F478000

General Info

Members Datasets Scaffolds Average Seq Length
732 366 661 124

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10041547|rootH1_100415472
Length 131
Sequence MFANTQMMGTDMGFPDVCLTPTPAGPVXXXXPNIAMGPMAIPNCPTILFMCTPAHNLGTTIPMTNGDNAGVNMGVASGSVMGPSRHLTGAFTVLLNGMPATRLTSVSLQNSTNCPGVRVVPSQALVLLLAP

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2547132181 Kosakonia sacchari SP1 Isolate Stem
5 2561511199 Enterobacter sp. R4-368 Isolate Nodule
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
11 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
12 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
13 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
14 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
15 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
16 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
17 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
18 2643221658 Variovorax sp. Root411 Isolate Unclassified
19 2643221672 Variovorax sp. Root434 Isolate Unclassified
20 2643221683 Variovorax sp. Root473 Isolate Unclassified
21 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
22 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541307 Variovorax sp. GV008 Isolate Unclassified
25 2738543019 Variovorax sp. GV040 Isolate Unclassified
26 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
27 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
28 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
29 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
30 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
31 2818991446 Variovorax sp. 1180 Isolate Unclassified
32 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2842677519 Variovorax sp. R-72495 Isolate Unclassified
35 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
36 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
37 2885198086 Variovorax sp. 679 Isolate Unclassified
38 2885211737 Variovorax sp. 553 Isolate Unclassified
39 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
40 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
41 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
42 2899924645 Variovorax sp. 369 Isolate Unclassified
43 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
44 2904456579 Variovorax sp. 2002 Isolate Unclassified
45 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
46 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928070936 Variovorax gossypii 1167 Isolate Unclassified
52 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
53 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
54 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
55 2929520902 Variovorax beijingensis 502 Isolate Unclassified
56 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
57 2937967321 Serratia sp. YC16 Isolate Unclassified
58 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
59 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
60 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
61 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
62 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
63 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
64 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
65 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
66 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
67 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
68 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
69 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
70 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
71 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
72 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
73 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
76 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
77 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
78 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
79 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
80 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
81 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
82 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
83 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
84 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
85 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
86 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
87 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
88 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
89 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
92 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
93 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
94 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
95 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
96 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
97 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
98 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
99 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
100 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
101 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
102 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
105 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
106 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
112 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
116 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
117 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
118 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
161 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
215 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
216 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
217 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
218 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
219 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
220 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
221 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
222 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
226 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
246 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
247 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
248 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
249 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
250 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
251 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
252 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
253 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
254 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
255 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
263 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
264 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
265 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
266 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
267 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
268 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
269 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
270 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
273 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
274 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
275 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
276 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
277 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
278 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
282 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
283 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
284 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
313 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
324 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
325 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
326 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
338 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
343 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
344 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
345 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
346 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
347 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
348 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
349 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
350 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
351 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
352 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
353 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
354 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
357 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
358 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
359 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
360 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
361 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
362 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 640753048 Serratia proteamaculans 568 Isolate Endosphere
364 8004592986 Serratia sp. S119 Isolate Unclassified
365 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
366 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.03
Metatranscriptomes 0.27
Isolates 9.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 32.1
Nodule 1.37
Rhizoplane 2.73
Rhizosphere 50.27
Stem 0.14
Stem Tuber 0.14
Unclassified 12.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C920 2010549000 Bacteria 2156
2 JGI24740J21852_10002188 3300001979 Bacteria 8939
3 JGI24739J22299_10001792 3300001989 Bacteria 8173
4 JGI24739J22299_10005292 3300001989 Bacteria 4915
5 JGI24739J22299_10006490 3300001989 Bacteria 4412
6 JGI24739J22299_10010438 3300001989 Bacteria 3448
7 JGI24735J21928_10124133 3300002067 Bacteria 744
8 JGI25158J39367_1003338 3300002739 Bacteria 2485
9 JGI25158J39367_1003485 3300002739 Bacteria 2427
10 JGI25152J39213_1000801 3300002773 Bacteria 15740
11 JGI25152J39213_1002221 3300002773 Bacteria 7551
12 JGI25152J39213_1002698 3300002773 Bacteria 6497
13 JGI25150J39212_1000532 3300002774 Bacteria 15522
14 JGI25150J39212_1012136 3300002774 Bacteria 1535
15 JGI25159J45721_1000759 3300002987 Bacteria 13994
16 JGI25159J45721_1010112 3300002987 Bacteria 2432
17 JGI25151J46595_10000859 3300003187 Bacteria 24089
18 JGI25151J46595_10003022 3300003187 Bacteria 9559
19 JGI25151J46595_10004385 3300003187 Bacteria 7477
20 JGI25151J46595_10005615 3300003187 Bacteria 6450
21 JGI25151J46595_10019187 3300003187 Bacteria 2911
22 JGI25153J46596_10004703 3300003215 Bacteria 7289
