ga0495608_0000135_38236_39171 303
497 3300046511 Ga0495608_0121575 Ga0495608_0121575_636_1586 303
498 3300046514 Ga0495618_0000052 Ga0495618_0000052_62862_63797 303
499 3300046516 Ga0495628_0000005 Ga0495628_0000005_260600_261535 303
500 3300046516 Ga0495628_0049349 Ga0495628_0049349_1209_2159 303
501 3300046517 Ga0495630_0343365 Ga0495630_0343365_179_1126 303
502 3300046526 Ga0495666_0046182 Ga0495666_0046182_1133_2080 303
503 3300046526 Ga0495666_0147559 Ga0495666_0147559_60_1010 303
504 3300046529 Ga0495652_0000001 Ga0495652_0000001_817631_818566 303
505 3300046533 Ga0495640_0000006 Ga0495640_0000006_265267_266202 303
506 3300046533 Ga0495640_0045036 Ga0495640_0045036_1933_2880 303
507 3300046533 Ga0495640_0252389 Ga0495640_0252389_82_1032 303
508 3300046536 Ga0495587_0000012 Ga0495587_0000012_159272_160207 303
509 3300046543 Ga0495645_0000014 Ga0495645_0000014_166684_167619 303
510 3300046559 Ga0495667_0000001 Ga0495667_0000001_657599_658534 303
511 3300046559 Ga0495667_0020257 Ga0495667_0020257_528_1445 303
512 3300046559 Ga0495667_0030679 Ga0495667_0030679_2328_3278 303
513 3300046642 Ga0495634_0000412 Ga0495634_0000412_3543_4478 303
514 3300046663 Ga0495635_0000007 Ga0495635_0000007_33133_34068 303
515 3300046675 Ga0495657_0000727 Ga0495657_0000727_4751_5686 303
516 3300046675 Ga0495657_0079268 Ga0495657_0079268_650_1567 303
517 3300046678 Ga0495599_0000002 Ga0495599_0000002_100185_101120 303
518 3300046678 Ga0495599_0104615 Ga0495599_0104615_168_1118 303
519 3300046679 Ga0495623_0000316 Ga0495623_0000316_912_1847 303
520 3300046679 Ga0495623_0049791 Ga0495623_0049791_1443_2360 303
521 3300046680 Ga0495646_0000024 Ga0495646_0000024_98455_99390 303
522 3300046683 Ga0495658_0018833 Ga0495658_0018833_1245_2195 303
523 3300046689 Ga0495613_0075985 Ga0495613_0075985_389_1336 303
524 3300046690 Ga0495624_0031072 Ga0495624_0031072_518_1465 303
525 3300046690 Ga0495624_0106044 Ga0495624_0106044_141_1076 303
526 3300046809 Ga0495600_0000199 Ga0495600_0000199_24514_25449 303
527 3300046809 Ga0495600_0074410 Ga0495600_0074410_136_1053 303
528 3300047315 Ga0495581_0027077 Ga0495581_0027077_285_1232 303
529 3300047315 Ga0495581_0076674 Ga0495581_0076674_913_1848 303
530 3300047317 Ga0495604_0000007 Ga0495604_0000007_184681_185616 303
531 3300047317 Ga0495604_0012881 Ga0495604_0012881_5058_6008 303
532 3300047317 Ga0495604_0156951 Ga0495604_0156951_249_1166 303
533 3300047319 Ga0495674_0000001 Ga0495674_0000001_208536_209471 303
534 3300047321 Ga0495676_0028084 Ga0495676_0028084_2718_3665 303
535 3300047321 Ga0495676_0304691 Ga0495676_0304691_11_940 303
536 3300047322 Ga0495680_0001123 Ga0495680_0001123_7144_8079 303
537 3300047322 Ga0495680_0161385 Ga0495680_0161385_608_1558 303
538 3300047444 Ga0495675_0012559 Ga0495675_0012559_1390_2325 303
539 3300047444 Ga0495675_0079347 Ga0495675_0079347_320_1237 303
540 3300047471 Ga0495684_0000027 Ga0495684_0000027_26956_27891 303
541 3300047471 Ga0495684_0007306 Ga0495684_0007306_4335_5282 303
542 3300047471 Ga0495684_0049415 Ga0495684_0049415_1959_2906 303
543 3300047673 Ga0495593_0061380 Ga0495593_0061380_603_1550 303
544 3300048088 Ga0495602_0000004 Ga0495602_0000004_159315_160250 303
545 3300048903 Ga0496100_0005158 Ga0496100_0005158_2590_3537 303
546 3300048904 Ga0496101_0045395 Ga0496101_0045395_256_1203 303
