F477987

General Info

Members Datasets Scaffolds Average Seq Length
731 358 1462 71

Family's Representative Sequence

Representative Sequence 3300046529|Ga0495652_0118466|Ga0495652_0118466_218_436
Length 72
Sequence MTEHTYRVTEIVGSSPDSVAEAIRSGLGRASQTLRELEWFEVTQIRGRIAPDGSVEQFQVGLKVGFRLEDVG

Samples

Sample ID Description Type Environment
1 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
178 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
179 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
180 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
181 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
257 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
258 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
315 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
335 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
338 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
339 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
340 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
341 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
342 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
343 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
344 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
347 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
348 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
356 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
357 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
358 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 2.46
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.56
Nodule 0.14
Rhizoplane 3.28
Rhizosphere 86.87
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495652_0118466 3300046529 Bacteria 2116
2 LJQas_1008657 3300000549 Bacteria 1234
3 JGI25406J46586_10023694 3300003203 Bacteria 2423
4 rootH1_10015850 3300003316 Bacteria 4025
5 rootL2_10142599 3300003322 Bacteria 1165
6 rootH1_10019902 3300003323 Bacteria 4394
7 JGI25160J50197_1018068 3300003354 Bacteria 2210
8 JGI25160J50197_1023273 3300003354 Bacteria 1792
9 JGI25160J50197_1023353 3300003354 Bacteria 1785
10 Ga0007429J51699_1025479 3300003579 Bacteria 535
11 Ga0058863_11714285 3300004799 Unclassified 1007
12 Ga0058862_11821698 3300004803 Unclassified 544
13 Ga0070658_10004159 3300005327 Bacteria 11849
14 Ga0070658_10144585 3300005327 Bacteria 1988
15 Ga0070658_10170787 3300005327 Bacteria 1826
16 Ga0070658_10201882 3300005327 Bacteria 1678
17 Ga0070658_11502276 3300005327 Unclassified 584
18 Ga0070683_100271525 3300005329 Bacteria 1613
19 Ga0070683_100476344 3300005329 Bacteria 1192
20 Ga0070683_100637817 3300005329 Bacteria 1020
21 Ga0070677_10436096 3300005333 Bacteria 698
22 Ga0068869_100024248 3300005334 Bacteria 4201
23 Ga0070666_11087232 3300005335 Bacteria 594
24 Ga0070680_100000215 3300005336 Bacteria 38142
25 Ga0070682_100162740 3300005337 Bacteria 1543
26 Ga0068868_100023128 3300005338 Bacteria 4700
27 Ga0068868_100293598 3300005338 Bacteria 1379
28 Ga0068868_101466155 3300005338 Bacteria 638
29 Ga0070660_100053693 3300005339 Bacteria 3109
30 Ga0070660_100637530 3300005339 Bacteria 892
31 Ga0070691_10396294 3300005341 Bacteria 777
32 Ga0070687_100235702 3300005343 Bacteria 1129
33 Ga0070692_10041444 3300005345 Bacteria 2359
34 Ga0070692_10798645 3300005345 Bacteria 644
35 Ga0070668_100821742 3300005347 Bacteria 827
36 Ga0070675_101271694 3300005354 Bacteria 678
37 Ga0070671_100580707 3300005355 Bacteria 968
38 Ga0070674_100061314 3300005356 Bacteria 2624
39 Ga0070674_100365820 3300005356 Bacteria 1169
40 Ga0070673_100172389 3300005364 Bacteria 1847
41 Ga0070673_101520662 3300005364 Bacteria 631
42 Ga0070673_101619539 3300005364 Bacteria 612
43 Ga0070688_100638414 3300005365 Bacteria 819
44 Ga0070659_100007849 3300005366 Bacteria 7769
45 Ga0070659_101350926 3300005366 Bacteria 633
46 Ga0070714_101239708 3300005435 Bacteria 728
47 Ga0070701_10080296 3300005438 Bacteria 1764
48 Ga0070663_100612286 3300005455 Bacteria 917
49 Ga0070663_100816217 3300005455 Bacteria 801
50 Ga0070663_101278574 3300005455 Bacteria 647
51 Ga0070678_100385302 3300005456 Bacteria 1214
52 Ga0070678_101257750 3300005456 Bacteria 688
53 Ga0070678_101825019 3300005456 Bacteria 573
54 Ga0070662_101299311 3300005457 Bacteria 626
55 Ga0070681_10000019 3300005458 Bacteria 124774
56 Ga0070681_10720038 3300005458 Bacteria 914
57 Ga0070681_11099898 3300005458 Bacteria 716
58 Ga0070698_101323823 3300005471 Bacteria 671
59 Ga0070679_100001348 3300005530 Bacteria 21679
60 Ga0070679_100641752 3300005530 Bacteria 1005