23 JGI25153J46596_10016032 3300003215 Bacteria 3023
24 rootH1_10041547 3300003316 Bacteria 1746
25 rootH2_10005335 3300003320 Bacteria 1490
26 rootH2_10070234 3300003320 Bacteria 1370
27 rootL2_10045172 3300003322 Bacteria 6056
28 rootL2_10095266 3300003322 Bacteria 1834
29 rootH1_10008528 3300003323 Bacteria 1149
30 rootH1_10008536 3300003323 Bacteria 8047
31 rootH1_10257612 3300003323 Bacteria 1112
32 JGI25160J50197_1003270 3300003354 Bacteria 7298
33 JGI25160J50197_1017164 3300003354 Bacteria 2303
34 JGI25161J50226_1001055 3300003374 Bacteria 9435
35 JGI25161J50226_1001654 3300003374 Bacteria 6407
36 Ga0055535_1000655 3300003761 Bacteria 27427
37 Ga0055542_1000301 3300003762 Bacteria 54975
38 Ga0055526_1005451 3300003771 Bacteria 7316
39 Ga0055526_1006343 3300003771 Bacteria 6449
40 Ga0055537_1000230 3300003773 Bacteria 40840
41 Ga0055537_1002342 3300003773 Bacteria 6437
42 Ga0055537_1008517 3300003773 Bacteria 2359
43 Ga0055524_1003704 3300003775 Bacteria 7316
44 Ga0055524_1004507 3300003775 Bacteria 6415
45 Ga0055536_1005261 3300003781 Bacteria 6375
46 Ga0055534_1000151 3300003784 Bacteria 51420
47 Ga0055534_1000782 3300003784 Bacteria 14876
48 Ga0055534_1005353 3300003784 Bacteria 3454
49 Ga0055528_1000165 3300003790 Bacteria 55665
50 Ga0055528_1004775 3300003790 Bacteria 6451
51 Ga0055528_1018489 3300003790 Bacteria 2359
52 Ga0055530_10005244 3300003791 Bacteria 6259
53 Ga0055530_10045596 3300003791 Bacteria 1045
54 Ga0055540_1002400 3300003792 Bacteria 9933
55 Ga0055540_1006632 3300003792 Bacteria 4549
56 Ga0055531_10002480 3300003794 Bacteria 12310
57 Ga0058692_1015801 3300003856 Bacteria 1692
58 Ga0058692_1018596 3300003856 Bacteria 1499
59 Ga0055543_1000654 3300004625 Bacteria 18357
60 Ga0055543_1015739 3300004625 Bacteria 1451
61 Ga0065165_1004213 3300005262 Bacteria 9153
62 Ga0065165_1022760 3300005262 Bacteria 2139
63 Ga0065703_1018900 3300005272 Bacteria 5342
64 Ga0065714_10028184 3300005288 Bacteria 1323
65 Ga0065714_10067058 3300005288 Bacteria 5943
66 Ga0065704_10220664 3300005289 Bacteria 1075
67 Ga0070690_100972555 3300005330 Bacteria 667
68 Ga0068869_100343138 3300005334 Bacteria 1216
69 Ga0068869_100929650 3300005334 Bacteria 754
70 Ga0068869_101960968 3300005334 Bacteria 525
71 Ga0070661_100086019 3300005344 Bacteria 2324
72 Ga0070668_100259622 3300005347 Bacteria 1444
73 Ga0070673_100469295 3300005364 Bacteria 1134
74 Ga0070659_100047218 3300005366 Bacteria 3377
75 Ga0070678_100134507 3300005456 Bacteria 1970
76 Ga0070678_101334865 3300005456 Bacteria 668
77 Ga0070662_100024895 3300005457 Bacteria 4128
78 Ga0068867_100519729 3300005459 Bacteria 1026
79 Ga0068853_100025162 3300005539 Bacteria 4994
80 Ga0068853_100089631 3300005539 Bacteria 2702
81 Ga0070665_100037997 3300005548 Bacteria 4840
82 Ga0070665_100141805 3300005548 Unclassified 2406
83 Ga0068855_100423369 3300005563 Bacteria 1456
84 Ga0070664_100004285 3300005564 Bacteria 11479
85 Ga0068857_100063086 3300005577 Bacteria 3294
86 Ga0068854_100076878 3300005578 Bacteria 2455
87 Ga0068854_100558972 3300005578 Bacteria 972
88 Ga0068852_100012470 3300005616 Bacteria 6457
89 Ga0068852_100180619 3300005616 Bacteria 1984
90 Ga0068864_102379652 3300005618 Bacteria 536
91 Ga0068866_10870623 3300005718 Bacteria 631
92 Ga0068851_10001095 3300005834 Bacteria 11756
93 Ga0068860_100422028 3300005843 Bacteria 1322
94 Ga0068860_100795382 3300005843 Bacteria 959
95 Ga0070717_11432976 3300006028 Bacteria 627
96 Ga0075365_10000218 3300006038 Bacteria 19315
97 Ga0075365_10379763 3300006038 Bacteria 997
98 Ga0075363_100000205 3300006048 Bacteria 16323
99 Ga0075363_100003154 3300006048 Bacteria 6934
100 Ga0075363_100003776 3300006048 Bacteria 6526
101 Ga0075363_100013928 3300006048 Bacteria 3914
102 Ga0075363_100056093 3300006048 Bacteria 2111
103 Ga0075363_100073625 3300006048 Bacteria 1859
104 Ga0075363_100095383 3300006048 Bacteria 1641
105 Ga0075363_100128242 3300006048 Bacteria 1421
106 Ga0075363_100470788 3300006048 Bacteria 744
107 Ga0075364_10001540 3300006051 Bacteria 12576
108 Ga0075364_10042596 3300006051 Bacteria 2950
109 Ga0075364_10071118 3300006051 Bacteria 2291
110 Ga0075364_10339919 3300006051 Bacteria 1023
111 Ga0075364_10407777 3300006051 Bacteria 927
112 Ga0075364_11111622 3300006051 Bacteria 536
113 Ga0075432_10003988 3300006058 Bacteria 5037
114 Ga0075432_10005947 3300006058 Bacteria 4151
115 Ga0075432_10180735 3300006058 Bacteria 825
116 Ga0075362_10001382 3300006177 Bacteria 7701
117 Ga0075362_10004148 3300006177 Bacteria 5170
118 Ga0075362_10005957 3300006177 Bacteria 4506
119 Ga0075362_10016686 3300006177 Bacteria 3011
120 Ga0075362_10052036 3300006177 Bacteria 1834
121 Ga0075367_10019854 3300006178 Bacteria 3733
122 Ga0075367_10069124 3300006178 Bacteria 2120
123 Ga0075367_10095797 3300006178 Bacteria 1810
124 Ga0075367_10449490 3300006178 Bacteria 816
125 Ga0075367_10546353 3300006178 Bacteria 735
126 Ga0075369_10081114 3300006186 Bacteria 1439
127 Ga0075369_10097735 3300006186 Bacteria 1315
128 Ga0075369_10175133 3300006186 Bacteria 986
129 Ga0075369_10192560 3300006186 Bacteria 940
130 Ga0075369_10598765 3300006186 Bacteria 528
131 Ga0075366_10001207 3300006195 Bacteria 12821
132 Ga0075366_10003574 3300006195 Bacteria 8226
133 Ga0075366_10008724 3300006195 Bacteria 5644
134 Ga0075366_10114734 3300006195 Bacteria 1622
135 Ga0075366_10165507 3300006195 Bacteria 1341
136 Ga0075366_10525475 3300006195 Bacteria 732
137 Ga0075366_10592044 3300006195 Bacteria 687
138 Ga0075366_10878934 3300006195 Bacteria 558
139 Ga0097621_100160169 3300006237 Bacteria 1934
140 Ga0097621_100729542 3300006237 Bacteria 914
141 Ga0075370_10000561 3300006353 Bacteria 14232
142 Ga0075370_10000992 3300006353 Bacteria 11736
143 Ga0075370_10001546 3300006353 Bacteria 10069
144 Ga0075370_10002472 3300006353 Bacteria 8576
145 Ga0075370_10014361 3300006353 Bacteria 4222
146 Ga0075370_10024484 3300006353 Bacteria 3335
147 Ga0075370_10048729 3300006353 Bacteria 2400
148 Ga0075370_10080271 3300006353 Bacteria 1874
149 Ga0075370_10128403 3300006353 Bacteria 1478
150 Ga0075370_10339624 3300006353 Bacteria 896
151 Ga0075370_10408668 3300006353 Bacteria 815
152 Ga0068871_100060058 3300006358 Bacteria 3100
153 Ga0068871_100251666 3300006358 Unclassified 1539
154 Ga0068871_100275220 3300006358 Unclassified 1471
155 Ga0075428_101044463 3300006844 Bacteria 864
156 Ga0075433_10499826 3300006852 Bacteria 1070
157 Ga0075429_100953386 3300006880 Bacteria 750
158 Ga0068865_100035516 3300006881 Unclassified 3353
159 Ga0068865_100927521 3300006881 Unclassified 759
160 Ga0079104_1003589 3300006946 Bacteria 7116
161 Ga0079104_1027682 3300006946 Bacteria 1450
162 Ga0099826_10002026 3300006948 Bacteria 12771
163 Ga0099826_10014200 3300006948 Bacteria 6017
164 Ga0099826_10293551 3300006948 Bacteria 834
165 Ga0105251_10140083 3300009011 Bacteria 1094
166 Ga0105244_10004138 3300009036 Bacteria 10106
167 Ga0105244_10008009 3300009036 Bacteria 6648
168 Ga0105244_10018820 3300009036 Bacteria 3866
169 Ga0105244_10031627 3300009036 Bacteria 2808
170 Ga0105240_10079264 3300009093 Bacteria 4042
171 Ga0105240_10090554 3300009093 Bacteria 3738
172 Ga0114129_10723807 3300009147 Bacteria 1277
173 Ga0105243_10002996 3300009148 Bacteria 13951
174 Ga0105243_10003562 3300009148 Bacteria 12569
175 Ga0105243_10017196 3300009148 Bacteria 5469
176 Ga0105243_10106697 3300009148 Bacteria 2335
177 Ga0105241_10823842 3300009174 Bacteria 856
178 Ga0105242_10499946 3300009176 Bacteria 1156
179 Ga0105242_11955784 3300009176 Bacteria 628
180 Ga0105237_10111668 3300009545 Bacteria 2725
181 Ga0105237_10132012 3300009545 Bacteria 2492
182 Ga0105237_12609380 3300009545 Unclassified 516
183 Ga0105238_10074524 3300009551 Bacteria 3387
184 Ga0105238_10086218 3300009551 Bacteria 3127
185 Ga0105238_11969078 3300009551 Bacteria 618
186 Ga0105239_10033028 3300010375 Bacteria 5683
187 Ga0105239_10076528 3300010375 Bacteria 3680
188 Ga0105246_10003441 3300011119 Bacteria 9599
189 Ga0105246_10009103 3300011119 Bacteria 6115
190 Ga0157373_10002535 3300013100 Bacteria 13905
191 Ga0157373_10004058 3300013100 Bacteria 11032
192 Ga0157373_10009631 3300013100 Bacteria 7130
193 Ga0157373_10011038 3300013100 Bacteria 6653
194 Ga0157373_10023490 3300013100 Bacteria 4468
195 Ga0157373_10375760 3300013100 Bacteria 1016
196 Ga0157371_10008632 3300013102 Bacteria 8094
197 Ga0157371_10011822 3300013102 Bacteria 6704
198 Ga0157371_10041613 3300013102 Bacteria 3278
199 Ga0157371_10083132 3300013102 Bacteria 2267
200 Ga0157370_10794398 3300013104 Bacteria 861
201 Ga0157369_10013444 3300013105 Bacteria 9252
202 Ga0157369_10020697 3300013105 Bacteria 7355
203 Ga0157369_10023936 3300013105 Bacteria 6797
204 Ga0157369_10049558 3300013105 Bacteria 4553
205 Ga0157369_11095357 3300013105 Bacteria 814
206 Ga0157372_10024631 3300013307 Bacteria 6541
207 Ga0157372_10042147 3300013307 Bacteria 5047
208 Ga0157375_10008646 3300013308 Bacteria 8920
209 Ga0182008_10001722 3300014497 Bacteria 14353
210 Ga0182008_10008714 3300014497 Bacteria 5515
211 Ga0182008_10014691 3300014497 Bacteria 4095
212 Ga0182008_10022869 3300014497 Bacteria 3199
213 Ga0157376_10087634 3300014969 Bacteria 2687
214 Ga0157376_11069913 3300014969 Bacteria 831
215 Ga0182006_1001207 3300015261 Bacteria 16149
216 Ga0182006_1009770 3300015261 Bacteria 4289
217 Ga0182006_1026328 3300015261 Bacteria 2381
218 Ga0182006_1036623 3300015261 Bacteria 1950
219 Ga0182006_1064138 3300015261 Bacteria 1378
220 Ga0182006_1073282 3300015261 Bacteria 1264
221 Ga0182006_1119548 3300015261 Bacteria 917
222 Ga0182006_1175023 3300015261 Bacteria 717
223 Ga0182007_10000297 3300015262 Bacteria 32194
224 Ga0182007_10033732 3300015262 Bacteria 1733
225 Ga0182007_10035581 3300015262 Bacteria 1678
226 Ga0182005_1152023 3300015265 Bacteria 674
227 Ga0163161_10000165 3300017792 Bacteria 60584
228 Ga0163161_10003662 3300017792 Bacteria 10781
229 Ga0163161_11052533 3300017792 Bacteria 697
230 Ga0213876_10000016 3300021384 Bacteria 300175
231 Ga0209672_100815 3300025228 Bacteria 14675
232 Ga0209147_100363 3300025229 Bacteria 32242
233 Ga0209437_100035 3300025233 Bacteria 481110
234 Ga0209258_100020 3300025242 Bacteria 565241
235 Ga0207425_1000487 3300025245 Bacteria 24918
236 Ga0207425_1002703 3300025245 Bacteria 6062
237 Ga0207425_1031419 3300025245 Bacteria 1058
238 Ga0207425_1047303 3300025245 Bacteria 798
239 Ga0209148_1000031 3300025254 Bacteria 564601
240 Ga0209129_1000004 3300025258 Bacteria 884499
241 Ga0209129_1000277 3300025258 Bacteria 49016
242 Ga0209129_1002214 3300025258 Bacteria 9755
243 Ga0209129_1003230 3300025258 Bacteria 7263
244 Ga0209565_1000070 3300025263 Bacteria 168957
245 Ga0209565_1000189 3300025263 Bacteria 75432