547 3300048905 Ga0496102_0019080 Ga0496102_0019080_1812_2759 303
548 3300048907 Ga0496104_0016166 Ga0496104_0016166_3811_4758 303
549 3300048908 Ga0496105_0049778 Ga0496105_0049778_2267_3214 303
550 3300048909 Ga0496106_0004426 Ga0496106_0004426_5656_6603 303
551 3300048910 Ga0496107_0010626 Ga0496107_0010626_2856_3803 303
552 3300048911 Ga0496108_0003177 Ga0496108_0003177_7454_8401 303
553 3300048912 Ga0496109_0010249 Ga0496109_0010249_3248_4195 303
554 3300048912 Ga0496109_0063465 Ga0496109_0063465_2012_2959 303
555 3300048913 Ga0496110_0005949 Ga0496110_0005949_3750_4697 303
556 3300048913 Ga0496110_0010442 Ga0496110_0010442_1538_2485 303
557 3300048914 Ga0496111_0007695 Ga0496111_0007695_2784_3731 303
558 3300048916 Ga0496113_0078603 Ga0496113_0078603_357_1304 303
559 3300048917 Ga0496114_0107053 Ga0496114_0107053_357_1304 303
560 3300049572 Ga0501036_0190420 Ga0501036_0190420_64_987 303
561 3300049575 Ga0501039_0061110 Ga0501039_0061110_311_1234 303
562 3300049576 Ga0501040_0067103 Ga0501040_0067103_175_1098 303
563 3300049581 Ga0501047_0123862 Ga0501047_0123862_335_1249 303
564 3300049587 Ga0501071_0044022 Ga0501071_0044022_1987_2910 303
565 3300049589 Ga0501073_0050072 Ga0501073_0050072_1217_2131 303
566 3300049590 Ga0501074_0044581 Ga0501074_0044581_2241_3164 303
567 3300049591 Ga0501075_0026735 Ga0501075_0026735_15_938 303
568 3300049592 Ga0501076_0313659 Ga0501076_0313659_227_1150 303
569 3300049593 Ga0501077_0036395 Ga0501077_0036395_2119_3042 303
570 3300049741 Ga0501079_0159044 Ga0501079_0159044_391_1314 303
571 3300049742 Ga0501080_0027409 Ga0501080_0027409_471_1394 303
572 3300049744 Ga0501083_0140351 Ga0501083_0140351_621_1535 303
573 3300049824 Ga0501045_0084414 Ga0501045_0084414_286_1209 303
574 3300050508 nmdc:mga09592_16801_c1 nmdc:mga09592_16801_c1_2535_3458 303
575 3300050510 nmdc:mga06r32_9412_c1 nmdc:mga06r32_9412_c1_4697_5620 303
576 3300053077 Ga0495601_0000006 Ga0495601_0000006_48586_49521 303
577 3300053077 Ga0495601_0175586 Ga0495601_0175586_314_1231 303
578 3300053078 Ga0495612_0000004 Ga0495612_0000004_265139_266074 303
579 3300053083 Ga0495655_0015752 Ga0495655_0015752_50_994 303
580 3300053084 Ga0495595_0000006 Ga0495595_0000006_192585_193520 303
581 3300053085 Ga0495619_0000011 Ga0495619_0000011_166657_167592 303
582 3300054114 Ga0501084_0024027 Ga0501084_0024027_2231_3154 303
583 3300060353 Ga0501082_0088060 Ga0501082_0088060_269_1192 303
584 3300060353 Ga0501082_0560418 Ga0501082_0560418_15_938 303
585 3300061734 Ga0530510_0044903 Ga0530510_0044903_2217_3140 303
586 3300005327 Ga0070658_10160279 Ga0070658_101602791 304
587 3300005336 Ga0070680_100046860 Ga0070680_1000468605 304
588 3300005339 Ga0070660_100094953 Ga0070660_1000949531 304
589 3300005340 Ga0070689_100006481 Ga0070689_1000064813 304
590 3300005353 Ga0070669_100052137 Ga0070669_1000521372 304
591 3300005355 Ga0070671_100098915 Ga0070671_1000989153 304
592 3300005365 Ga0070688_100026349 Ga0070688_1000263493 304
593 3300005435 Ga0070714_100260277 Ga0070714_1002602772 304
594 3300005458 Ga0070681_10180078 Ga0070681_101800783 304
595 3300005458 Ga0070681_10504365 Ga0070681_105043651 304
596 3300005466 Ga0070685_10219873 Ga0070685_102198732 304
597 3300005530 Ga0070679_100021262 Ga0070679_1000212623 304
598 3300005617 Ga0068859_100190897 Ga0068859_1001908972 304