61 Ga0070684_100087656 3300005535 Bacteria 2764
62 Ga0070684_100279204 3300005535 Bacteria 1530
63 Ga0070684_100847841 3300005535 Unclassified 855
64 Ga0070684_101375022 3300005535 Bacteria 665
65 Ga0070684_101412399 3300005535 Bacteria 655
66 Ga0068853_100122082 3300005539 Bacteria 2325
67 Ga0068853_101780744 3300005539 Bacteria 597
68 Ga0070672_100179930 3300005543 Bacteria 1762
69 Ga0070686_100094462 3300005544 Bacteria 2007
70 Ga0070665_100324695 3300005548 Bacteria 1543
71 Ga0070665_100621147 3300005548 Bacteria 1094
72 Ga0070665_101204613 3300005548 Bacteria 768
73 Ga0068855_101437234 3300005563 Bacteria 710
74 Ga0068852_100354424 3300005616 Bacteria 1434
75 Ga0068852_101431667 3300005616 Bacteria 713
76 Ga0068864_100567164 3300005618 Bacteria 1099
77 Ga0068866_10436225 3300005718 Bacteria 853
78 Ga0068870_10653224 3300005840 Bacteria 721
79 Ga0068863_101651159 3300005841 Bacteria 650
80 Ga0068862_100401561 3300005844 Bacteria 1282
81 Ga0081455_10070782 3300005937 Bacteria 2894
82 Ga0081455_11020755 3300005937 Bacteria 512
83 Ga0081539_10000479 3300005985 Bacteria 84481
84 Ga0075365_11199996 3300006038 Bacteria 534
85 Ga0075363_100178875 3300006048 Bacteria 1206
86 Ga0075363_100351346 3300006048 Bacteria 861
87 Ga0075370_10238941 3300006353 Bacteria 1075
88 Ga0075428_100901457 3300006844 Bacteria 938
89 Ga0075433_10804967 3300006852 Bacteria 821
90 Ga0075434_102097764 3300006871 Bacteria 570
91 Ga0099826_10501639 3300006948 Bacteria 567
92 Ga0105250_10104785 3300009092 Bacteria 1156
93 Ga0111539_11424732 3300009094 Bacteria 804
94 Ga0105245_10058347 3300009098 Bacteria 3474
95 Ga0105245_10190415 3300009098 Bacteria 1964
96 Ga0105245_10780675 3300009098 Bacteria 992
97 Ga0105245_11063469 3300009098 Bacteria 855
98 Ga0105245_11590952 3300009098 Bacteria 705
99 Ga0105245_11677303 3300009098 Bacteria 688
100 Ga0114129_10916914 3300009147 Bacteria 1109
101 Ga0114129_11174260 3300009147 Bacteria 957
102 Ga0105243_10045776 3300009148 Bacteria 3440
103 Ga0105243_12395511 3300009148 Bacteria 566
104 Ga0105241_12110881 3300009174 Bacteria 557
105 Ga0105242_10271509 3300009176 Bacteria 1536
106 Ga0105242_10290140 3300009176 Bacteria 1489
107 Ga0105242_11473826 3300009176 Bacteria 710
108 Ga0105242_11656672 3300009176 Bacteria 675
109 Ga0105237_10043356 3300009545 Bacteria 4532
110 Ga0105238_11554853 3300009551 Bacteria 691
111 Ga0105249_10348471 3300009553 Bacteria 1500
112 Ga0105249_13492037 3300009553 Bacteria 506
113 Ga0105239_10544153 3300010375 Bacteria 1322
114 Ga0105239_11596067 3300010375 Bacteria 754
115 Ga0105239_12517670 3300010375 Unclassified 600
116 Ga0105246_10109244 3300011119 Bacteria 2029
117 Ga0105246_11193536 3300011119 Bacteria 700
118 Ga0157373_10317809 3300013100 Bacteria 1107
119 Ga0157373_11135124 3300013100 Bacteria 587
120 Ga0157370_10010583 3300013104 Bacteria 9711
121 Ga0157369_10536157 3300013105 Bacteria 1210
122 Ga0157369_11516587 3300013105 Bacteria 682
123 Ga0157369_12339676 3300013105 Bacteria 541
124 Ga0157369_12613902 3300013105 Unclassified 510
125 Ga0157374_10713708 3300013296 Unclassified 1016
126 Ga0157374_11120127 3300013296 Bacteria 808
127 Ga0157374_11181736 3300013296 Bacteria 786
128 Ga0157378_11420385 3300013297 Bacteria 737
129 Ga0157378_11893969 3300013297 Bacteria 645
130 Ga0157378_12097156 3300013297 Bacteria 616
131 Ga0163162_12336516 3300013306 Bacteria 614
132 Ga0157372_10259480 3300013307 Bacteria 2018
133 Ga0157372_10417370 3300013307 Bacteria 1564
134 Ga0157372_11885625 3300013307 Bacteria 687
135 Ga0157372_12423316 3300013307 Bacteria 602
136 Ga0157372_12643599 3300013307 Bacteria 576
137 Ga0157375_10219539 3300013308 Bacteria 2059
138 Ga0157375_11916112 3300013308 Bacteria 704
139 Ga0157375_13318643 3300013308 Bacteria 536
140 Ga0163163_10422691 3300014325 Bacteria 1392
141 Ga0157380_10719250 3300014326 Bacteria 1006
142 Ga0157380_11233185 3300014326 Bacteria 793
143 Ga0157377_11178584 3300014745 Bacteria 592
144 Ga0157379_11584812 3300014968 Bacteria 639
145 Ga0157376_11416703 3300014969 Bacteria 727
146 Ga0157376_11538809 3300014969 Bacteria 699
147 Ga0163161_10035610 3300017792 Bacteria 3563
148 Ga0197907_10474894 3300020069 Bacteria 711
149 Ga0206356_10819511 3300020070 Bacteria 602
150 Ga0206352_10231614 3300020078 Bacteria 931
151 Ga0206350_11556875 3300020080 Bacteria 718
152 Ga0206354_11374769 3300020081 Bacteria 876
153 Ga0206354_11711784 3300020081 Bacteria 779
154 Ga0206353_10047350 3300020082 Bacteria 507
155 Ga0206353_11141798 3300020082 Bacteria 793