246 Ga0209565_1001494 3300025263 Bacteria 10217
247 Ga0209565_1048262 3300025263 Bacteria 772
248 Ga0209673_1000264 3300025273 Bacteria 98846
249 Ga0209673_1000266 3300025273 Bacteria 98358
250 Ga0209673_1000518 3300025273 Bacteria 63151
251 Ga0209673_1001706 3300025273 Bacteria 18645
252 Ga0209130_1000294 3300025284 Bacteria 60839
253 Ga0209130_1000478 3300025284 Bacteria 41207
254 Ga0209675_1000069 3300025291 Bacteria 170538
255 Ga0209675_1000278 3300025291 Bacteria 48974
256 Ga0209675_1001780 3300025291 Bacteria 11763
257 Ga0209675_1002756 3300025291 Bacteria 8779
258 Ga0209676_1000195 3300025292 Bacteria 135920
259 Ga0209676_1000361 3300025292 Bacteria 85925
260 Ga0209676_1001614 3300025292 Bacteria 19960
261 Ga0209676_1002319 3300025292 Bacteria 13800
262 Ga0209676_1063682 3300025292 Bacteria 905
263 Ga0209025_1000029 3300025294 Bacteria 488571
264 Ga0209025_1000319 3300025294 Bacteria 107011
265 Ga0209025_1000526 3300025294 Bacteria 72957
266 Ga0209025_1000940 3300025294 Bacteria 44330
267 Ga0209025_1004022 3300025294 Bacteria 13180
268 Ga0209025_1032016 3300025294 Bacteria 2470
269 Ga0209025_1050668 3300025294 Bacteria 1658
270 Ga0209564_1000101 3300025295 Bacteria 222879
271 Ga0209564_1000156 3300025295 Bacteria 165265
272 Ga0209758_1000127 3300025297 Bacteria 189368
273 Ga0209758_1008911 3300025297 Bacteria 6365
274 Ga0209050_1000021 3300025298 Bacteria 574406
275 Ga0209050_1012775 3300025298 Bacteria 3810
276 Ga0209050_1039313 3300025298 Bacteria 1335
277 Ga0209256_1000104 3300025299 Bacteria 189367
278 Ga0209256_1000137 3300025299 Bacteria 158814
279 Ga0207426_1000149 3300025302 Bacteria 189367
280 Ga0207426_1000398 3300025302 Bacteria 73672
281 Ga0207426_1051737 3300025302 Bacteria 1219
282 Ga0209051_1000028 3300025303 Bacteria 404269
283 Ga0209051_1000184 3300025303 Bacteria 112134
284 Ga0209051_1000607 3300025303 Bacteria 41634
285 Ga0209051_1012172 3300025303 Bacteria 4177
286 Ga0209257_1001918 3300025304 Bacteria 22463
287 Ga0209257_1003866 3300025304 Bacteria 12233
288 Ga0209257_1007641 3300025304 Bacteria 6475
289 Ga0209257_1093511 3300025304 Bacteria 746
290 Ga0207656_10139611 3300025321 Bacteria 1141
291 Ga0207655_1001349 3300025728 Bacteria 23056
292 Ga0207655_1008284 3300025728 Bacteria 6616
293 Ga0207713_1099714 3300025735 Bacteria 1005
294 Ga0207695_10068719 3300025913 Bacteria 3629
295 Ga0207695_10293723 3300025913 Bacteria 1517
296 Ga0207671_10370887 3300025914 Bacteria 1137
297 Ga0207657_10269001 3300025919 Bacteria 1355
298 Ga0207649_10054698 3300025920 Bacteria 2485
299 Ga0207690_10873445 3300025932 Bacteria 745
300 Ga0207706_10008854 3300025933 Bacteria 9266
301 Ga0207686_11383574 3300025934 Bacteria 579
302 Ga0207709_10000448 3300025935 Bacteria 38563
303 Ga0207709_10001264 3300025935 Bacteria 18132
304 Ga0207709_10001311 3300025935 Bacteria 17710
305 Ga0207709_10937012 3300025935 Bacteria 705
306 Ga0207704_10461721 3300025938 Bacteria 1016
307 Ga0207689_10847816 3300025942 Bacteria 771
308 Ga0207661_10218174 3300025944 Unclassified 1685
309 Ga0207679_10098890 3300025945 Bacteria 2276
310 Ga0207667_10092374 3300025949 Bacteria 3126
311 Ga0207668_10838175 3300025972 Bacteria 816
312 Ga0207640_10585466 3300025981 Bacteria 942
313 Ga0207658_10000824 3300025986 Bacteria 25908
314 Ga0207639_10033919 3300026041 Bacteria 3769
315 Ga0207648_10090288 3300026089 Bacteria 2677
316 Ga0207648_10381923 3300026089 Bacteria 1274
317 Ga0207674_10024032 3300026116 Bacteria 6517
318 Ga0207674_10277597 3300026116 Bacteria 1623
319 Ga0207683_10117008 3300026121 Bacteria 2390
320 Ga0207683_11287712 3300026121 Bacteria 677
321 Ga0207698_10921680 3300026142 Bacteria 882
322 Ga0209281_1008938 3300027111 Bacteria 2387
323 Ga0209281_1053128 3300027111 Bacteria 640
324 Ga0209371_1000052 3300027312 Bacteria 274444
325 Ga0209371_1002652 3300027312 Bacteria 9753
326 Ga0209371_1047017 3300027312 Bacteria 845
327 Ga0209282_1001406 3300027666 Bacteria 13206
328 Ga0209813_10129051 3300027866 Bacteria 887
329 Ga0207428_10024767 3300027907 Bacteria 5037
330 Ga0268266_10108896 3300028379 Bacteria 2452
331 Ga0268266_10108918 3300028379 Unclassified 2452
332 Ga0268266_11425305 3300028379 Bacteria 668
333 Ga0268265_10019139 3300028380 Bacteria 4753
334 Ga0268264_10185342 3300028381 Unclassified 1893
335 Ga0268264_11285204 3300028381 Unclassified 742
336 Ga0307515_10000248 3300028794 Bacteria 134073
337 Ga0268256_1000061 3300030500 Bacteria 216116
338 Ga0268256_1007310 3300030500 Bacteria 3959
339 Ga0268256_1033576 3300030500 Bacteria 1210
340 Ga0268256_1053016 3300030500 Bacteria 845
341 Ga0316177_1080122 3300030731 Bacteria 8682
342 Ga0314311_1024461 3300030733 Bacteria 7458
343 Ga0316179_1114146 3300030734 Bacteria 3706
344 Ga0316178_1088360 3300030735 Bacteria 4423
345 Ga0316180_1109260 3300030736 Bacteria 2798
346 Ga0316183_1144523 3300030742 Bacteria 7782
347 Ga0316181_1062975 3300030744 Bacteria 3019
348 Ga0316182_1103192 3300030745 Bacteria 599
349 Ga0316182_1202305 3300030745 Bacteria 8009
350 Ga0265331_10200415 3300031250 Bacteria 899
351 Ga0265331_10202271 3300031250 Bacteria 894
352 Ga0307513_10094668 3300031456 Bacteria 3031
353 Ga0307513_10693865 3300031456 Bacteria 724
354 Ga0307408_100026269 3300031548 Bacteria 3997
355 Ga0307408_100104044 3300031548 Bacteria 2168
356 Ga0307408_100107778 3300031548 Bacteria 2134
357 Ga0307408_100110525 3300031548 Bacteria 2110
358 Ga0307408_100126577 3300031548 Bacteria 1987
359 Ga0307408_100324800 3300031548 Bacteria 1297
360 Ga0307408_100978801 3300031548 Bacteria 778
361 Ga0307408_101181555 3300031548 Bacteria 713
362 Ga0307408_101670435 3300031548 Bacteria 606
363 Ga0307514_10004610 3300031649 Bacteria 12635
364 Ga0307405_10016497 3300031731 Bacteria 4029
365 Ga0307405_10020011 3300031731 Bacteria 3730
366 Ga0307405_10481750 3300031731 Bacteria 990
367 Ga0307405_10562100 3300031731 Bacteria 925
368 Ga0307405_11100829 3300031731 Bacteria 683
369 Ga0307413_10286699 3300031824 Bacteria 1241
370 Ga0307413_10332166 3300031824 Bacteria 1166
371 Ga0307413_10656907 3300031824 Bacteria 865
372 Ga0307410_10035185 3300031852 Bacteria 3250
373 Ga0307410_10201252 3300031852 Bacteria 1520
374 Ga0307410_10984220 3300031852 Bacteria 727
375 Ga0307406_10000184 3300031901 Bacteria 37320
376 Ga0307406_10008069 3300031901 Bacteria 5864
377 Ga0307406_10042339 3300031901 Bacteria 2842
378 Ga0307406_10732642 3300031901 Bacteria 828
379 Ga0307406_11185897 3300031901 Bacteria 662
380 Ga0307406_11213179 3300031901 Bacteria 655
381 Ga0307406_11521298 3300031901 Bacteria 589
382 Ga0307407_10013073 3300031903 Bacteria 4014
383 Ga0307407_10098031 3300031903 Bacteria 1813
384 Ga0307407_10211599 3300031903 Bacteria 1306
385 Ga0307412_10015797 3300031911 Bacteria 4481
386 Ga0307412_10034033 3300031911 Bacteria 3244
387 Ga0307412_10059800 3300031911 Bacteria 2555
388 Ga0307412_10074808 3300031911 Bacteria 2322
389 Ga0307412_10131073 3300031911 Bacteria 1821
390 Ga0307412_10147862 3300031911 Bacteria 1729
391 Ga0307412_10213949 3300031911 Bacteria 1473
392 Ga0307412_10224712 3300031911 Bacteria 1441
393 Ga0307412_10235734 3300031911 Bacteria 1412
394 Ga0307412_10368905 3300031911 Bacteria 1158
395 Ga0307412_10448298 3300031911 Bacteria 1062
396 Ga0307412_11518185 3300031911 Bacteria 609
397 Ga0307412_11625908 3300031911 Bacteria 590
398 Ga0307409_100420214 3300031995 Bacteria 1282
399 Ga0307416_100002576 3300032002 Bacteria 10469
400 Ga0307416_100021154 3300032002 Bacteria 4663
401 Ga0307416_100538886 3300032002 Bacteria 1239
402 Ga0307416_100934688 3300032002 Bacteria 968
403 Ga0307416_101461355 3300032002 Bacteria 789
404 Ga0307414_10690028 3300032004 Bacteria 923
405 Ga0307414_11157231 3300032004 Bacteria 715
406 Ga0307414_11270290 3300032004 Bacteria 683
407 Ga0307414_11599128 3300032004 Bacteria 607
408 Ga0307414_11857988 3300032004 Bacteria 562
409 Ga0307411_10003882 3300032005 Bacteria 7043
410 Ga0307411_10067211 3300032005 Bacteria 2411
411 Ga0307411_10069504 3300032005 Bacteria 2378
412 Ga0307411_10344299 3300032005 Bacteria 1212
413 Ga0307415_102459406 3300032126 Bacteria 512
414 Ga0316583_10000492 3300032133 Bacteria 11805
415 Ga0373935_0078306 3300035692 Bacteria 2144
416 Ga0373927_0021040 3300035695 Bacteria 4275
417 Ga0373925_0037461 3300037068 Bacteria 3581
418 Ga0400486_24404 3300038742 Bacteria 6072
419 Ga0436365_1617030 3300039437 Bacteria 523
420 Ga0436365_1910565 3300039437 Bacteria 475219
421 Ga0436361_0360914 3300039447 Unclassified 682
422 Ga0439436_0002127 3300041404 Bacteria 5916
423 Ga0439436_0034250 3300041404 Bacteria 1468
424 Ga0439438_002501 3300041405 Bacteria 7815
425 Ga0439439_0004230 3300041406 Bacteria 3221
426 Ga0439453_0071743 3300041408 Bacteria 734
427 Ga0439461_0131537 3300041410 Bacteria 633
428 Ga0439466_0022898 3300041411 Bacteria 2201
429 Ga0439466_0030491 3300041411 Bacteria 1849
430 Ga0439465_0003257 3300041413 Bacteria 5303
431 Ga0451789_0252313 3300041443 Bacteria 912
432 Ga0451795_0605217 3300041456 Bacteria 643
433 Ga0451798_0655303 3300041458 Bacteria 536
434 Ga0451802_0418642 3300041460 Bacteria 690
435 Ga0451802_0736358 3300041460 Bacteria 818
436 Ga0439431_0015299 3300041997 Bacteria 1784
437 Ga0439431_0017369 3300041997 Bacteria 1691
438 Ga0439433_0087054 3300041999 Bacteria 765
439 Ga0439442_002357 3300042002 Bacteria 3706
440 Ga0439442_018744 3300042002 Bacteria 1431
441 Ga0439442_076473 3300042002 Bacteria 715
442 Ga0439445_0068078 3300042004 Bacteria 982
443 Ga0439445_0146990 3300042004 Bacteria 685
444 Ga0439432_001168 3300042006 Bacteria 9944
445 Ga0439432_004934 3300042006 Bacteria 4832
446 Ga0439449_0025670 3300042007 Bacteria 2201
447 Ga0439449_0162031 3300042007 Bacteria 835
448 Ga0439452_000001 3300042010 Bacteria 1725439
449 Ga0439452_000022 3300042010 Bacteria 267565
450 Ga0439452_000695 3300042010 Bacteria 16507
451 Ga0439452_004115 3300042010 Bacteria 4944
452 Ga0439452_010260 3300042010 Bacteria 2732
453 Ga0439462_0009778 3300042015 Bacteria 2425
454 Ga0450919_002221 3300042121 Bacteria 2523
455 Ga0450920_011307 3300042122 Bacteria 1663
456 Ga0450923_000124 3300042125 Bacteria 6644
457 Ga0450923_033872 3300042125 Bacteria 1051
458 Ga0450894_005284 3300042131 Bacteria 1672
459 Ga0450898_020769 3300042134 Bacteria 1153
460 Ga0450906_001490 3300042145 Bacteria 5109
461 Ga0450906_072180 3300042145 Bacteria 619
462 Ga0450910_000485 3300042147 Bacteria 4718
463 Ga0450910_027141 3300042147 Bacteria 887
464 Ga0439446_0183066 3300042156 Bacteria 701
465 Ga0450908_001612 3300042184 Bacteria 4388
466 Ga0450909_005059 3300042185 Bacteria 1892
467 Ga0450909_006409 3300042185 Bacteria 1697
468 Ga0439434_0002289 3300042435 Bacteria 5564