599 3300005618 Ga0068864_100030481 Ga0068864_1000304813 304
600 3300005842 Ga0068858_100405655 Ga0068858_1004056552 304
601 3300005844 Ga0068862_100579436 Ga0068862_1005794362 304
602 3300006042 Ga0075368_10079985 Ga0075368_100799851 304
603 3300006178 Ga0075367_10048103 Ga0075367_100481033 304
604 3300006178 Ga0075367_10090012 Ga0075367_100900122 304
605 3300006178 Ga0075367_10283599 Ga0075367_102835991 304
606 3300006195 Ga0075366_10001361 Ga0075366_100013614 304
607 3300006195 Ga0075366_10242131 Ga0075366_102421311 304
608 3300006847 Ga0075431_100270929 Ga0075431_1002709292 304
609 3300006931 Ga0097620_100190898 Ga0097620_1001908982 304
610 3300009094 Ga0111539_10041314 Ga0111539_100413142 304
611 3300009177 Ga0105248_10614035 Ga0105248_106140351 304
612 3300009551 Ga0105238_10196033 Ga0105238_101960332 304
613 3300011119 Ga0105246_10385015 Ga0105246_103850151 304
614 3300013104 Ga0157370_10148763 Ga0157370_101487631 304
615 3300013297 Ga0157378_10114051 Ga0157378_101140511 304
616 3300013306 Ga0163162_10195346 Ga0163162_101953461 304
617 3300013306 Ga0163162_10435449 Ga0163162_104354492 304
618 3300014325 Ga0163163_10064618 Ga0163163_100646183 304
619 3300014326 Ga0157380_10290599 Ga0157380_102905991 304
620 3300014326 Ga0157380_10335969 Ga0157380_103359691 304
621 3300021388 Ga0213875_10027032 Ga0213875_100270322 304
622 3300025912 Ga0207707_10051087 Ga0207707_100510871 304
623 3300025912 Ga0207707_10160155 Ga0207707_101601553 304
624 3300025919 Ga0207657_10052916 Ga0207657_100529162 304
625 3300025923 Ga0207681_10042227 Ga0207681_100422273 304
626 3300025926 Ga0207659_10270084 Ga0207659_102700842 304
627 3300025931 Ga0207644_10014393 Ga0207644_100143935 304
628 3300025936 Ga0207670_10025042 Ga0207670_100250423 304
629 3300026089 Ga0207648_10064010 Ga0207648_100640103 304
630 3300026095 Ga0207676_10011939 Ga0207676_100119394 304
631 3300027907 Ga0207428_10243434 Ga0207428_102434342 304
632 3300028800 Ga0265338_10021763 Ga0265338_100217638 304
633 3300031249 Ga0265339_10000080 Ga0265339_1000008025 304
634 3300031595 Ga0265313_10000330 Ga0265313_1000033030 304
635 3300035117 Ga0373953_0012233 Ga0373953_0012233_1331_2287 304
636 3300035118 Ga0373954_0032919 Ga0373954_0032919_303_1259 304
637 3300035121 Ga0373960_0042512 Ga0373960_0042512_362_1276 304
638 3300035171 Ga0373946_0044646 Ga0373946_0044646_365_1315 304
639 3300035410 Ga0373924_0005515 Ga0373924_0005515_1437_2393 304
640 3300035691 Ga0373931_0092748 Ga0373931_0092748_643_1557 304
641 3300035692 Ga0373935_0020718 Ga0373935_0020718_141_1097 304
642 3300035692 Ga0373935_0035403 Ga0373935_0035403_1887_2837 304
643 3300035695 Ga0373927_0021678 Ga0373927_0021678_1310_2260 304
644 3300035695 Ga0373927_0112291 Ga0373927_0112291_626_1582 304
645 3300035725 Ga0373947_0066744 Ga0373947_0066744_64_1014 304
646 3300036401 Ga0373937_0497320 Ga0373937_0497320_173_1129 304
647 3300037068 Ga0373925_0032671 Ga0373925_0032671_1116_2066 304
648 3300037068 Ga0373925_0053236 Ga0373925_0053236_1693_2607 304
649 3300037853 Ga0436364_0748531 Ga0436364_0748531_605_1522 304
650 3300037853 Ga0436364_0771233 Ga0436364_0771233_1727_2668 304
651 3300044694 Ga0466963_0051933 Ga0466963_0051933_755_1738 304
652 3300045976 Ga0466967_0129520 Ga0466967_0129520_967_1950 304
653 3300045976 Ga0466967_0376621 Ga0466967_0376621_163_1095 304