156 Ga0206353_11664766 3300020082 Bacteria 1245
157 Ga0213875_10030561 3300021388 Bacteria 2549
158 Ga0224712_10000799 3300022467 Bacteria 6641
159 Ga0224712_10154764 3300022467 Bacteria 1018
160 Ga0224712_10493855 3300022467 Bacteria 591
161 Ga0207426_1000911 3300025302 Bacteria 29649
162 Ga0207426_1001346 3300025302 Bacteria 20862
163 Ga0207426_1047697 3300025302 Bacteria 1291
164 Ga0207682_10097460 3300025893 Bacteria 1282
165 Ga0207688_10074365 3300025901 Bacteria 1932
166 Ga0207705_10024296 3300025909 Bacteria 4326
167 Ga0207705_10052754 3300025909 Bacteria 2928
168 Ga0207705_10429077 3300025909 Bacteria 1024
169 Ga0207684_10119489 3300025910 Bacteria 2259
170 Ga0207707_10000046 3300025912 Bacteria 119404
171 Ga0207707_10804844 3300025912 Bacteria 783
172 Ga0207671_10025620 3300025914 Bacteria 4428
173 Ga0207660_10001571 3300025917 Bacteria 15313
174 Ga0207660_11436103 3300025917 Bacteria 558
175 Ga0207662_10241339 3300025918 Bacteria 1183
176 Ga0207662_10414341 3300025918 Bacteria 916
177 Ga0207657_10316380 3300025919 Bacteria 1235
178 Ga0207657_11194141 3300025919 Bacteria 578
179 Ga0207652_10003303 3300025921 Bacteria 13354
180 Ga0207652_10434240 3300025921 Bacteria 1184
181 Ga0207646_11042188 3300025922 Bacteria 722
182 Ga0207694_11662176 3300025924 Bacteria 538
183 Ga0207659_11076023 3300025926 Bacteria 692
184 Ga0207659_11776625 3300025926 Bacteria 524
185 Ga0207687_10059653 3300025927 Bacteria 2689
186 Ga0207687_10193854 3300025927 Bacteria 1583
187 Ga0207664_11501042 3300025929 Bacteria 595
188 Ga0207690_10000087 3300025932 Bacteria 76974
189 Ga0207690_10036753 3300025932 Bacteria 3174
190 Ga0207690_10883006 3300025932 Bacteria 741
191 Ga0207690_11457078 3300025932 Bacteria 572
192 Ga0207686_10492868 3300025934 Bacteria 949
193 Ga0207686_11196147 3300025934 Bacteria 622
194 Ga0207709_10159890 3300025935 Bacteria 1570
195 Ga0207669_10105884 3300025937 Bacteria 1872
196 Ga0207669_10872125 3300025937 Bacteria 750
197 Ga0207665_11044470 3300025939 Bacteria 651
198 Ga0207691_10173309 3300025940 Bacteria 1888
199 Ga0207691_11373555 3300025940 Bacteria 581
200 Ga0207711_10991563 3300025941 Bacteria 779
201 Ga0207689_10077211 3300025942 Bacteria 2738
202 Ga0207661_10303465 3300025944 Bacteria 1432
203 Ga0207679_11677899 3300025945 Bacteria 582
204 Ga0207667_11082957 3300025949 Bacteria 785
205 Ga0207651_10972462 3300025960 Bacteria 758
206 Ga0207651_12002986 3300025960 Bacteria 520
207 Ga0207712_11190235 3300025961 Bacteria 680
208 Ga0207668_11804322 3300025972 Bacteria 552
209 Ga0207677_10005107 3300026023 Bacteria 7099
210 Ga0207677_10577294 3300026023 Bacteria 983
211 Ga0207677_11710886 3300026023 Bacteria 583
212 Ga0207639_10158536 3300026041 Bacteria 1904
213 Ga0207678_10049840 3300026067 Bacteria 3619
214 Ga0207678_10255796 3300026067 Bacteria 1500
215 Ga0207678_10484151 3300026067 Bacteria 1078
216 Ga0207678_10498616 3300026067 Unclassified 1061
217 Ga0207641_11987328 3300026088 Bacteria 583
218 Ga0207648_11761129 3300026089 Bacteria 581
219 Ga0207676_10496959 3300026095 Bacteria 1158
220 Ga0207675_100539382 3300026118 Bacteria 1165
221 Ga0207675_101118800 3300026118 Bacteria 807
222 Ga0207683_10238732 3300026121 Bacteria 1658
223 Ga0207683_10350072 3300026121 Bacteria 1356
224 Ga0207683_10837368 3300026121 Bacteria 854
225 Ga0207698_10963814 3300026142 Bacteria 862
226 Ga0207698_11160631 3300026142 Bacteria 786
227 Ga0268266_10313234 3300028379 Bacteria 1467
228 Ga0268266_10602577 3300028379 Bacteria 1055
229 Ga0307517_10008743 3300028786 Bacteria 14491
230 Ga0307515_10000325 3300028794 Bacteria 118141
231 Ga0307515_10040244 3300028794 Bacteria 7397
232 Ga0307515_10337220 3300028794 Bacteria 1162
233 Ga0265338_10477781 3300028800 Bacteria 880
234 Ga0307511_10000010 3300030521 Bacteria 146716
235 Ga0307511_10023329 3300030521 Bacteria 5771
236 Ga0307511_10086730 3300030521 Bacteria 2154
237 Ga0307512_10123845 3300030522 Bacteria 1649
238 Ga0265325_10032702 3300031241 Bacteria 2775
239 Ga0307513_10011395 3300031456 Bacteria 11053
240 Ga0307513_10141324 3300031456 Bacteria 2333
241 Ga0307509_10006748 3300031507 Bacteria 15291
242 Ga0307509_10007319 3300031507 Bacteria 14483
243 Ga0307509_10217935 3300031507 Bacteria 1725
244 Ga0307408_100735396 3300031548 Bacteria 890
245 Ga0307408_101719897 3300031548 Bacteria 598
246 Ga0307508_10236605 3300031616 Bacteria 1424
247 Ga0307508_10292414 3300031616 Bacteria 1222
248 Ga0307514_10103178 3300031649 Bacteria 2042
249 Ga0307514_10137806 3300031649 Bacteria 1666
250 Ga0307516_10029243 3300031730 Bacteria 5572