469 Ga0439434_0055824 3300042435 Bacteria 1230
470 Ga0439434_0153761 3300042435 Bacteria 762
471 Ga0439464_0010692 3300042439 Bacteria 2424
472 Ga0450918_000234 3300042531 Bacteria 12718
473 Ga0450918_008679 3300042531 Bacteria 1785
474 Ga0450893_0085620 3300042532 Bacteria 628
475 Ga0451577_1078261 3300042876 Bacteria 719
476 Ga0466965_0187328 3300044683 Bacteria 1093
477 Ga0453684_0000491 3300044712 Bacteria 155597
478 Ga0453684_0023640 3300044712 Bacteria 9033
479 Ga0453684_0053355 3300044712 Bacteria 5277
480 Ga0453684_0580262 3300044712 Unclassified 1231
481 Ga0453684_0987953 3300044712 Bacteria 896
482 Ga0466960_0049327 3300044901 Bacteria 2026
483 Ga0466960_0349684 3300044901 Bacteria 843
484 Ga0466960_0567152 3300044901 Bacteria 671
485 Ga0466959_0301921 3300045049 Unclassified 1096
486 Ga0466959_0452865 3300045049 Unclassified 870
487 Ga0451576_0667834 3300045051 Bacteria 1092
488 Ga0451576_0968397 3300045051 Bacteria 892
489 Ga0451576_1045981 3300045051 Bacteria 855
490 Ga0451576_1511817 3300045051 Bacteria 697
491 Ga0495627_001148 3300046453 Bacteria 17088
492 Ga0495627_030780 3300046453 Bacteria 1700
493 Ga0495651_0812348 3300046462 Bacteria 576
494 Ga0495650_0021830 3300046471 Bacteria 3081
495 Ga0495583_0060584 3300046506 Bacteria 1692
496 Ga0495606_0072348 3300046507 Bacteria 2167
497 Ga0495618_0707277 3300046514 Bacteria 592
498 Ga0495620_0052570 3300046515 Bacteria 1729
499 Ga0495631_0000775 3300046518 Bacteria 20562
500 Ga0495654_0000127 3300046530 Bacteria 84749
501 Ga0495654_0325751 3300046530 Bacteria 622
502 Ga0495633_0374138 3300046558 Bacteria 645
503 Ga0495625_0000146 3300046660 Bacteria 108123
504 Ga0495625_0124711 3300046660 Bacteria 1749
505 Ga0495625_0210523 3300046660 Bacteria 1278
506 Ga0495661_0160598 3300046665 Bacteria 1207
507 Ga0495588_0030334 3300046674 Bacteria 2717
508 Ga0495588_0178751 3300046674 Bacteria 1121
509 Ga0495588_0226162 3300046674 Bacteria 987
510 Ga0495658_0026597 3300046683 Bacteria 3102
511 Ga0495670_0127735 3300046691 Bacteria 1324
512 Ga0495671_0006902 3300046692 Bacteria 6516
513 Ga0495589_0000013 3300046794 Bacteria 248616
514 Ga0495660_0080423 3300046810 Bacteria 1710
515 Ga0495660_0265223 3300046810 Bacteria 791
516 Ga0495676_0000492 3300047321 Bacteria 32413
517 Ga0495593_0000714 3300047673 Bacteria 19219
518 Ga0495602_0018378 3300048088 Bacteria 6985
519 Ga0495614_0000225 3300048089 Bacteria 21977
520 Ga0496100_0044470 3300048903 Bacteria 2845
521 Ga0496101_0031684 3300048904 Bacteria 3718
522 Ga0496102_0255991 3300048905 Bacteria 1650
523 Ga0496102_0633938 3300048905 Bacteria 992
524 Ga0496116_0010589 3300048919 Bacteria 7712
525 Ga0496116_0013128 3300048919 Bacteria 6706
526 Ga0496116_0016207 3300048919 Bacteria 5845
527 Ga0496116_0028398 3300048919 Bacteria 4053
528 Ga0496116_0048037 3300048919 Bacteria 2867
529 Ga0496117_0002511 3300048920 Bacteria 23015
530 Ga0496117_0008279 3300048920 Bacteria 9897
531 Ga0496117_0008732 3300048920 Bacteria 9571
532 Ga0496117_0010801 3300048920 Bacteria 8246
533 Ga0496117_0047007 3300048920 Bacteria 3099
534 Ga0496117_0062457 3300048920 Bacteria 2552
535 Ga0496117_0065402 3300048920 Bacteria 2472
536 Ga0496117_0069922 3300048920 Bacteria 2361
537 Ga0496117_0382242 3300048920 Bacteria 716
538 Ga0496118_0002851 3300048921 Bacteria 22559
539 Ga0496118_0004060 3300048921 Bacteria 17747
540 Ga0496118_0008690 3300048921 Bacteria 10439
541 Ga0496118_0013404 3300048921 Bacteria 7757
542 Ga0496118_0030949 3300048921 Bacteria 4451
543 Ga0496118_0082993 3300048921 Bacteria 2242
544 Ga0496118_0210304 3300048921 Bacteria 1142
545 Ga0496118_0327660 3300048921 Bacteria 827
546 Ga0496119_0000001 3300048922 Bacteria 789520
547 Ga0496119_0013230 3300048922 Bacteria 6596
548 Ga0496120_0009249 3300048923 Bacteria 7016
549 Ga0496120_0009823 3300048923 Bacteria 6741
550 Ga0496121_0000047 3300048924 Bacteria 335768
551 Ga0496121_0062905 3300048924 Bacteria 3036
552 Ga0496121_0099903 3300048924 Bacteria 2241
553 Ga0496121_0152023 3300048924 Bacteria 1702
554 Ga0496122_0000187 3300048925 Bacteria 143921
555 Ga0496122_0037239 3300048925 Bacteria 3919
556 Ga0496122_0124159 3300048925 Bacteria 1657
557 Ga0496122_0204341 3300048925 Bacteria 1151
558 Ga0496122_0290248 3300048925 Bacteria 888
559 Ga0496123_0000095 3300048926 Bacteria 176621
560 Ga0496123_0053644 3300048926 Bacteria 2662
561 Ga0496123_0063824 3300048926 Bacteria 2350
562 Ga0496123_0069528 3300048926 Bacteria 2210
563 Ga0496123_0182713 3300048926 Bacteria 1093
564 Ga0496124_0000059 3300048927 Bacteria 241949
565 Ga0496124_0013609 3300048927 Bacteria 7933
566 Ga0496124_0015989 3300048927 Bacteria 7161
567 Ga0496124_0253352 3300048927 Bacteria 1300
568 Ga0496124_0406287 3300048927 Bacteria 943
569 Ga0496125_0006597 3300048928 Bacteria 12494
570 Ga0496125_0044951 3300048928 Bacteria 3725
571 Ga0496125_0171191 3300048928 Bacteria 1459
572 Ga0496125_0185694 3300048928 Bacteria 1379
573 Ga0496125_0344219 3300048928 Bacteria 893
574 Ga0496126_0137656 3300048929 Bacteria 2104
575 Ga0496126_0329247 3300048929 Bacteria 1254
576 Ga0501305_060648 3300049161 Bacteria 650
577 Ga0495678_131438 3300049459 Bacteria 829
578 Ga0501034_0396206 3300049571 Bacteria 1304
579 Ga0501249_004596 3300049679 Bacteria 2806
580 Ga0501225_0004259 3300049705 Bacteria 4276
581 Ga0501241_024631 3300049758 Bacteria 1118
582 Ga0501262_000040 3300049759 Bacteria 16997
583 nmdc:mga03683_1038_c1 3300050489 Bacteria 8096
584 nmdc:mga03683_15587_c1 3300050489 Bacteria 2839
585 nmdc:mga03683_29482_c1 3300050489 Bacteria 2189
586 nmdc:mga03683_3842_c1 3300050489 Bacteria 4905
587 nmdc:mga03683_664_c1 3300050489 Bacteria 9877
588 nmdc:mga03n38_106527_c1 3300050490 Bacteria 1359
589 nmdc:mga03n38_106850_c1 3300050490 Bacteria 1358
590 nmdc:mga03n38_113701_c1 3300050490 Bacteria 1322
591 nmdc:mga03n38_161478_c1 3300050490 Bacteria 1135
592 nmdc:mga03n38_251441_c1 3300050490 Bacteria 934
593 nmdc:mga03n38_398573_c1 3300050490 Bacteria 757
594 nmdc:mga03n38_409702_c1 3300050490 Bacteria 748
595 nmdc:mga03n38_563_c1 3300050490 Bacteria 9405
596 nmdc:mga00v17_292821_c1 3300050491 Bacteria 1057
597 nmdc:mga00v17_338008_c1 3300050491 Bacteria 979
598 nmdc:mga00v17_34675_c1 3300050491 Bacteria 2999
599 nmdc:mga00v17_59367_c1 3300050491 Bacteria 2347
600 nmdc:mga0yw44_1098109_c1 3300050492 Bacteria 537
601 nmdc:mga0yw44_261845_c1 3300050492 Bacteria 1152
602 nmdc:mga0yw44_6052_c1 3300050492 Bacteria 5798
603 nmdc:mga0k408_25998_c1 3300050493 Bacteria 3318
604 nmdc:mga0k408_305812_c1 3300050493 Bacteria 949
605 nmdc:mga0k408_34363_c1 3300050493 Bacteria 2902
606 nmdc:mga0k408_497738_c1 3300050493 Bacteria 722
607 nmdc:mga0k408_55150_c1 3300050493 Bacteria 2304
608 nmdc:mga0k408_6659_c1 3300050493 Bacteria 6160
609 nmdc:mga06z11_113195_c1 3300050494 Bacteria 1505
610 nmdc:mga06z11_118182_c1 3300050494 Bacteria 1476
611 nmdc:mga06z11_119701_c1 3300050494 Bacteria 1467
612 nmdc:mga06z11_145898_c1 3300050494 Bacteria 1341
613 nmdc:mga06z11_54072_c1 3300050494 Bacteria 2068
614 nmdc:mga04h51_145744_c1 3300050495 Bacteria 901
615 nmdc:mga07m45_170786_c1 3300050496 Bacteria 1264
616 nmdc:mga07m45_2454_c1 3300050496 Bacteria 8701
617 nmdc:mga07m45_39383_c1 3300050496 Bacteria 2641
618 nmdc:mga07m45_46544_c1 3300050496 Bacteria 2438
619 nmdc:mga07m45_63363_c1 3300050496 Bacteria 1342
620 nmdc:mga07m45_7566_c1 3300050496 Bacteria 5555
621 nmdc:mga07m45_9053_c1 3300050496 Bacteria 4675
622 nmdc:mga07m45_97194_c1 3300050496 Bacteria 1690
623 nmdc:mga07m45_99706_c1 3300050496 Bacteria 1668
624 nmdc:mga09592_1087910_c1 3300050508 Bacteria 665
625 nmdc:mga0rr50_1464662_c1 3300050513 Bacteria 577
626 nmdc:mga0sz30_136243_c1 3300050516 Bacteria 1083
627 nmdc:mga0sz30_225215_c1 3300050516 Bacteria 834
628 nmdc:mga0sz30_423384_c1 3300050516 Bacteria 597
629 nmdc:mga0sz30_5927_c3 3300050516 Bacteria 1376
630 Ga0500610_0000290 3300053079 Bacteria 15128
631 Ga0500610_0000449 3300053079 Bacteria 12704
632 Ga0500610_0022560 3300053079 Bacteria 3105
633 Ga0500643_001757 3300053087 Bacteria 11942
634 Ga0500651_0263514 3300053093 Bacteria 998
635 Ga0500566_0019631 3300053094 Bacteria 3969
636 Ga0500569_005829 3300053109 Bacteria 2667
637 Ga0500571_000027 3300053110 Bacteria 51623
638 Ga0500572_025970 3300053111 Bacteria 1593
639 Ga0500593_000151 3300053117 Bacteria 27776
640 Ga0500597_000108 3300053120 Bacteria 17172
641 Ga0500607_001110 3300053121 Bacteria 25307
642 Ga0500607_009988 3300053121 Bacteria 5686
643 Ga0500608_001585 3300053122 Bacteria 8160
644 Ga0500608_183881 3300053122 Bacteria 881
645 Ga0500608_184022 3300053122 Bacteria 881
646 Ga0500618_011263 3300053125 Bacteria 2376
647 Ga0500618_061439 3300053125 Bacteria 845
648 Ga0500655_001213 3300053133 Bacteria 4894
649 Ga0500564_017687 3300053138 Bacteria 3242
650 Ga0500574_000743 3300053141 Bacteria 4339
651 Ga0500574_081356 3300053141 Bacteria 955
652 Ga0500577_0305241 3300053142 Bacteria 695
653 Ga0500604_0149648 3300053151 Bacteria 792
654 Ga0500616_0002193 3300053153 Bacteria 16809
655 Ga0500627_0000252 3300053158 Bacteria 15244
656 Ga0500633_0136063 3300053160 Bacteria 918
657 Ga0500634_0011820 3300053161 Bacteria 4522
658 Ga0500638_001050 3300053162 Bacteria 8080
659 Ga0500636_0002403 3300053177 Bacteria 10364
660 Ga0500625_098324 3300053729 Bacteria 1233
661 Ga0587109_151348 3300059624 Bacteria 574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050490 nmdc:mga03n38_161478_c1 nmdc:mga03n38_161478_c1_11_352 94
2 3300048921 Ga0496118_0013404 Ga0496118_0013404_42_371 97
3 3300048921 Ga0496118_0082993 Ga0496118_0082993_1872_2201 97
4 3300045051 Ga0451576_0667834 Ga0451576_0667834_123_518 101
5 3300025919 Ga0207657_10269001 Ga0207657_102690012 102
6 3300028380 Ga0268265_10019139 Ga0268265_100191391 104
7 3300005330 Ga0070690_100972555 Ga0070690_1009725552 105
8 3300005843 Ga0068860_100422028 Ga0068860_1004220283 105
9 3300028381 Ga0268264_11285204 Ga0268264_112852041 105
10 3300006852 Ga0075433_10499826 Ga0075433_104998262 106
11 3300035692 Ga0373935_0078306 Ga0373935_0078306_1298_1687 106
12 3300035695 Ga0373927_0021040 Ga0373927_0021040_470_859 106
13 3300037068 Ga0373925_0037461 Ga0373925_0037461_338_727 106
14 3300050508 nmdc:mga09592_1087910_c1 nmdc:mga09592_1087910_c1_259_651 106
15 3300006195 Ga0075366_10525475 Ga0075366_105254752 108
16 3300042007 Ga0439449_0162031 Ga0439449_0162031_197_595 108
17 3300048905 Ga0496102_0633938 Ga0496102_0633938_116_511 108
18 3300050493 nmdc:mga0k408_497738_c1 nmdc:mga0k408_497738_c1_71_466 108
19 3300003323 rootH1_10257612 rootH1_102576122 109
20 3300030731 Ga0316177_1080122 Ga0316177_10801224 109
21 3300030733 Ga0314311_1024461 Ga0314311_10244615 109