654 3300046454 Ga0495592_0038235 Ga0495592_0038235_1512_2468 304
655 3300046460 Ga0495638_0030487 Ga0495638_0030487_58_981 304
656 3300046462 Ga0495651_0045111 Ga0495651_0045111_2235_3191 304
657 3300046463 Ga0495653_0017397 Ga0495653_0017397_1400_2356 304
658 3300046463 Ga0495653_0124846 Ga0495653_0124846_250_1200 304
659 3300046474 Ga0495605_0026611 Ga0495605_0026611_1315_2241 304
660 3300046476 Ga0495662_0002924 Ga0495662_0002924_3456_4406 304
661 3300046477 Ga0495664_0000142 Ga0495664_0000142_18127_19077 304
662 3300046511 Ga0495608_0016441 Ga0495608_0016441_2943_3899 304
663 3300046514 Ga0495618_0000471 Ga0495618_0000471_5024_5974 304
664 3300046514 Ga0495618_0008311 Ga0495618_0008311_557_1513 304
665 3300046517 Ga0495630_0036902 Ga0495630_0036902_2321_3277 304
666 3300046529 Ga0495652_0015686 Ga0495652_0015686_1870_2820 304
667 3300046533 Ga0495640_0003772 Ga0495640_0003772_8461_9417 304
668 3300046533 Ga0495640_0035965 Ga0495640_0035965_879_1829 304
669 3300046536 Ga0495587_0073090 Ga0495587_0073090_65_1021 304
670 3300046543 Ga0495645_0009924 Ga0495645_0009924_883_1833 304
671 3300046642 Ga0495634_0005395 Ga0495634_0005395_1274_2224 304
672 3300046642 Ga0495634_0009029 Ga0495634_0009029_2971_3927 304
673 3300046663 Ga0495635_0002818 Ga0495635_0002818_1282_2232 304
674 3300046680 Ga0495646_0015685 Ga0495646_0015685_1331_2287 304
675 3300046680 Ga0495646_0122061 Ga0495646_0122061_156_1106 304
676 3300047319 Ga0495674_0002597 Ga0495674_0002597_16190_17146 304
677 3300047319 Ga0495674_0047646 Ga0495674_0047646_1785_2735 304
678 3300047322 Ga0495680_0006886 Ga0495680_0006886_8911_9867 304
679 3300047471 Ga0495684_0002588 Ga0495684_0002588_1802_2752 304
680 3300048904 Ga0496101_0325934 Ga0496101_0325934_189_1103 304
681 3300048909 Ga0496106_0033517 Ga0496106_0033517_1554_2468 304
682 3300048911 Ga0496108_0095214 Ga0496108_0095214_592_1506 304
683 3300048913 Ga0496110_0187722 Ga0496110_0187722_350_1267 304
684 3300048915 Ga0496112_0040219 Ga0496112_0040219_2361_3275 304
685 3300048917 Ga0496114_0043271 Ga0496114_0043271_570_1484 304
686 3300048918 Ga0496115_0029402 Ga0496115_0029402_2674_3588 304
687 3300049568 Ga0501031_0049006 Ga0501031_0049006_873_1793 304
688 3300049569 Ga0501032_0038885 Ga0501032_0038885_976_1896 304
689 3300049570 Ga0501033_0069637 Ga0501033_0069637_635_1555 304
690 3300049571 Ga0501034_0183588 Ga0501034_0183588_457_1371 304
691 3300049571 Ga0501034_0207610 Ga0501034_0207610_566_1486 304
692 3300049572 Ga0501036_0010381 Ga0501036_0010381_5494_6414 304
693 3300049573 Ga0501037_0061031 Ga0501037_0061031_1139_2059 304
694 3300049574 Ga0501038_0101814 Ga0501038_0101814_268_1188 304
695 3300049574 Ga0501038_0140723 Ga0501038_0140723_294_1208 304
696 3300049575 Ga0501039_0228921 Ga0501039_0228921_324_1244 304
697 3300049579 Ga0501043_0130034 Ga0501043_0130034_221_1141 304
698 3300049580 Ga0501046_0085272 Ga0501046_0085272_1304_2230 304
699 3300049581 Ga0501047_0004258 Ga0501047_0004258_10856_11782 304
700 3300049581 Ga0501047_0027586 Ga0501047_0027586_2883_3803 304
701 3300049581 Ga0501047_0246229 Ga0501047_0246229_339_1253 304
702 3300049585 Ga0501069_0081927 Ga0501069_0081927_478_1392 304
703 3300049588 Ga0501072_0003155 Ga0501072_0003155_11214_12131 304
704 3300049822 Ga0501035_0008134 Ga0501035_0008134_1101_2027 304
705 3300049822 Ga0501035_0009844 Ga0501035_0009844_5725_6645 304