251 Ga0307518_10058965 3300031838 Bacteria 2787
252 Ga0307410_11165528 3300031852 Bacteria 670
253 Ga0307412_11418573 3300031911 Bacteria 629
254 Ga0307409_100876613 3300031995 Bacteria 910
255 Ga0307409_101627421 3300031995 Bacteria 674
256 Ga0307416_100555411 3300032002 Bacteria 1222
257 Ga0307416_100886389 3300032002 Bacteria 992
258 Ga0307414_11048701 3300032004 Bacteria 752
259 Ga0307411_11218486 3300032005 Bacteria 683
260 Ga0307411_12306748 3300032005 Bacteria 506
261 Ga0307415_100989368 3300032126 Bacteria 781
262 Ga0307415_101063689 3300032126 Bacteria 756
263 Ga0307415_101234358 3300032126 Bacteria 705
264 Ga0316593_10222179 3300032168 Bacteria 702
265 Ga0307507_10000017 3300033179 Bacteria 224506
266 Ga0307507_10009781 3300033179 Bacteria 12655
267 Ga0307507_10096223 3300033179 Bacteria 2506
268 Ga0307510_10006935 3300033180 Bacteria 13507
269 Ga0307510_10009726 3300033180 Bacteria 11444
270 Ga0307510_10429035 3300033180 Bacteria 764
271 Ga0316596_1059953 3300033541 Bacteria 1015
272 Ga0373946_0550303 3300035171 Bacteria 595
273 Ga0373955_0576937 3300035172 Bacteria 688
274 Ga0373935_0217506 3300035692 Bacteria 1326
275 Ga0373933_0088389 3300035724 Bacteria 1909
276 Ga0373947_0044793 3300035725 Bacteria 2646
277 Ga0373937_0009931 3300036401 Bacteria 8299
278 Ga0316582_0013953 3300036647 Bacteria 4543
279 Ga0395900_0075214 3300037418 Bacteria 3472
280 Ga0395900_0238964 3300037418 Bacteria 1823
281 Ga0395900_0700482 3300037418 Bacteria 946
282 Ga0395898_0002046 3300037466 Bacteria 25206
283 Ga0395898_0197376 3300037466 Bacteria 1922
284 Ga0395898_0648881 3300037466 Bacteria 998
285 Ga0395898_1575143 3300037466 Bacteria 582
286 Ga0395905_1208835 3300037471 Bacteria 659
287 Ga0436364_0116545 3300037853 Bacteria 10570
288 Ga0436364_1364354 3300037853 Bacteria 9941
289 Ga0395901_0102550 3300038443 Bacteria 3003
290 Ga0395901_0280019 3300038443 Bacteria 1733
291 Ga0395901_0372500 3300038443 Bacteria 1471
292 Ga0436363_1379767 3300039450 Bacteria 762
293 Ga0436362_1238058 3300039453 Bacteria 530
294 Ga0451793_0594397 3300041452 Bacteria 755
295 Ga0451797_0389516 3300041453 Bacteria 740
296 Ga0451795_1556856 3300041456 Bacteria 634
297 Ga0451802_0790062 3300041460 Bacteria 692
298 Ga0451802_1999616 3300041460 Bacteria 1180
299 Ga0451804_0813560 3300041463 Bacteria 1060
300 Ga0451807_0065561 3300041486 Bacteria 1505
301 Ga0451833_0572314 3300041491 Bacteria 711
302 Ga0451833_0941305 3300041491 Bacteria 682
303 Ga0451837_0836637 3300041494 Bacteria 1802
304 Ga0451841_0309167 3300041498 Bacteria 1796
305 Ga0451849_0671702 3300041505 Bacteria 1462
306 Ga0451849_0787754 3300041505 Bacteria 976
307 Ga0451851_0439997 3300041507 Bacteria 511
308 Ga0451843_0585716 3300041509 Bacteria 670
309 Ga0451853_0644947 3300041512 Bacteria 2290
310 Ga0451853_1295071 3300041512 Bacteria 1094
311 Ga0451853_2582090 3300041512 Bacteria 1469
312 Ga0439448_0000998 3300042005 Bacteria 7044
313 Ga0439450_041379 3300042008 Bacteria 1071
314 Ga0439455_0000753 3300042012 Bacteria 4860
315 Ga0450903_001241 3300042138 Bacteria 4788
316 Ga0439458_0000266 3300042157 Bacteria 12806
317 Ga0439458_0023738 3300042157 Bacteria 1431
318 Ga0466969_0009890 3300044656 Bacteria 5056
319 Ga0466969_0044935 3300044656 Bacteria 2194
320 Ga0466969_0071966 3300044656 Bacteria 1662
321 Ga0466969_0405996 3300044656 Bacteria 619
322 Ga0466972_0004287 3300044658 Bacteria 7123
323 Ga0466972_0087747 3300044658 Bacteria 1477
324 Ga0466965_0009387 3300044683 Bacteria 4545
325 Ga0466965_0127554 3300044683 Bacteria 1317
326 Ga0466965_0788634 3300044683 Bacteria 549
327 Ga0466965_0829155 3300044683 Bacteria 536
328 Ga0466965_0859459 3300044683 Bacteria 527
329 Ga0466966_0000456 3300044684 Bacteria 26320
330 Ga0466966_0014511 3300044684 Bacteria 5214
331 Ga0466966_0015414 3300044684 Bacteria 5053
332 Ga0466966_0043666 3300044684 Bacteria 2872
333 Ga0466966_0266104 3300044684 Bacteria 1032
334 Ga0466961_0000862 3300044693 Bacteria 18935
335 Ga0466961_0002796 3300044693 Bacteria 10855
336 Ga0466961_0003411 3300044693 Bacteria 9911
337 Ga0466961_0035241 3300044693 Bacteria 3214
338 Ga0466961_0042677 3300044693 Bacteria 2907
339 Ga0466961_0168397 3300044693 Bacteria 1363
340 Ga0466961_0208141 3300044693 Bacteria 1208
341 Ga0466961_0381109 3300044693 Bacteria 857
342 Ga0466961_0633654 3300044693 Bacteria 642
343 Ga0466961_0691908 3300044693 Bacteria 611
344 Ga0466963_0001691 3300044694 Bacteria 12018
345 Ga0466963_0009011 3300044694 Bacteria 5993
346 Ga0466963_0270014 3300044694 Bacteria 1195
347 Ga0466963_0596727 3300044694 Bacteria 780