22 3300030734 Ga0316179_1114146 Ga0316179_11141464 109
23 3300030735 Ga0316178_1088360 Ga0316178_10883602 109
24 3300030736 Ga0316180_1109260 Ga0316180_11092603 109
25 3300030742 Ga0316183_1144523 Ga0316183_11445235 109
26 3300030744 Ga0316181_1062975 Ga0316181_10629754 109
27 3300030745 Ga0316182_1202305 Ga0316182_12023055 109
28 3300031548 Ga0307408_100110525 Ga0307408_1001105252 109
29 3300031548 Ga0307408_100978801 Ga0307408_1009788012 109
30 3300031731 Ga0307405_10020011 Ga0307405_100200111 109
31 3300031824 Ga0307413_10332166 Ga0307413_103321662 109
32 3300031852 Ga0307410_10984220 Ga0307410_109842202 109
33 3300031901 Ga0307406_11185897 Ga0307406_111858972 109
34 3300031903 Ga0307407_10211599 Ga0307407_102115992 109
35 3300031911 Ga0307412_10448298 Ga0307412_104482982 109
36 3300032002 Ga0307416_101461355 Ga0307416_1014613552 109
37 3300042004 Ga0439445_0068078 Ga0439445_0068078_134_529 109
38 3300049679 Ga0501249_004596 Ga0501249_004596_1824_2219 109
39 3300049705 Ga0501225_0004259 Ga0501225_0004259_2830_3225 109
40 3300041408 Ga0439453_0071743 Ga0439453_0071743_350_724 110
41 3300045051 Ga0451576_1511817 Ga0451576_1511817_185_580 110
42 3300050489 nmdc:mga03683_15587_c1 nmdc:mga03683_15587_c1_2071_2445 110
43 3300050490 nmdc:mga03n38_113701_c1 nmdc:mga03n38_113701_c1_344_718 110
44 3300001989 JGI24739J22299_10005292 JGI24739J22299_100052924 111
45 3300003187 JGI25151J46595_10003022 JGI25151J46595_100030222 111
46 3300006051 Ga0075364_10407777 Ga0075364_104077772 111
47 3300006186 Ga0075369_10192560 Ga0075369_101925602 111
48 3300006353 Ga0075370_10002472 Ga0075370_100024727 111
49 3300013100 Ga0157373_10004058 Ga0157373_100040583 111
50 3300015261 Ga0182006_1009770 Ga0182006_10097704 111
51 3300015261 Ga0182006_1073282 Ga0182006_10732822 111
52 3300025294 Ga0209025_1000940 Ga0209025_10009407 111
53 3300031548 Ga0307408_100104044 Ga0307408_1001040441 111
54 3300031911 Ga0307412_10224712 Ga0307412_102247122 111
55 3300049758 Ga0501241_024631 Ga0501241_024631_176_571 111
56 3300049759 Ga0501262_000040 Ga0501262_000040_8165_8560 111
57 3300050491 nmdc:mga00v17_292821_c1 nmdc:mga00v17_292821_c1_352_738 111
58 3300050516 nmdc:mga0sz30_136243_c1 nmdc:mga0sz30_136243_c1_234_620 111
59 3300053122 Ga0500608_183881 Ga0500608_183881_263_658 111
60 3300006048 Ga0075363_100013928 Ga0075363_1000139284 112
61 3300006178 Ga0075367_10019854 Ga0075367_100198542 112
62 3300006195 Ga0075366_10003574 Ga0075366_100035747 112
63 3300006353 Ga0075370_10024484 Ga0075370_100244842 112
64 3300017792 Ga0163161_11052533 Ga0163161_110525332 112
65 3300028794 Ga0307515_10000248 Ga0307515_1000024843 112
66 3300031456 Ga0307513_10094668 Ga0307513_100946683 112
67 3300049571 Ga0501034_0396206 Ga0501034_0396206_122_517 112
68 3300050493 nmdc:mga0k408_55150_c1 nmdc:mga0k408_55150_c1_933_1328 112
69 3300050494 nmdc:mga06z11_113195_c1 nmdc:mga06z11_113195_c1_495_890 112
70 3300050496 nmdc:mga07m45_46544_c1 nmdc:mga07m45_46544_c1_514_909 112
71 3300045049 Ga0466959_0452865 Ga0466959_0452865_33_422 113
72 3300003322 rootL2_10045172 rootL2_100451722 114
73 3300006353 Ga0075370_10339624 Ga0075370_103396242 114
74 3300031548 Ga0307408_101181555 Ga0307408_1011815552 114
75 3300032002 Ga0307416_100538886 Ga0307416_1005388862 114
76 3300032004 Ga0307414_11270290 Ga0307414_112702902 114
77 3300032005 Ga0307411_10003882 Ga0307411_100038826 114
78 3300042876 Ga0451577_1078261 Ga0451577_1078261_187_579 114
79 3300044683 Ga0466965_0187328 Ga0466965_0187328_476_877 114
80 3300044712 Ga0453684_0987953 Ga0453684_0987953_28_420 114
81 3300044901 Ga0466960_0049327 Ga0466960_0049327_452_853 114
82 3300045051 Ga0451576_1045981 Ga0451576_1045981_360_761 114
83 3300059624 Ga0587109_151348 Ga0587109_151348_148_540 114
84 iso_pu_bacteria 2508501071 2508854148 114
85 iso_pu_bacteria 2513020051 2513228012 114
86 iso_pu_bacteria 2547132181 2547695655 114
87 iso_pu_bacteria 2561511199 2562462322 114
88 iso_pu_bacteria 2599185214 2599622060 114
89 iso_pu_bacteria 2599185226 2599677040 114
90 iso_pu_bacteria 2599185227 2599680533 114
91 iso_pu_bacteria 2599185229 2599692549 114
92 iso_pu_bacteria 2600255256 2601533494 114
93 iso_pu_bacteria 2600255257 2601542161 114
94 iso_pu_bacteria 2600255310 2601760508 114
95 iso_pu_bacteria 2600255311 2601765890 114
96 iso_pu_bacteria 2602042109 2603866841 114
97 iso_pu_bacteria 2608642108 2608669170 114
98 iso_pu_bacteria 2609459761 2609910497 114
99 iso_pu_bacteria 2643221628 2644161097 114
100 iso_pu_bacteria 2643221658 2644326293 114
101 iso_pu_bacteria 2643221672 2644399396 114
102 iso_pu_bacteria 2643221683 2644469669 114
103 iso_pu_bacteria 2648501693 2650897659 114
104 iso_pu_bacteria 2684622997 2686353866 114
105 iso_pu_bacteria 2738541277 2738723629 114
106 iso_pu_bacteria 2738541307 2738886023 114
107 iso_pu_bacteria 2738543019 2739284360 114
108 iso_pu_bacteria 2772190666 2772439580 114
109 iso_pu_bacteria 2791355010 2792310662 114
110 iso_pu_bacteria 2806310673 2807180185 114
111 iso_pu_bacteria 2808606414 2809128068 114
112 iso_pu_bacteria 2814123068 2814695983 114
113 iso_pu_bacteria 2818991446 2819598836 114
114 iso_pu_bacteria 2831265667 2831269401 114
115 iso_pu_bacteria 2838054893 2838058658 114
116 iso_pu_bacteria 2842677519 2842682149 114
117 iso_pu_bacteria 2844528606 2844530668 114
118 iso_pu_bacteria 2871282230 2871284803 114
119 iso_pu_bacteria 2885198086 2885202640 114
120 iso_pu_bacteria 2885211737 2885216293 114
121 iso_pu_bacteria 2888366609 2888369646 114
122 iso_pu_bacteria 2888373701 2888375842 114
123 iso_pu_bacteria 2894772417 2894777223 114
124 iso_pu_bacteria 2899924645 2899929653 114
125 iso_pu_bacteria 2904449895 2904455612 114
126 iso_pu_bacteria 2904456579 2904462223 114
127 iso_pu_bacteria 2904541872 2904545475 114
128 iso_pu_bacteria 2904541872 2904545802 114
129 iso_pu_bacteria 2919462493 2919464748 114
130 iso_pu_bacteria 2928037797 2928042407 114
131 iso_pu_bacteria 2928044640 2928048432 114
132 iso_pu_bacteria 2928051484 2928054757 114
133 iso_pu_bacteria 2928064002 2928068176 114
134 iso_pu_bacteria 2928070936 2928073951 114
135 iso_pu_bacteria 2928084124 2928086246 114
136 iso_pu_bacteria 2928115317 2928121138 114
137 iso_pu_bacteria 2929160207 2929160988 114
138 iso_pu_bacteria 2929160207 2929168113 114
139 iso_pu_bacteria 2929520902 2929526803 114
140 iso_pu_bacteria 2935625433 2935626319 114
141 iso_pu_bacteria 2937967321 2937968217 114
142 iso_pu_bacteria 2939617950 2939617992 114
143 iso_pu_bacteria 2945909444 2945915832 114
144 iso_pu_bacteria 2945945610 2945950186 114
145 iso_pu_bacteria 2945972063 2945975169 114
146 iso_pu_bacteria 2945984333 2945988734 114
147 iso_pu_bacteria 2954767861 2954770349 114
148 iso_pu_bacteria 2974435778 2974438769 114
149 iso_pu_bacteria 2984494565 2984497172 114
150 iso_pu_bacteria 2990261002 2990261126 114
151 iso_pu_bacteria 640753048 640939748 114
152 iso_pu_bacteria 8004592986 8004596777 114
153 iso_pu_bacteria 8015394850 8015398549 114
154 iso_pu_bacteria 8019504834 8019505671 114
155 3300005548 Ga0070665_100141805 Ga0070665_1001418052 115
156 3300005563 Ga0068855_100423369 Ga0068855_1004233692 115
157 3300005843 Ga0068860_100795382 Ga0068860_1007953822 115
158 3300009545 Ga0105237_12609380 Ga0105237_126093801 115
159 3300028379 Ga0268266_10108918 Ga0268266_101089182 115
160 3300031250 Ga0265331_10202271 Ga0265331_102022712 115
161 3300031548 Ga0307408_100107778 Ga0307408_1001077783 115
162 3300031901 Ga0307406_11521298 Ga0307406_115212981 115
163 3300031911 Ga0307412_10074808 Ga0307412_100748081 115
164 3300031911 Ga0307412_10131073 Ga0307412_101310732 115
165 3300032004 Ga0307414_11857988 Ga0307414_118579881 115
166 3300039437 Ga0436365_1617030 Ga0436365_1617030_103_495 115
167 3300039447 Ga0436361_0360914 Ga0436361_0360914_244_633 115
168 3300041997 Ga0439431_0017369 Ga0439431_0017369_220_612 115
169 3300042004 Ga0439445_0146990 Ga0439445_0146990_210_602 115
170 3300042435 Ga0439434_0055824 Ga0439434_0055824_240_632 115
171 3300042532 Ga0450893_0085620 Ga0450893_0085620_143_535 115
172 3300044901 Ga0466960_0567152 Ga0466960_0567152_205_597 115
173 3300045049 Ga0466959_0301921 Ga0466959_0301921_28_417 115
174 3300045051 Ga0451576_0968397 Ga0451576_0968397_251_646 115
175 3300050513 nmdc:mga0rr50_1464662_c1 nmdc:mga0rr50_1464662_c1_137_529 115
176 3300053122 Ga0500608_184022 Ga0500608_184022_149_538 115
177 3300006195 Ga0075366_10008724 Ga0075366_100087243 116
178 3300038742 Ga0400486_24404 Ga0400486_24404_275_676 116
179 3300050493 nmdc:mga0k408_6659_c1 nmdc:mga0k408_6659_c1_1627_2025 116
180 3300001979 JGI24740J21852_10002188 JGI24740J21852_100021883 117
181 3300001989 JGI24739J22299_10006490 JGI24739J22299_100064902 117
182 3300002067 JGI24735J21928_10124133 JGI24735J21928_101241331 117
183 3300002739 JGI25158J39367_1003338 JGI25158J39367_10033382 117
184 3300002739 JGI25158J39367_1003485 JGI25158J39367_10034852 117
185 3300002773 JGI25152J39213_1000801 JGI25152J39213_10008015 117
186 3300002773 JGI25152J39213_1002698 JGI25152J39213_10026982 117
187 3300002774 JGI25150J39212_1000532 JGI25150J39212_10005324 117
188 3300002774 JGI25150J39212_1012136 JGI25150J39212_10121361 117
189 3300002987 JGI25159J45721_1000759 JGI25159J45721_100075910 117
190 3300002987 JGI25159J45721_1010112 JGI25159J45721_10101122 117
191 3300003187 JGI25151J46595_10000859 JGI25151J46595_100008594 117
192 3300003187 JGI25151J46595_10005615 JGI25151J46595_100056152 117
193 3300003187 JGI25151J46595_10019187 JGI25151J46595_100191872 117
194 3300003215 JGI25153J46596_10004703 JGI25153J46596_100047035 117
195 3300003215 JGI25153J46596_10016032 JGI25153J46596_100160322 117
196 3300003320 rootH2_10005335 rootH2_100053352 117
197 3300003322 rootL2_10095266 rootL2_100952661 117
198 3300003323 rootH1_10008528 rootH1_100085282 117
199 3300003354 JGI25160J50197_1003270 JGI25160J50197_10032705 117
200 3300003354 JGI25160J50197_1017164 JGI25160J50197_10171642 117
201 3300003374 JGI25161J50226_1001055 JGI25161J50226_10010555 117
202 3300003374 JGI25161J50226_1001654 JGI25161J50226_10016544 117
203 3300003771 Ga0055526_1005451 Ga0055526_10054512 117
204 3300003771 Ga0055526_1006343 Ga0055526_10063434 117
205 3300003773 Ga0055537_1000230 Ga0055537_10002306 117
206 3300003773 Ga0055537_1002342 Ga0055537_10023422 117
207 3300003773 Ga0055537_1008517 Ga0055537_10085172 117
208 3300003775 Ga0055524_1003704 Ga0055524_10037045 117
209 3300003775 Ga0055524_1004507 Ga0055524_10045074 117
210 3300003781 Ga0055536_1005261 Ga0055536_10052615 117
211 3300003784 Ga0055534_1000151 Ga0055534_100015118 117
212 3300003784 Ga0055534_1000782 Ga0055534_100078210 117