706 3300049823 Ga0501044_0000678 Ga0501044_0000678_3552_4466 304
707 3300049823 Ga0501044_0036346 Ga0501044_0036346_2670_3596 304
708 3300049823 Ga0501044_0159501 Ga0501044_0159501_566_1486 304
709 3300050493 nmdc:mga0k408_2291_c1 nmdc:mga0k408_2291_c1_6270_7184 304
710 3300050494 nmdc:mga06z11_33731_c1 nmdc:mga06z11_33731_c1_1062_1976 304
711 3300050511 nmdc:mga08y16_127411_c1 nmdc:mga08y16_127411_c1_1451_2368 304
712 3300053077 Ga0495601_0002675 Ga0495601_0002675_8395_9345 304
713 3300053077 Ga0495601_0007858 Ga0495601_0007858_5175_6131 304
714 3300053077 Ga0495601_0028456 Ga0495601_0028456_770_1684 304
715 3300053078 Ga0495612_0013401 Ga0495612_0013401_2198_3148 304
716 3300053078 Ga0495612_0040548 Ga0495612_0040548_492_1406 304
717 3300053084 Ga0495595_0012396 Ga0495595_0012396_1285_2199 304
718 3300053085 Ga0495619_0000663 Ga0495619_0000663_13015_13965 304
719 3300053119 Ga0500595_011732 Ga0500595_011732_1510_2427 304
720 3300053153 Ga0500616_0126874 Ga0500616_0126874_50_970 304
721 3300054114 Ga0501084_0144528 Ga0501084_0144528_1058_1975 304
722 3300054114 Ga0501084_0202458 Ga0501084_0202458_197_1111 304
723 3300006844 Ga0075428_100132548 Ga0075428_1001325484 305
724 3300006847 Ga0075431_100138807 Ga0075431_1001388071 305
725 3300009094 Ga0111539_10009267 Ga0111539_100092677 305
726 3300027907 Ga0207428_10060942 Ga0207428_100609424 305
727 3300049743 Ga0501081_0274681 Ga0501081_0274681_77_1012 305
728 3300050510 nmdc:mga06r32_475510_c1 nmdc:mga06r32_475510_c1_283_1218 305
729 3300050511 nmdc:mga08y16_14054_c1 nmdc:mga08y16_14054_c1_2052_2987 305
730 3300003215 JGI25153J46596_10001140 JGI25153J46596_100011404 306
731 3300005539 Ga0068853_100523613 Ga0068853_1005236131 306
732 3300025297 Ga0209758_1000741 Ga0209758_10007414 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

68

176

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w2j-assembly1.cif.gz_C cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.9068 44 303
8jek-assembly1.cif.gz_C cryo-em structure of k-ferricyanide oxidized membrane-bound fructose dehydrogenase from gluconobacter japonicus 0.9019 43 303
8gy2-assembly1.cif.gz_B cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans 0.8859 41 300
8gy3-assembly1.cif.gz_A cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8616 13 294
8gy3-assembly1.cif.gz_A cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.7952 13 294
ID Description Score Start End Superfamily
1dvhA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6582 192 294 1.10.760.10
1dvhA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6378 192 294 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6092 185 299 1.10.760.10
4wqaA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6072 25 147 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.5944 228 291 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A431P530-F1-model_v4 deleted 0.9794 1 306
AF-A0A258JFY8-F1-model_v4 Alkylated DNA repair protein 0.9749 1 230 GO:0009055
GO:0020037
GO:0046872
AF-A0A537SH69-F1-model_v4 C-type cytochrome 0.9734 1 303 GO:0009055
GO:0020037
GO:0046872
AF-A0A431P530-F1-model_v4 deleted 0.9731 1 306
AF-A0A537SH69-F1-model_v4 C-type cytochrome 0.9702 1 303 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.87 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map