348 Ga0466963_0717600 3300044694 Bacteria 705
349 Ga0466963_0941871 3300044694 Bacteria 608
350 Ga0466963_1274588 3300044694 Unclassified 516
351 Ga0466964_0015148 3300044706 Bacteria 2935
352 Ga0466964_0826657 3300044706 Unclassified 525
353 Ga0466971_0000175 3300044719 Bacteria 24166
354 Ga0466971_0000235 3300044719 Bacteria 21054
355 Ga0466971_0160426 3300044719 Bacteria 1052
356 Ga0466971_0205273 3300044719 Bacteria 931
357 Ga0466971_0540832 3300044719 Bacteria 577
358 Ga0466968_0019572 3300044735 Bacteria 2725
359 Ga0466968_0099494 3300044735 Bacteria 1297
360 Ga0466970_0002379 3300044765 Bacteria 9090
361 Ga0466970_0033291 3300044765 Bacteria 2724
362 Ga0466970_0970915 3300044765 Bacteria 501
363 Ga0466957_0000357 3300044842 Bacteria 22414
364 Ga0466957_0012868 3300044842 Bacteria 4850
365 Ga0466957_0063918 3300044842 Bacteria 2263
366 Ga0466957_0236504 3300044842 Bacteria 1211
367 Ga0466957_0559456 3300044842 Bacteria 797
368 Ga0466957_1393270 3300044842 Bacteria 510
369 Ga0466959_0000302 3300045049 Bacteria 29272
370 Ga0466959_0000965 3300045049 Bacteria 17096
371 Ga0466959_0024342 3300045049 Bacteria 4485
372 Ga0466959_0054593 3300045049 Bacteria 2918
373 Ga0466959_0192864 3300045049 Bacteria 1421
374 Ga0466959_0950829 3300045049 Bacteria 573
375 Ga0466958_0000082 3300045836 Bacteria 29102
376 Ga0466958_0123677 3300045836 Bacteria 1621
377 Ga0466958_0993606 3300045836 Bacteria 548
378 Ga0466958_1018259 3300045836 Bacteria 540
379 Ga0466967_0002873 3300045976 Bacteria 10954
380 Ga0466967_0011599 3300045976 Bacteria 6689
381 Ga0466967_0139995 3300045976 Bacteria 2253
382 Ga0466967_0257678 3300045976 Bacteria 1668
383 Ga0466967_0483836 3300045976 Bacteria 1213
384 Ga0466967_0798610 3300045976 Bacteria 937
385 Ga0495617_022623 3300046452 Bacteria 2125
386 Ga0495627_194031 3300046453 Bacteria 560
387 Ga0495592_0009668 3300046454 Bacteria 7258
388 Ga0495592_0054685 3300046454 Bacteria 2956
389 Ga0495592_0503085 3300046454 Bacteria 751
390 Ga0495603_0004796 3300046455 Bacteria 8080
391 Ga0495603_0007000 3300046455 Bacteria 6769
392 Ga0495603_0009932 3300046455 Bacteria 5760
393 Ga0495603_0010268 3300046455 Bacteria 5668
394 Ga0495603_0206390 3300046455 Bacteria 1135
395 Ga0495629_0003791 3300046459 Bacteria 11388
396 Ga0495629_0016312 3300046459 Bacteria 5329
397 Ga0495629_0021371 3300046459 Bacteria 4619
398 Ga0495629_0052224 3300046459 Bacteria 2860
399 Ga0495629_0068073 3300046459 Bacteria 2484
400 Ga0495629_0135493 3300046459 Bacteria 1714
401 Ga0495629_0290698 3300046459 Bacteria 1120
402 Ga0495629_0883353 3300046459 Bacteria 586
403 Ga0495638_0033893 3300046460 Bacteria 3262
404 Ga0495638_0070486 3300046460 Bacteria 2140
405 Ga0495651_0065044 3300046462 Bacteria 2785
406 Ga0495651_0116395 3300046462 Bacteria 1969
407 Ga0495651_0448988 3300046462 Bacteria 833
408 Ga0495653_0035507 3300046463 Bacteria 3933
409 Ga0495580_0061262 3300046472 Bacteria 2642
410 Ga0495582_0093088 3300046473 Bacteria 1682
411 Ga0495605_0001251 3300046474 Bacteria 16850
412 Ga0495639_0097557 3300046475 Bacteria 1385
413 Ga0495662_0002690 3300046476 Bacteria 8978
414 Ga0495662_0005342 3300046476 Bacteria 6435
415 Ga0495662_0035156 3300046476 Bacteria 2418
416 Ga0495662_0528869 3300046476 Bacteria 578
417 Ga0495664_0002229 3300046477 Bacteria 10372
418 Ga0495664_0017350 3300046477 Bacteria 4113
419 Ga0495664_0772506 3300046477 Bacteria 566
420 Ga0495584_0074369 3300046491 Bacteria 1708
421 Ga0495594_0002086 3300046499 Bacteria 10405
422 Ga0495594_0828783 3300046499 Bacteria 521
423 Ga0495596_0114528 3300046500 Bacteria 1047
424 Ga0495607_0023972 3300046501 Bacteria 3811
425 Ga0495607_0314928 3300046501 Bacteria 732
426 Ga0495583_0040981 3300046506 Bacteria 2171
427 Ga0495583_0081375 3300046506 Bacteria 1406
428 Ga0495583_0223551 3300046506 Bacteria 760
429 Ga0495606_0003973 3300046507 Bacteria 15146
430 Ga0495608_0014400 3300046511 Bacteria 5486
431 Ga0495608_0290679 3300046511 Bacteria 1013
432 Ga0495610_0086203 3300046512 Bacteria 1431
433 Ga0495616_0002179 3300046513 Bacteria 13097
434 Ga0495618_0125522 3300046514 Bacteria 1643
435 Ga0495620_0043132 3300046515 Bacteria 1966
436 Ga0495620_0072462 3300046515 Bacteria 1406
437 Ga0495628_0048518 3300046516 Bacteria 3365
438 Ga0495628_0120604 3300046516 Bacteria 2012
439 Ga0495628_0156821 3300046516 Bacteria 1731
440 Ga0495628_0244786 3300046516 Bacteria 1340
441 Ga0495630_0038818 3300046517 Bacteria 3562
442 Ga0495630_0096451 3300046517 Bacteria 2235
443 Ga0495630_0503182 3300046517 Bacteria 929