213 3300003784 Ga0055534_1005353 Ga0055534_10053533 117
214 3300003790 Ga0055528_1000165 Ga0055528_100016518 117
215 3300003790 Ga0055528_1004775 Ga0055528_10047752 117
216 3300003790 Ga0055528_1018489 Ga0055528_10184892 117
217 3300003791 Ga0055530_10005244 Ga0055530_100052444 117
218 3300003791 Ga0055530_10045596 Ga0055530_100455962 117
219 3300003792 Ga0055540_1002400 Ga0055540_10024006 117
220 3300003792 Ga0055540_1006632 Ga0055540_10066324 117
221 3300003794 Ga0055531_10002480 Ga0055531_100024804 117
222 3300004625 Ga0055543_1000654 Ga0055543_10006546 117
223 3300004625 Ga0055543_1015739 Ga0055543_10157393 117
224 3300005262 Ga0065165_1004213 Ga0065165_10042132 117
225 3300005262 Ga0065165_1022760 Ga0065165_10227602 117
226 3300005288 Ga0065714_10067058 Ga0065714_100670584 117
227 3300005289 Ga0065704_10220664 Ga0065704_102206642 117
228 3300005334 Ga0068869_100343138 Ga0068869_1003431382 117
229 3300005334 Ga0068869_101960968 Ga0068869_1019609681 117
230 3300005344 Ga0070661_100086019 Ga0070661_1000860193 117
231 3300005366 Ga0070659_100047218 Ga0070659_1000472181 117
232 3300005456 Ga0070678_101334865 Ga0070678_1013348651 117
233 3300005457 Ga0070662_100024895 Ga0070662_1000248952 117
234 3300005459 Ga0068867_100519729 Ga0068867_1005197292 117
235 3300005539 Ga0068853_100025162 Ga0068853_1000251622 117
236 3300005539 Ga0068853_100089631 Ga0068853_1000896312 117
237 3300005564 Ga0070664_100004285 Ga0070664_1000042853 117
238 3300005577 Ga0068857_100063086 Ga0068857_1000630861 117
239 3300005578 Ga0068854_100076878 Ga0068854_1000768783 117
240 3300005578 Ga0068854_100558972 Ga0068854_1005589722 117
241 3300005616 Ga0068852_100012470 Ga0068852_1000124702 117
242 3300005616 Ga0068852_100180619 Ga0068852_1001806193 117
243 3300005618 Ga0068864_102379652 Ga0068864_1023796521 117
244 3300006048 Ga0075363_100003776 Ga0075363_1000037762 117
245 3300006048 Ga0075363_100056093 Ga0075363_1000560932 117
246 3300006048 Ga0075363_100073625 Ga0075363_1000736252 117
247 3300006048 Ga0075363_100095383 Ga0075363_1000953832 117
248 3300006048 Ga0075363_100128242 Ga0075363_1001282422 117
249 3300006051 Ga0075364_10042596 Ga0075364_100425962 117
250 3300006051 Ga0075364_10071118 Ga0075364_100711183 117
251 3300006058 Ga0075432_10005947 Ga0075432_100059474 117
252 3300006058 Ga0075432_10180735 Ga0075432_101807351 117
253 3300006177 Ga0075362_10001382 Ga0075362_100013821 117
254 3300006177 Ga0075362_10005957 Ga0075362_100059572 117
255 3300006177 Ga0075362_10052036 Ga0075362_100520362 117
256 3300006178 Ga0075367_10449490 Ga0075367_104494902 117
257 3300006178 Ga0075367_10546353 Ga0075367_105463532 117
258 3300006186 Ga0075369_10081114 Ga0075369_100811142 117
259 3300006186 Ga0075369_10097735 Ga0075369_100977352 117
260 3300006186 Ga0075369_10598765 Ga0075369_105987651 117
261 3300006195 Ga0075366_10114734 Ga0075366_101147342 117
262 3300006195 Ga0075366_10165507 Ga0075366_101655073 117
263 3300006237 Ga0097621_100160169 Ga0097621_1001601692 117
264 3300006353 Ga0075370_10000992 Ga0075370_1000099210 117
265 3300006353 Ga0075370_10001546 Ga0075370_100015462 117
266 3300006353 Ga0075370_10014361 Ga0075370_100143612 117
267 3300006353 Ga0075370_10080271 Ga0075370_100802712 117
268 3300006353 Ga0075370_10128403 Ga0075370_101284032 117
269 3300006353 Ga0075370_10408668 Ga0075370_104086681 117
270 3300006358 Ga0068871_100060058 Ga0068871_1000600583 117
271 3300006946 Ga0079104_1027682 Ga0079104_10276822 117
272 3300006948 Ga0099826_10002026 Ga0099826_100020264 117
273 3300006948 Ga0099826_10293551 Ga0099826_102935512 117
274 3300009036 Ga0105244_10004138 Ga0105244_100041382 117
275 3300009036 Ga0105244_10031627 Ga0105244_100316274 117
276 3300009093 Ga0105240_10079264 Ga0105240_100792642 117
277 3300009093 Ga0105240_10090554 Ga0105240_100905542 117
278 3300009148 Ga0105243_10002996 Ga0105243_100029966 117
279 3300009148 Ga0105243_10003562 Ga0105243_100035623 117
280 3300009148 Ga0105243_10017196 Ga0105243_100171964 117
281 3300009148 Ga0105243_10106697 Ga0105243_101066973 117
282 3300009174 Ga0105241_10823842 Ga0105241_108238422 117
283 3300009176 Ga0105242_10499946 Ga0105242_104999462 117
284 3300009545 Ga0105237_10111668 Ga0105237_101116684 117
285 3300009551 Ga0105238_10074524 Ga0105238_100745244 117
286 3300009551 Ga0105238_10086218 Ga0105238_100862182 117
287 3300010375 Ga0105239_10033028 Ga0105239_100330284 117
288 3300010375 Ga0105239_10076528 Ga0105239_100765284 117
289 3300011119 Ga0105246_10003441 Ga0105246_100034416 117
290 3300011119 Ga0105246_10009103 Ga0105246_100091033 117
291 3300013100 Ga0157373_10375760 Ga0157373_103757602 117
292 3300013104 Ga0157370_10794398 Ga0157370_107943982 117
293 3300013105 Ga0157369_10049558 Ga0157369_100495583 117
294 3300014497 Ga0182008_10008714 Ga0182008_100087142 117
295 3300014497 Ga0182008_10014691 Ga0182008_100146912 117
296 3300014497 Ga0182008_10022869 Ga0182008_100228693 117
297 3300015261 Ga0182006_1001207 Ga0182006_10012074 117
298 3300015261 Ga0182006_1036623 Ga0182006_10366232 117
299 3300015261 Ga0182006_1119548 Ga0182006_11195482 117
300 3300015261 Ga0182006_1175023 Ga0182006_11750232 117
301 3300015262 Ga0182007_10000297 Ga0182007_1000029722 117
302 3300015262 Ga0182007_10035581 Ga0182007_100355812 117
303 3300017792 Ga0163161_10000165 Ga0163161_100001655 117
304 3300017792 Ga0163161_10003662 Ga0163161_100036624 117
305 3300025245 Ga0207425_1000487 Ga0207425_100048720 117
306 3300025245 Ga0207425_1002703 Ga0207425_10027035 117
307 3300025258 Ga0209129_1000277 Ga0209129_100027749 117
308 3300025258 Ga0209129_1002214 Ga0209129_10022142 117
309 3300025258 Ga0209129_1003230 Ga0209129_10032305 117
310 3300025263 Ga0209565_1000070 Ga0209565_100007042 117
311 3300025263 Ga0209565_1000189 Ga0209565_100018914 117
312 3300025263 Ga0209565_1001494 Ga0209565_10014946 117
313 3300025273 Ga0209673_1000264 Ga0209673_100026437 117
314 3300025273 Ga0209673_1000266 Ga0209673_100026671 117
315 3300025273 Ga0209673_1000518 Ga0209673_100051820 117
316 3300025284 Ga0209130_1000294 Ga0209130_10002949 117
317 3300025284 Ga0209130_1000478 Ga0209130_100047818 117
318 3300025291 Ga0209675_1000069 Ga0209675_100006942 117
319 3300025291 Ga0209675_1000278 Ga0209675_100027849 117
320 3300025291 Ga0209675_1001780 Ga0209675_10017804 117
321 3300025291 Ga0209675_1002756 Ga0209675_10027562 117
322 3300025292 Ga0209676_1000195 Ga0209676_100019572 117
323 3300025292 Ga0209676_1000361 Ga0209676_100036150 117
324 3300025292 Ga0209676_1001614 Ga0209676_10016145 117
325 3300025292 Ga0209676_1002319 Ga0209676_100231910 117
326 3300025294 Ga0209025_1000319 Ga0209025_10003195 117
327 3300025294 Ga0209025_1000526 Ga0209025_100052649 117
328 3300025294 Ga0209025_1004022 Ga0209025_10040226 117
329 3300025294 Ga0209025_1032016 Ga0209025_10320162 117
330 3300025294 Ga0209025_1050668 Ga0209025_10506682 117
331 3300025295 Ga0209564_1000101 Ga0209564_1000101152 117
332 3300025295 Ga0209564_1000156 Ga0209564_100015620 117
333 3300025297 Ga0209758_1000127 Ga0209758_100012749 117
334 3300025297 Ga0209758_1008911 Ga0209758_10089115 117
335 3300025298 Ga0209050_1000021 Ga0209050_1000021463 117
336 3300025298 Ga0209050_1012775 Ga0209050_10127754 117
337 3300025298 Ga0209050_1039313 Ga0209050_10393131 117
338 3300025299 Ga0209256_1000104 Ga0209256_100010449 117
339 3300025299 Ga0209256_1000137 Ga0209256_100013743 117
340 3300025302 Ga0207426_1000149 Ga0207426_100014949 117
341 3300025302 Ga0207426_1000398 Ga0207426_100039845 117
342 3300025302 Ga0207426_1051737 Ga0207426_10517372 117
343 3300025303 Ga0209051_1000028 Ga0209051_100002849 117
344 3300025303 Ga0209051_1000184 Ga0209051_100018472 117
345 3300025303 Ga0209051_1000607 Ga0209051_10006076 117
346 3300025303 Ga0209051_1012172 Ga0209051_10121724 117
347 3300025304 Ga0209257_1001918 Ga0209257_10019185 117
348 3300025304 Ga0209257_1003866 Ga0209257_10038662 117
349 3300025304 Ga0209257_1007641 Ga0209257_10076412 117
350 3300025304 Ga0209257_1093511 Ga0209257_10935112 117
351 3300025728 Ga0207655_1001349 Ga0207655_10013492 117
352 3300025913 Ga0207695_10068719 Ga0207695_100687194 117
353 3300025913 Ga0207695_10293723 Ga0207695_102937232 117
354 3300025914 Ga0207671_10370887 Ga0207671_103708872 117
355 3300025920 Ga0207649_10054698 Ga0207649_100546982 117
356 3300025932 Ga0207690_10873445 Ga0207690_108734452 117
357 3300025933 Ga0207706_10008854 Ga0207706_100088546 117
358 3300025935 Ga0207709_10000448 Ga0207709_1000044822 117
359 3300025935 Ga0207709_10001264 Ga0207709_100012649 117
360 3300025935 Ga0207709_10001311 Ga0207709_1000131113 117
361 3300025935 Ga0207709_10937012 Ga0207709_109370121 117
362 3300025945 Ga0207679_10098890 Ga0207679_100988902 117
363 3300025949 Ga0207667_10092374 Ga0207667_100923743 117
364 3300025981 Ga0207640_10585466 Ga0207640_105854662 117
365 3300026041 Ga0207639_10033919 Ga0207639_100339193 117
366 3300026089 Ga0207648_10381923 Ga0207648_103819232 117
367 3300026116 Ga0207674_10024032 Ga0207674_100240325 117
368 3300026121 Ga0207683_11287712 Ga0207683_112877122 117
369 3300026142 Ga0207698_10921680 Ga0207698_109216802 117
370 3300027111 Ga0209281_1053128 Ga0209281_10531281 117
371 3300027666 Ga0209282_1001406 Ga0209282_10014066 117
372 3300030745 Ga0316182_1103192 Ga0316182_11031921 117
373 3300031250 Ga0265331_10200415 Ga0265331_102004152 117
374 3300031456 Ga0307513_10693865 Ga0307513_106938652 117
375 3300031548 Ga0307408_100026269 Ga0307408_1000262692 117
376 3300031548 Ga0307408_100126577 Ga0307408_1001265773 117
377 3300031548 Ga0307408_100324800 Ga0307408_1003248003 117
378 3300031548 Ga0307408_101670435 Ga0307408_1016704351 117
379 3300031649 Ga0307514_10004610 Ga0307514_100046104 117
380 3300031731 Ga0307405_10016497 Ga0307405_100164974 117
381 3300031731 Ga0307405_11100829 Ga0307405_111008291 117
382 3300031824 Ga0307413_10286699 Ga0307413_102866992 117
383 3300031824 Ga0307413_10656907 Ga0307413_106569072 117
384 3300031852 Ga0307410_10201252 Ga0307410_102012522 117
385 3300031901 Ga0307406_10000184 Ga0307406_1000018413 117
386 3300031901 Ga0307406_10042339 Ga0307406_100423394 117
387 3300031901 Ga0307406_10732642 Ga0307406_107326422 117
388 3300031901 Ga0307406_11213179 Ga0307406_112131792 117
389 3300031903 Ga0307407_10098031 Ga0307407_100980313 117
390 3300031911 Ga0307412_10015797 Ga0307412_100157974 117
391 3300031911 Ga0307412_10034033 Ga0307412_100340334 117
392 3300031911 Ga0307412_10059800 Ga0307412_100598002 117
393 3300031911 Ga0307412_10147862 Ga0307412_101478623 117
394 3300031911 Ga0307412_10213949 Ga0307412_102139492 117
395 3300031911 Ga0307412_10368905 Ga0307412_103689052 117
396 3300031911 Ga0307412_11518185 Ga0307412_115181851 117