444 Ga0495631_0013527 3300046518 Bacteria 3959
445 Ga0495632_0135029 3300046519 Bacteria 1147
446 Ga0495643_0003401 3300046522 Bacteria 11692
447 Ga0495643_0213549 3300046522 Bacteria 919
448 Ga0495648_0064384 3300046524 Bacteria 2160
449 Ga0495648_0354173 3300046524 Bacteria 669
450 Ga0495666_0009784 3300046526 Bacteria 4791
451 Ga0495666_0051653 3300046526 Bacteria 1974
452 Ga0495666_0089204 3300046526 Bacteria 1456
453 Ga0495666_0154936 3300046526 Bacteria 1064
454 Ga0495642_0124606 3300046528 Bacteria 1107
455 Ga0495652_0082633 3300046529 Bacteria 2646
456 Ga0495652_0260976 3300046529 Bacteria 1279
457 Ga0495665_0014306 3300046531 Bacteria 4281
458 Ga0495665_0661401 3300046531 Bacteria 520
459 Ga0495640_0000601 3300046533 Bacteria 26498
460 Ga0495640_0038975 3300046533 Bacteria 3338
461 Ga0495640_0133597 3300046533 Bacteria 1604
462 Ga0495640_0146857 3300046533 Bacteria 1517
463 Ga0495586_0035391 3300046535 Bacteria 2683
464 Ga0495587_0011922 3300046536 Bacteria 5494
465 Ga0495587_0148998 3300046536 Bacteria 1333
466 Ga0495609_0090821 3300046538 Bacteria 1328
467 Ga0495597_0006030 3300046542 Bacteria 6317
468 Ga0495645_0016653 3300046543 Bacteria 5254
469 Ga0495645_0637015 3300046543 Bacteria 652
470 Ga0495622_0006294 3300046557 Bacteria 5513
471 Ga0495622_0068079 3300046557 Bacteria 1644
472 Ga0495633_0385122 3300046558 Bacteria 634
473 Ga0495667_0096721 3300046559 Bacteria 1911
474 Ga0495667_0116416 3300046559 Bacteria 1726
475 Ga0495656_0284895 3300046615 Bacteria 843
476 Ga0495668_0036836 3300046616 Bacteria 2739
477 Ga0495668_0439714 3300046616 Bacteria 717
478 Ga0495634_0003156 3300046642 Bacteria 13347
479 Ga0495634_0010839 3300046642 Bacteria 6664
480 Ga0495634_0034929 3300046642 Bacteria 3447
481 Ga0495634_0283662 3300046642 Bacteria 1005
482 Ga0495611_0037273 3300046648 Bacteria 2160
483 Ga0495611_0104938 3300046648 Bacteria 1314
484 Ga0495611_0130392 3300046648 Bacteria 1172
485 Ga0495611_0380123 3300046648 Bacteria 646
486 Ga0495625_0056521 3300046660 Bacteria 2793
487 Ga0495625_0150379 3300046660 Bacteria 1565
488 Ga0495625_0215669 3300046660 Bacteria 1260
489 Ga0495625_0404363 3300046660 Bacteria 852
490 Ga0495625_0610848 3300046660 Bacteria 653
491 Ga0495625_0654791 3300046660 Bacteria 625
492 Ga0495635_0000315 3300046663 Bacteria 31453
493 Ga0495635_0030325 3300046663 Bacteria 3757
494 Ga0495635_0055882 3300046663 Bacteria 2719
495 Ga0495661_0079304 3300046665 Bacteria 1897
496 Ga0495588_0012700 3300046674 Bacteria 3989
497 Ga0495588_0013520 3300046674 Bacteria 3891
498 Ga0495588_0037060 3300046674 Bacteria 2476
499 Ga0495657_0001674 3300046675 Bacteria 19020
500 Ga0495657_0003809 3300046675 Bacteria 12210
501 Ga0495657_0009737 3300046675 Bacteria 7255
502 Ga0495657_0053430 3300046675 Bacteria 2703
503 Ga0495599_0069940 3300046678 Bacteria 2190
504 Ga0495599_0627400 3300046678 Bacteria 624
505 Ga0495623_0035471 3300046679 Bacteria 3196
506 Ga0495623_0130404 3300046679 Bacteria 1506
507 Ga0495623_0225894 3300046679 Bacteria 1064
508 Ga0495646_0002621 3300046680 Bacteria 11098
509 Ga0495646_0030520 3300046680 Bacteria 3365
510 Ga0495646_0205744 3300046680 Bacteria 1070
511 Ga0495647_0147443 3300046681 Bacteria 1007
512 Ga0495647_0407909 3300046681 Bacteria 625
513 Ga0495658_0037067 3300046683 Bacteria 2694
514 Ga0495669_0004360 3300046684 Bacteria 5839
515 Ga0495613_0001781 3300046689 Bacteria 16365
516 Ga0495613_0004939 3300046689 Bacteria 10018
517 Ga0495613_0005385 3300046689 Bacteria 9612
518 Ga0495613_0013302 3300046689 Bacteria 6113
519 Ga0495613_0015359 3300046689 Bacteria 5693
520 Ga0495613_0389786 3300046689 Bacteria 952
521 Ga0495624_0111996 3300046690 Bacteria 1677
522 Ga0495624_0891397 3300046690 Bacteria 524
523 Ga0495670_0454072 3300046691 Bacteria 694
524 Ga0495671_0364716 3300046692 Bacteria 692
525 Ga0495671_0469443 3300046692 Bacteria 601
526 Ga0495649_0025591 3300046694 Bacteria 3287
527 Ga0495649_0177725 3300046694 Bacteria 1111
528 Ga0495589_0018380 3300046794 Bacteria 3584
529 Ga0495589_0030028 3300046794 Bacteria 2739
530 Ga0495589_0085998 3300046794 Bacteria 1527
531 Ga0495589_0113013 3300046794 Bacteria 1310
532 Ga0495589_0151110 3300046794 Bacteria 1109
533 Ga0495600_0032906 3300046809 Bacteria 3364
534 Ga0495600_0556163 3300046809 Bacteria 700
535 Ga0495660_0045431 3300046810 Bacteria 2411
536 Ga0495660_0063969 3300046810 Bacteria 1967
537 Ga0495660_0511420 3300046810 Bacteria 512
538 Ga0495581_0008162 3300047315 Bacteria 6062
539 Ga0495581_0080251 3300047315 Bacteria 1888
540 Ga0495581_0118555 3300047315 Bacteria 1540