397 3300031911 Ga0307412_11625908 Ga0307412_116259081 117
398 3300031995 Ga0307409_100420214 Ga0307409_1004202142 117
399 3300032002 Ga0307416_100002576 Ga0307416_1000025766 117
400 3300032002 Ga0307416_100021154 Ga0307416_1000211542 117
401 3300032004 Ga0307414_10690028 Ga0307414_106900282 117
402 3300032004 Ga0307414_11157231 Ga0307414_111572312 117
403 3300032005 Ga0307411_10067211 Ga0307411_100672112 117
404 3300032005 Ga0307411_10069504 Ga0307411_100695042 117
405 3300032005 Ga0307411_10344299 Ga0307411_103442992 117
406 3300032126 Ga0307415_102459406 Ga0307415_1024594061 117
407 3300041404 Ga0439436_0002127 Ga0439436_0002127_4254_4649 117
408 3300041404 Ga0439436_0034250 Ga0439436_0034250_626_1021 117
409 3300041406 Ga0439439_0004230 Ga0439439_0004230_1776_2171 117
410 3300041410 Ga0439461_0131537 Ga0439461_0131537_85_480 117
411 3300041411 Ga0439466_0022898 Ga0439466_0022898_983_1378 117
412 3300041411 Ga0439466_0030491 Ga0439466_0030491_627_1022 117
413 3300041413 Ga0439465_0003257 Ga0439465_0003257_4192_4587 117
414 3300041443 Ga0451789_0252313 Ga0451789_0252313_384_779 117
415 3300041456 Ga0451795_0605217 Ga0451795_0605217_42_437 117
416 3300041458 Ga0451798_0655303 Ga0451798_0655303_94_489 117
417 3300041460 Ga0451802_0418642 Ga0451802_0418642_16_411 117
418 3300041460 Ga0451802_0736358 Ga0451802_0736358_243_638 117
419 3300041997 Ga0439431_0015299 Ga0439431_0015299_668_1063 117
420 3300041999 Ga0439433_0087054 Ga0439433_0087054_102_497 117
421 3300042002 Ga0439442_002357 Ga0439442_002357_2189_2584 117
422 3300042002 Ga0439442_018744 Ga0439442_018744_172_567 117
423 3300042002 Ga0439442_076473 Ga0439442_076473_289_684 117
424 3300042006 Ga0439432_001168 Ga0439432_001168_6093_6488 117
425 3300042007 Ga0439449_0025670 Ga0439449_0025670_58_453 117
426 3300042010 Ga0439452_004115 Ga0439452_004115_3806_4201 117
427 3300042015 Ga0439462_0009778 Ga0439462_0009778_1259_1654 117
428 3300042121 Ga0450919_002221 Ga0450919_002221_242_637 117
429 3300042122 Ga0450920_011307 Ga0450920_011307_447_842 117
430 3300042125 Ga0450923_000124 Ga0450923_000124_4385_4780 117
431 3300042125 Ga0450923_033872 Ga0450923_033872_318_713 117
432 3300042131 Ga0450894_005284 Ga0450894_005284_1198_1593 117
433 3300042134 Ga0450898_020769 Ga0450898_020769_465_860 117
434 3300042145 Ga0450906_001490 Ga0450906_001490_620_1015 117
435 3300042145 Ga0450906_072180 Ga0450906_072180_110_505 117
436 3300042147 Ga0450910_000485 Ga0450910_000485_302_697 117
437 3300042147 Ga0450910_027141 Ga0450910_027141_420_815 117
438 3300042156 Ga0439446_0183066 Ga0439446_0183066_230_625 117
439 3300042184 Ga0450908_001612 Ga0450908_001612_514_909 117
440 3300042185 Ga0450909_005059 Ga0450909_005059_350_745 117
441 3300042185 Ga0450909_006409 Ga0450909_006409_809_1204 117
442 3300042435 Ga0439434_0002289 Ga0439434_0002289_3997_4392 117
443 3300042435 Ga0439434_0153761 Ga0439434_0153761_161_556 117
444 3300042531 Ga0450918_000234 Ga0450918_000234_5050_5445 117
445 3300042531 Ga0450918_008679 Ga0450918_008679_764_1159 117
446 3300044901 Ga0466960_0349684 Ga0466960_0349684_49_438 117
447 3300046453 Ga0495627_001148 Ga0495627_001148_10985_11380 117
448 3300046453 Ga0495627_030780 Ga0495627_030780_32_427 117
449 3300046507 Ga0495606_0072348 Ga0495606_0072348_725_1120 117
450 3300046515 Ga0495620_0052570 Ga0495620_0052570_751_1146 117
451 3300046530 Ga0495654_0325751 Ga0495654_0325751_58_453 117
452 3300046558 Ga0495633_0374138 Ga0495633_0374138_11_406 117
453 3300046660 Ga0495625_0124711 Ga0495625_0124711_1051_1446 117
454 3300046660 Ga0495625_0210523 Ga0495625_0210523_582_977 117
455 3300046665 Ga0495661_0160598 Ga0495661_0160598_669_1064 117
456 3300046674 Ga0495588_0030334 Ga0495588_0030334_1695_2090 117
457 3300046674 Ga0495588_0226162 Ga0495588_0226162_273_668 117
458 3300046691 Ga0495670_0127735 Ga0495670_0127735_617_1012 117
459 3300046692 Ga0495671_0006902 Ga0495671_0006902_5148_5543 117
460 3300046810 Ga0495660_0265223 Ga0495660_0265223_170_565 117
461 3300048903 Ga0496100_0044470 Ga0496100_0044470_1593_1988 117
462 3300048904 Ga0496101_0031684 Ga0496101_0031684_587_982 117
463 3300048905 Ga0496102_0255991 Ga0496102_0255991_920_1315 117
464 3300048919 Ga0496116_0028398 Ga0496116_0028398_302_697 117
465 3300048920 Ga0496117_0008279 Ga0496117_0008279_5222_5617 117
466 3300048920 Ga0496117_0008732 Ga0496117_0008732_3129_3524 117
467 3300048920 Ga0496117_0047007 Ga0496117_0047007_2069_2464 117
468 3300048921 Ga0496118_0004060 Ga0496118_0004060_13651_14046 117
469 3300048921 Ga0496118_0008690 Ga0496118_0008690_2259_2654 117
470 3300048921 Ga0496118_0210304 Ga0496118_0210304_183_578 117
471 3300048924 Ga0496121_0062905 Ga0496121_0062905_2340_2735 117
472 3300048924 Ga0496121_0099903 Ga0496121_0099903_114_509 117
473 3300048925 Ga0496122_0124159 Ga0496122_0124159_767_1162 117
474 3300048926 Ga0496123_0053644 Ga0496123_0053644_887_1282 117
475 3300048926 Ga0496123_0063824 Ga0496123_0063824_298_693 117
476 3300048927 Ga0496124_0013609 Ga0496124_0013609_319_714 117
477 3300048927 Ga0496124_0253352 Ga0496124_0253352_740_1135 117
478 3300048928 Ga0496125_0006597 Ga0496125_0006597_9124_9519 117
479 3300048928 Ga0496125_0044951 Ga0496125_0044951_1343_1738 117
480 3300048928 Ga0496125_0185694 Ga0496125_0185694_478_873 117
481 3300048929 Ga0496126_0329247 Ga0496126_0329247_805_1200 117
482 3300049459 Ga0495678_131438 Ga0495678_131438_126_521 117
483 3300050489 nmdc:mga03683_29482_c1 nmdc:mga03683_29482_c1_271_666 117
484 3300050489 nmdc:mga03683_664_c1 nmdc:mga03683_664_c1_8536_8931 117
485 3300050490 nmdc:mga03n38_106527_c1 nmdc:mga03n38_106527_c1_149_544 117
486 3300050490 nmdc:mga03n38_251441_c1 nmdc:mga03n38_251441_c1_358_753 117
487 3300050490 nmdc:mga03n38_409702_c1 nmdc:mga03n38_409702_c1_202_597 117
488 3300050491 nmdc:mga00v17_34675_c1 nmdc:mga00v17_34675_c1_1036_1431 117
489 3300050492 nmdc:mga0yw44_1098109_c1 nmdc:mga0yw44_1098109_c1_53_448 117
490 3300050493 nmdc:mga0k408_305812_c1 nmdc:mga0k408_305812_c1_221_616 117
491 3300050494 nmdc:mga06z11_118182_c1 nmdc:mga06z11_118182_c1_820_1215 117
492 3300050494 nmdc:mga06z11_145898_c1 nmdc:mga06z11_145898_c1_232_627 117
493 3300050496 nmdc:mga07m45_170786_c1 nmdc:mga07m45_170786_c1_848_1243 117
494 3300050496 nmdc:mga07m45_2454_c1 nmdc:mga07m45_2454_c1_3220_3615 117
495 3300050496 nmdc:mga07m45_7566_c1 nmdc:mga07m45_7566_c1_680_1075 117
496 3300050496 nmdc:mga07m45_9053_c1 nmdc:mga07m45_9053_c1_3651_4046 117
497 3300050496 nmdc:mga07m45_97194_c1 nmdc:mga07m45_97194_c1_553_948 117
498 3300050516 nmdc:mga0sz30_423384_c1 nmdc:mga0sz30_423384_c1_75_470 117
499 3300050516 nmdc:mga0sz30_5927_c3 nmdc:mga0sz30_5927_c3_190_585 117
500 3300053079 Ga0500610_0000290 Ga0500610_0000290_11880_12275 117
501 3300053079 Ga0500610_0000449 Ga0500610_0000449_9845_10240 117
502 3300053109 Ga0500569_005829 Ga0500569_005829_2044_2439 117
503 3300053111 Ga0500572_025970 Ga0500572_025970_1016_1411 117
504 3300053117 Ga0500593_000151 Ga0500593_000151_4864_5259 117
505 3300053121 Ga0500607_001110 Ga0500607_001110_24357_24752 117
506 3300053121 Ga0500607_009988 Ga0500607_009988_4502_4897 117
507 3300053125 Ga0500618_011263 Ga0500618_011263_781_1176 117
508 3300053142 Ga0500577_0305241 Ga0500577_0305241_71_466 117
509 3300053158 Ga0500627_0000252 Ga0500627_0000252_4604_4999 117
510 3300053160 Ga0500633_0136063 Ga0500633_0136063_256_651 117
511 3300053729 Ga0500625_098324 Ga0500625_098324_740_1135 117
512 2010549000 RicEn_C920 RicEn_17050 118
513 3300001989 JGI24739J22299_10001792 JGI24739J22299_100017922 118
514 3300001989 JGI24739J22299_10010438 JGI24739J22299_100104382 118
515 3300002773 JGI25152J39213_1002221 JGI25152J39213_10022218 118
516 3300003187 JGI25151J46595_10004385 JGI25151J46595_100043854 118
517 3300003316 rootH1_10041547 rootH1_100415472 118
518 3300003320 rootH2_10070234 rootH2_100702341 118
519 3300003323 rootH1_10008536 rootH1_100085366 118
520 3300003761 Ga0055535_1000655 Ga0055535_100065516 118
521 3300003762 Ga0055542_1000301 Ga0055542_100030137 118
522 3300003856 Ga0058692_1015801 Ga0058692_10158012 118
523 3300003856 Ga0058692_1018596 Ga0058692_10185961 118
524 3300005272 Ga0065703_1018900 Ga0065703_10189003 118
525 3300005288 Ga0065714_10028184 Ga0065714_100281842 118
526 3300005334 Ga0068869_100929650 Ga0068869_1009296501 118
527 3300005347 Ga0070668_100259622 Ga0070668_1002596221 118
528 3300005364 Ga0070673_100469295 Ga0070673_1004692952 118
529 3300005456 Ga0070678_100134507 Ga0070678_1001345073 118
530 3300005548 Ga0070665_100037997 Ga0070665_1000379973 118
531 3300005718 Ga0068866_10870623 Ga0068866_108706231 118
532 3300005834 Ga0068851_10001095 Ga0068851_100010953 118
533 3300006028 Ga0070717_11432976 Ga0070717_114329762 118
534 3300006038 Ga0075365_10000218 Ga0075365_100002187 118
535 3300006038 Ga0075365_10379763 Ga0075365_103797632 118
536 3300006048 Ga0075363_100000205 Ga0075363_1000002057 118
537 3300006048 Ga0075363_100003154 Ga0075363_1000031542 118
538 3300006048 Ga0075363_100470788 Ga0075363_1004707882 118
539 3300006051 Ga0075364_10001540 Ga0075364_100015407 118
540 3300006051 Ga0075364_10339919 Ga0075364_103399192 118
541 3300006051 Ga0075364_11111622 Ga0075364_111116221 118
542 3300006058 Ga0075432_10003988 Ga0075432_100039882 118
543 3300006177 Ga0075362_10004148 Ga0075362_100041485 118
544 3300006177 Ga0075362_10016686 Ga0075362_100166863 118
545 3300006178 Ga0075367_10069124 Ga0075367_100691243 118
546 3300006178 Ga0075367_10095797 Ga0075367_100957972 118
547 3300006186 Ga0075369_10175133 Ga0075369_101751332 118
548 3300006195 Ga0075366_10001207 Ga0075366_100012075 118
549 3300006195 Ga0075366_10592044 Ga0075366_105920442 118
550 3300006195 Ga0075366_10878934 Ga0075366_108789341 118
551 3300006237 Ga0097621_100729542 Ga0097621_1007295422 118
552 3300006353 Ga0075370_10000561 Ga0075370_100005615 118
553 3300006353 Ga0075370_10048729 Ga0075370_100487292 118
554 3300006358 Ga0068871_100251666 Ga0068871_1002516662 118
555 3300006358 Ga0068871_100275220 Ga0068871_1002752202 118
556 3300006844 Ga0075428_101044463 Ga0075428_1010444632 118
557 3300006880 Ga0075429_100953386 Ga0075429_1009533861 118
558 3300006881 Ga0068865_100035516 Ga0068865_1000355162 118
559 3300006881 Ga0068865_100927521 Ga0068865_1009275212 118
560 3300006946 Ga0079104_1003589 Ga0079104_10035892 118
561 3300006948 Ga0099826_10014200 Ga0099826_100142005 118
562 3300009011 Ga0105251_10140083 Ga0105251_101400832 118
563 3300009036 Ga0105244_10008009 Ga0105244_100080096 118
564 3300009036 Ga0105244_10018820 Ga0105244_100188202 118
565 3300009147 Ga0114129_10723807 Ga0114129_107238072 118