541 Ga0495581_0246337 3300047315 Bacteria 1045
542 Ga0495581_0450797 3300047315 Bacteria 749
543 Ga0495604_0000708 3300047317 Bacteria 28349
544 Ga0495604_0002256 3300047317 Bacteria 15442
545 Ga0495604_0018254 3300047317 Bacteria 5617
546 Ga0495636_0001078 3300047318 Bacteria 10256
547 Ga0495636_0008407 3300047318 Bacteria 4073
548 Ga0495636_0033757 3300047318 Bacteria 2104
549 Ga0495636_0343719 3300047318 Bacteria 703
550 Ga0495674_0005206 3300047319 Bacteria 12491
551 Ga0495672_0112404 3300047320 Bacteria 1460
552 Ga0495676_0004649 3300047321 Bacteria 12574
553 Ga0495676_0009141 3300047321 Bacteria 9033
554 Ga0495676_0015618 3300047321 Bacteria 6754
555 Ga0495676_0019396 3300047321 Bacteria 5981
556 Ga0495676_0020839 3300047321 Bacteria 5742
557 Ga0495676_0023170 3300047321 Bacteria 5391
558 Ga0495676_0643017 3300047321 Bacteria 689
559 Ga0495680_0109839 3300047322 Bacteria 2044
560 Ga0495683_0140588 3300047323 Bacteria 1131
561 Ga0495687_003376 3300047443 Bacteria 11653
562 Ga0495687_005470 3300047443 Bacteria 8084
563 Ga0495687_014353 3300047443 Bacteria 4082
564 Ga0495687_059187 3300047443 Bacteria 1586
565 Ga0495687_069874 3300047443 Bacteria 1412
566 Ga0495687_083794 3300047443 Bacteria 1240
567 Ga0495687_095181 3300047443 Bacteria 1130
568 Ga0495687_182909 3300047443 Bacteria 682
569 Ga0495675_0047597 3300047444 Bacteria 2728
570 Ga0495685_034543 3300047447 Bacteria 1737
571 Ga0495685_043452 3300047447 Bacteria 1533
572 Ga0495685_044360 3300047447 Bacteria 1516
573 Ga0495685_061215 3300047447 Bacteria 1268
574 Ga0495685_074184 3300047447 Bacteria 1137
575 Ga0495685_126188 3300047447 Bacteria 838
576 Ga0495681_0003263 3300047470 Bacteria 11314
577 Ga0495684_0278535 3300047471 Bacteria 1207
578 Ga0495684_0521689 3300047471 Bacteria 813
579 Ga0495686_0030954 3300047472 Bacteria 3473
580 Ga0495593_0044651 3300047673 Bacteria 2369
581 Ga0495593_0102180 3300047673 Bacteria 1470
582 Ga0495593_0547414 3300047673 Bacteria 580
583 Ga0495602_0087836 3300048088 Bacteria 2590
584 Ga0495602_0203806 3300048088 Bacteria 1507
585 Ga0495602_0461543 3300048088 Bacteria 894
586 Ga0495614_0006496 3300048089 Bacteria 5247
587 Ga0495614_0011415 3300048089 Bacteria 3911
588 Ga0495614_0019582 3300048089 Bacteria 2928
589 Ga0495614_0150532 3300048089 Bacteria 1038
590 Ga0495614_0439118 3300048089 Bacteria 617
591 Ga0495626_0011919 3300048091 Bacteria 4577
592 Ga0496100_1048838 3300048903 Bacteria 642
593 Ga0496102_1339960 3300048905 Bacteria 635
594 Ga0496104_0426665 3300048907 Bacteria 1238
595 Ga0496104_0453109 3300048907 Bacteria 1195
596 Ga0496105_0653860 3300048908 Bacteria 811
597 Ga0496105_0691164 3300048908 Bacteria 784
598 Ga0496106_0065276 3300048909 Bacteria 2771
599 Ga0496108_0157794 3300048911 Bacteria 1959
600 Ga0496108_0740826 3300048911 Bacteria 850
601 Ga0496109_0059760 3300048912 Bacteria 3483
602 Ga0496109_0441182 3300048912 Bacteria 1230
603 Ga0496109_0973898 3300048912 Bacteria 786
604 Ga0496110_0547669 3300048913 Bacteria 1052
605 Ga0496114_0016357 3300048917 Bacteria 5975
606 Ga0496114_0205471 3300048917 Bacteria 1726
607 Ga0496114_0733806 3300048917 Bacteria 864
608 Ga0496115_0596074 3300048918 Bacteria 879
609 Ga0495682_0337968 3300049460 Bacteria 531
610 Ga0501031_0026048 3300049568 Bacteria 3814
611 Ga0501032_0016306 3300049569 Bacteria 5227
612 Ga0501032_0041770 3300049569 Bacteria 3113
613 Ga0501032_0378797 3300049569 Bacteria 910
614 Ga0501033_0025313 3300049570 Bacteria 4469
615 Ga0501033_0040546 3300049570 Bacteria 3475
616 Ga0501033_0069325 3300049570 Bacteria 2592
617 Ga0501033_0360033 3300049570 Bacteria 1018
618 Ga0501033_0728292 3300049570 Bacteria 673
619 Ga0501034_0001719 3300049571 Bacteria 28178
620 Ga0501034_0037309 3300049571 Bacteria 4920
621 Ga0501034_0264121 3300049571 Bacteria 1663
622 Ga0501034_0504303 3300049571 Bacteria 1124
623 Ga0501036_0006468 3300049572 Bacteria 9518
624 Ga0501036_0008623 3300049572 Bacteria 8365
625 Ga0501036_0009238 3300049572 Bacteria 8105
626 Ga0501036_0155580 3300049572 Bacteria 1928
627 Ga0501036_0797349 3300049572 Bacteria 778
628 Ga0501037_0035455 3300049573 Bacteria 3679
629 Ga0501037_1061995 3300049573 Bacteria 526
630 Ga0501038_0039784 3300049574 Bacteria 4112
631 Ga0501038_0128824 3300049574 Bacteria 2080
632 Ga0501038_0465471 3300049574 Bacteria 971
633 Ga0501038_0576800 3300049574 Bacteria 853
634 Ga0501039_0015271 3300049575 Bacteria 5878
635 Ga0501039_0020427 3300049575 Bacteria 5075
636 Ga0501039_0870121 3300049575 Bacteria 702
637 Ga0501039_0922782 3300049575 Bacteria 679