566 3300009176 Ga0105242_11955784 Ga0105242_119557841 118
567 3300009545 Ga0105237_10132012 Ga0105237_101320122 118
568 3300009551 Ga0105238_11969078 Ga0105238_119690782 118
569 3300013100 Ga0157373_10002535 Ga0157373_1000253510 118
570 3300013100 Ga0157373_10009631 Ga0157373_100096317 118
571 3300013100 Ga0157373_10011038 Ga0157373_100110382 118
572 3300013100 Ga0157373_10023490 Ga0157373_100234904 118
573 3300013102 Ga0157371_10008632 Ga0157371_100086327 118
574 3300013102 Ga0157371_10011822 Ga0157371_100118222 118
575 3300013102 Ga0157371_10041613 Ga0157371_100416131 118
576 3300013102 Ga0157371_10083132 Ga0157371_100831323 118
577 3300013105 Ga0157369_10013444 Ga0157369_100134449 118
578 3300013105 Ga0157369_10020697 Ga0157369_100206977 118
579 3300013105 Ga0157369_10023936 Ga0157369_100239362 118
580 3300013105 Ga0157369_11095357 Ga0157369_110953572 118
581 3300013307 Ga0157372_10024631 Ga0157372_100246312 118
582 3300013307 Ga0157372_10042147 Ga0157372_100421474 118
583 3300013308 Ga0157375_10008646 Ga0157375_100086462 118
584 3300014497 Ga0182008_10001722 Ga0182008_100017228 118
585 3300014969 Ga0157376_10087634 Ga0157376_100876342 118
586 3300014969 Ga0157376_11069913 Ga0157376_110699131 118
587 3300015261 Ga0182006_1026328 Ga0182006_10263282 118
588 3300015261 Ga0182006_1064138 Ga0182006_10641382 118
589 3300015262 Ga0182007_10033732 Ga0182007_100337323 118
590 3300015265 Ga0182005_1152023 Ga0182005_11520232 118
591 3300021384 Ga0213876_10000016 Ga0213876_100000164 118
592 3300025228 Ga0209672_100815 Ga0209672_10081510 118
593 3300025229 Ga0209147_100363 Ga0209147_10036316 118
594 3300025233 Ga0209437_100035 Ga0209437_100035478 118
595 3300025242 Ga0209258_100020 Ga0209258_10002038 118
596 3300025245 Ga0207425_1031419 Ga0207425_10314191 118
597 3300025245 Ga0207425_1047303 Ga0207425_10473032 118
598 3300025254 Ga0209148_1000031 Ga0209148_100003138 118
599 3300025258 Ga0209129_1000004 Ga0209129_1000004596 118
600 3300025263 Ga0209565_1048262 Ga0209565_10482622 118
601 3300025273 Ga0209673_1001706 Ga0209673_10017066 118
602 3300025292 Ga0209676_1063682 Ga0209676_10636822 118
603 3300025294 Ga0209025_1000029 Ga0209025_1000029277 118
604 3300025321 Ga0207656_10139611 Ga0207656_101396111 118
605 3300025728 Ga0207655_1008284 Ga0207655_10082846 118
606 3300025735 Ga0207713_1099714 Ga0207713_10997142 118
607 3300025934 Ga0207686_11383574 Ga0207686_113835741 118
608 3300025938 Ga0207704_10461721 Ga0207704_104617212 118
609 3300025942 Ga0207689_10847816 Ga0207689_108478161 118
610 3300025944 Ga0207661_10218174 Ga0207661_102181743 118
611 3300025972 Ga0207668_10838175 Ga0207668_108381752 118
612 3300025986 Ga0207658_10000824 Ga0207658_1000082423 118
613 3300026089 Ga0207648_10090288 Ga0207648_100902882 118
614 3300026116 Ga0207674_10277597 Ga0207674_102775972 118
615 3300026121 Ga0207683_10117008 Ga0207683_101170083 118
616 3300027111 Ga0209281_1008938 Ga0209281_10089383 118
617 3300027312 Ga0209371_1000052 Ga0209371_1000052188 118
618 3300027312 Ga0209371_1002652 Ga0209371_10026529 118
619 3300027312 Ga0209371_1047017 Ga0209371_10470171 118
620 3300027866 Ga0209813_10129051 Ga0209813_101290512 118
621 3300027907 Ga0207428_10024767 Ga0207428_100247672 118
622 3300028379 Ga0268266_10108896 Ga0268266_101088962 118
623 3300028379 Ga0268266_11425305 Ga0268266_114253051 118
624 3300028381 Ga0268264_10185342 Ga0268264_101853422 118
625 3300030500 Ga0268256_1000061 Ga0268256_1000061154 118
626 3300030500 Ga0268256_1007310 Ga0268256_10073102 118
627 3300030500 Ga0268256_1033576 Ga0268256_10335762 118
628 3300030500 Ga0268256_1053016 Ga0268256_10530161 118
629 3300031731 Ga0307405_10481750 Ga0307405_104817502 118
630 3300031731 Ga0307405_10562100 Ga0307405_105621002 118
631 3300031852 Ga0307410_10035185 Ga0307410_100351854 118
632 3300031901 Ga0307406_10008069 Ga0307406_100080696 118
633 3300031903 Ga0307407_10013073 Ga0307407_100130734 118
634 3300031911 Ga0307412_10235734 Ga0307412_102357343 118
635 3300032002 Ga0307416_100934688 Ga0307416_1009346881 118
636 3300032004 Ga0307414_11599128 Ga0307414_115991281 118
637 3300032133 Ga0316583_10000492 Ga0316583_100004927 118
638 3300039437 Ga0436365_1910565 Ga0436365_1910565_466052_466444 118
639 3300041405 Ga0439438_002501 Ga0439438_002501_352_744 118
640 3300042006 Ga0439432_004934 Ga0439432_004934_4310_4702 118
641 3300042010 Ga0439452_000001 Ga0439452_000001_1399602_1399994 118
642 3300042010 Ga0439452_000022 Ga0439452_000022_244252_244644 118
643 3300042010 Ga0439452_000695 Ga0439452_000695_7599_7991 118
644 3300042010 Ga0439452_010260 Ga0439452_010260_256_648 118
645 3300042439 Ga0439464_0010692 Ga0439464_0010692_373_765 118
646 3300044712 Ga0453684_0000491 Ga0453684_0000491_123076_123471 118
647 3300044712 Ga0453684_0023640 Ga0453684_0023640_1251_1703 118
648 3300044712 Ga0453684_0053355 Ga0453684_0053355_2863_3258 118
649 3300044712 Ga0453684_0580262 Ga0453684_0580262_604_999 118
650 3300046462 Ga0495651_0812348 Ga0495651_0812348_55_450 118
651 3300046471 Ga0495650_0021830 Ga0495650_0021830_734_1129 118
652 3300046506 Ga0495583_0060584 Ga0495583_0060584_944_1339 118
653 3300046514 Ga0495618_0707277 Ga0495618_0707277_34_429 118
654 3300046518 Ga0495631_0000775 Ga0495631_0000775_7437_7832 118
655 3300046530 Ga0495654_0000127 Ga0495654_0000127_7508_7900 118
656 3300046660 Ga0495625_0000146 Ga0495625_0000146_33066_33461 118
657 3300046674 Ga0495588_0178751 Ga0495588_0178751_135_530 118
658 3300046683 Ga0495658_0026597 Ga0495658_0026597_2396_2791 118
659 3300046794 Ga0495589_0000013 Ga0495589_0000013_227933_228325 118
660 3300046810 Ga0495660_0080423 Ga0495660_0080423_484_879 118
661 3300047321 Ga0495676_0000492 Ga0495676_0000492_21499_21894 118
662 3300047673 Ga0495593_0000714 Ga0495593_0000714_7235_7630 118
663 3300048088 Ga0495602_0018378 Ga0495602_0018378_3436_3831 118
664 3300048089 Ga0495614_0000225 Ga0495614_0000225_8421_8816 118
665 3300048919 Ga0496116_0010589 Ga0496116_0010589_5225_5617 118
666 3300048919 Ga0496116_0013128 Ga0496116_0013128_6143_6535 118
667 3300048919 Ga0496116_0016207 Ga0496116_0016207_37_429 118
668 3300048919 Ga0496116_0048037 Ga0496116_0048037_2313_2705 118
669 3300048920 Ga0496117_0002511 Ga0496117_0002511_8513_8905 118
670 3300048920 Ga0496117_0010801 Ga0496117_0010801_7220_7612 118
671 3300048920 Ga0496117_0062457 Ga0496117_0062457_2113_2505 118
672 3300048920 Ga0496117_0065402 Ga0496117_0065402_238_630 118
673 3300048920 Ga0496117_0069922 Ga0496117_0069922_194_586 118
674 3300048920 Ga0496117_0382242 Ga0496117_0382242_130_522 118
675 3300048921 Ga0496118_0002851 Ga0496118_0002851_15601_15993 118
676 3300048921 Ga0496118_0030949 Ga0496118_0030949_3858_4250 118
677 3300048921 Ga0496118_0327660 Ga0496118_0327660_150_542 118
678 3300048922 Ga0496119_0000001 Ga0496119_0000001_230123_230515 118
679 3300048922 Ga0496119_0013230 Ga0496119_0013230_6050_6442 118
680 3300048923 Ga0496120_0009249 Ga0496120_0009249_2793_3185 118
681 3300048923 Ga0496120_0009823 Ga0496120_0009823_271_663 118
682 3300048924 Ga0496121_0000047 Ga0496121_0000047_301_693 118
683 3300048924 Ga0496121_0152023 Ga0496121_0152023_1084_1479 118
684 3300048925 Ga0496122_0000187 Ga0496122_0000187_62062_62454 118
685 3300048925 Ga0496122_0037239 Ga0496122_0037239_2956_3348 118
686 3300048925 Ga0496122_0204341 Ga0496122_0204341_383_775 118
687 3300048925 Ga0496122_0290248 Ga0496122_0290248_80_472 118
688 3300048926 Ga0496123_0000095 Ga0496123_0000095_82072_82464 118
689 3300048926 Ga0496123_0069528 Ga0496123_0069528_817_1212 118
690 3300048926 Ga0496123_0182713 Ga0496123_0182713_417_809 118
691 3300048927 Ga0496124_0000059 Ga0496124_0000059_2074_2466 118
692 3300048927 Ga0496124_0015989 Ga0496124_0015989_568_960 118
693 3300048927 Ga0496124_0406287 Ga0496124_0406287_517_909 118
694 3300048928 Ga0496125_0171191 Ga0496125_0171191_297_689 118
695 3300048928 Ga0496125_0344219 Ga0496125_0344219_193_585 118
696 3300048929 Ga0496126_0137656 Ga0496126_0137656_600_992 118
697 3300049161 Ga0501305_060648 Ga0501305_060648_137_532 118
698 3300050489 nmdc:mga03683_1038_c1 nmdc:mga03683_1038_c1_3149_3544 118
699 3300050489 nmdc:mga03683_3842_c1 nmdc:mga03683_3842_c1_2985_3365 118
700 3300050490 nmdc:mga03n38_106850_c1 nmdc:mga03n38_106850_c1_367_747 118
701 3300050490 nmdc:mga03n38_398573_c1 nmdc:mga03n38_398573_c1_210_605 118
702 3300050490 nmdc:mga03n38_563_c1 nmdc:mga03n38_563_c1_8701_9096 118
703 3300050491 nmdc:mga00v17_338008_c1 nmdc:mga00v17_338008_c1_305_700 118
704 3300050491 nmdc:mga00v17_59367_c1 nmdc:mga00v17_59367_c1_706_1101 118
705 3300050492 nmdc:mga0yw44_261845_c1 nmdc:mga0yw44_261845_c1_596_991 118
706 3300050492 nmdc:mga0yw44_6052_c1 nmdc:mga0yw44_6052_c1_4840_5235 118
707 3300050493 nmdc:mga0k408_25998_c1 nmdc:mga0k408_25998_c1_2614_3009 118
708 3300050493 nmdc:mga0k408_34363_c1 nmdc:mga0k408_34363_c1_664_1059 118
709 3300050494 nmdc:mga06z11_119701_c1 nmdc:mga06z11_119701_c1_215_610 118
710 3300050494 nmdc:mga06z11_54072_c1 nmdc:mga06z11_54072_c1_790_1185 118
711 3300050495 nmdc:mga04h51_145744_c1 nmdc:mga04h51_145744_c1_247_642 118
712 3300050496 nmdc:mga07m45_39383_c1 nmdc:mga07m45_39383_c1_344_739 118
713 3300050496 nmdc:mga07m45_63363_c1 nmdc:mga07m45_63363_c1_827_1222 118
714 3300050496 nmdc:mga07m45_99706_c1 nmdc:mga07m45_99706_c1_396_791 118
715 3300050516 nmdc:mga0sz30_225215_c1 nmdc:mga0sz30_225215_c1_284_679 118
716 3300053079 Ga0500610_0022560 Ga0500610_0022560_415_810 118
717 3300053087 Ga0500643_001757 Ga0500643_001757_2530_2925 118
718 3300053093 Ga0500651_0263514 Ga0500651_0263514_583_978 118
719 3300053094 Ga0500566_0019631 Ga0500566_0019631_213_608 118
720 3300053110 Ga0500571_000027 Ga0500571_000027_41926_42321 118
721 3300053120 Ga0500597_000108 Ga0500597_000108_5534_5929 118
722 3300053122 Ga0500608_001585 Ga0500608_001585_3166_3561 118
723 3300053125 Ga0500618_061439 Ga0500618_061439_248_643 118
724 3300053133 Ga0500655_001213 Ga0500655_001213_1506_1901 118
725 3300053138 Ga0500564_017687 Ga0500564_017687_2335_2730 118
726 3300053141 Ga0500574_000743 Ga0500574_000743_1436_1831 118
727 3300053141 Ga0500574_081356 Ga0500574_081356_285_680 118
728 3300053151 Ga0500604_0149648 Ga0500604_0149648_213_608 118
729 3300053153 Ga0500616_0002193 Ga0500616_0002193_8275_8670 118
730 3300053161 Ga0500634_0011820 Ga0500634_0011820_839_1234 118
731 3300053162 Ga0500638_001050 Ga0500638_001050_3180_3575 118
732 3300053177 Ga0500636_0002403 Ga0500636_0002403_8229_8624 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13665

Tox-PAAR-like

Toxin PAAR-like domain

9

116

0.97

Feature Viewer

pLDDT pTM Quality
43.38 0.25 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map