638 Ga0501040_0054853 3300049576 Bacteria 2732
639 Ga0501040_0649676 3300049576 Bacteria 762
640 Ga0501041_0006424 3300049577 Bacteria 6879
641 Ga0501042_0013215 3300049578 Bacteria 5620
642 Ga0501042_0236714 3300049578 Bacteria 1317
643 Ga0501043_0002922 3300049579 Bacteria 14262
644 Ga0501043_0069431 3300049579 Bacteria 2767
645 Ga0501043_0090452 3300049579 Bacteria 2406
646 Ga0501043_0205766 3300049579 Bacteria 1526
647 Ga0501046_0067865 3300049580 Bacteria 2776
648 Ga0501046_0208630 3300049580 Bacteria 1451
649 Ga0501047_0005559 3300049581 Bacteria 11868
650 Ga0501047_0052000 3300049581 Bacteria 3959
651 Ga0501047_0185166 3300049581 Bacteria 1948
652 Ga0501047_0336865 3300049581 Bacteria 1346
653 Ga0501047_0732532 3300049581 Unclassified 805
654 Ga0501047_0892245 3300049581 Bacteria 702
655 Ga0501048_0010780 3300049582 Bacteria 6814
656 Ga0501067_0004952 3300049583 Bacteria 7399
657 Ga0501069_0010547 3300049585 Bacteria 4893
658 Ga0501069_0935819 3300049585 Bacteria 528
659 Ga0501070_0007029 3300049586 Bacteria 9575
660 Ga0501070_0028846 3300049586 Bacteria 4652
661 Ga0501070_0040845 3300049586 Bacteria 3866
662 Ga0501070_0519300 3300049586 Bacteria 956
663 Ga0501071_0058498 3300049587 Bacteria 2787
664 Ga0501071_1161444 3300049587 Bacteria 596
665 Ga0501072_0009396 3300049588 Bacteria 7435
666 Ga0501072_0859171 3300049588 Bacteria 709
667 Ga0501073_0209044 3300049589 Bacteria 1349
668 Ga0501073_0290773 3300049589 Bacteria 1127
669 Ga0501073_0334840 3300049589 Bacteria 1045
670 Ga0501073_0387135 3300049589 Bacteria 966
671 Ga0501074_0015294 3300049590 Bacteria 5577
672 Ga0501074_0179707 3300049590 Bacteria 1509
673 Ga0501074_0551842 3300049590 Bacteria 816
674 Ga0501076_0029701 3300049592 Bacteria 4253
675 Ga0501077_0012757 3300049593 Bacteria 5264
676 Ga0501077_0501702 3300049593 Bacteria 778
677 Ga0501077_0813978 3300049593 Bacteria 601
678 Ga0501209_259330 3300049656 Bacteria 544
679 Ga0501079_0017684 3300049741 Bacteria 5445
680 Ga0501080_0026223 3300049742 Bacteria 5415
681 Ga0501080_1030441 3300049742 Bacteria 713
682 Ga0501083_0003666 3300049744 Bacteria 10782
683 Ga0501035_0106099 3300049822 Bacteria 2463
684 Ga0501035_0801042 3300049822 Bacteria 752
685 Ga0501044_0009361 3300049823 Bacteria 10678
686 Ga0501044_0022612 3300049823 Bacteria 6698
687 Ga0501044_0046477 3300049823 Bacteria 4493
688 Ga0501044_0058188 3300049823 Bacteria 3964
689 Ga0501044_0609680 3300049823 Bacteria 984
690 Ga0501045_0026969 3300049824 Bacteria 4135
691 Ga0501045_0320263 3300049824 Bacteria 1154
692 nmdc:mga03n38_141181_c1 3300050490 Bacteria 1203
693 nmdc:mga03n38_564095_c1 3300050490 Bacteria 645
694 nmdc:mga05p37_1492564_c1 3300050507 Bacteria 674
695 nmdc:mga05p37_278284_c1 3300050507 Bacteria 1997
696 nmdc:mga09592_801557_c1 3300050508 Bacteria 797
697 Ga0495601_0091773 3300053077 Bacteria 1955
698 Ga0495601_0121407 3300053077 Bacteria 1697
699 Ga0495601_0341737 3300053077 Bacteria 974
700 Ga0495612_0020678 3300053078 Bacteria 2638
701 Ga0495612_0102620 3300053078 Bacteria 1219
702 Ga0495612_0525642 3300053078 Bacteria 544
703 Ga0500610_0293271 3300053079 Bacteria 722
704 Ga0495655_0027403 3300053083 Bacteria 1351
705 Ga0495619_0016991 3300053085 Bacteria 4611
706 Ga0495619_0164055 3300053085 Bacteria 1535
707 Ga0500644_0133400 3300053088 Bacteria 980
708 Ga0500650_0128845 3300053098 Bacteria 1177
709 Ga0500553_041386 3300053101 Bacteria 2257
710 Ga0500558_285957 3300053106 Bacteria 522
711 Ga0500560_144712 3300053107 Bacteria 791
712 Ga0500572_020536 3300053111 Bacteria 1739
713 Ga0500608_363031 3300053122 Bacteria 508
714 Ga0500614_116761 3300053123 Bacteria 783
715 Ga0500559_0370910 3300053136 Bacteria 668
716 Ga0500573_0207251 3300053140 Bacteria 1037
717 Ga0500600_0091346 3300053149 Bacteria 1625
718 Ga0500624_010093 3300053157 Bacteria 1354
719 Ga0500634_0213012 3300053161 Bacteria 837
720 Ga0501084_0005603 3300054114 Bacteria 10311
721 Ga0501084_0513296 3300054114 Bacteria 1013
722 Ga0587076_167803 3300059645 Bacteria 544
723 Ga0501082_0011682 3300060353 Bacteria 7549
724 Ga0466962_0000340 3300061719 Bacteria 20024
725 Ga0466962_0000544 3300061719 Bacteria 16587
726 Ga0466962_0036422 3300061719 Bacteria 2355
727 Ga0530510_0228227 3300061734 Bacteria 1385
728 2919446841 2919443155 Bacteria 4072969
729 2995469546 2995463766 Bacteria 8577691
730 3006326958 3006321560 Bacteria 8247479
731 8056668827 8056667051 Bacteria 6953971
732 Ga0495652_0118466
733 LJQas_1008657
734 JGI25406J46586_10023694
735 rootH1_10015850
736 rootL2_10142599
737 rootH1_10019902
738 JGI25160J50197_1018068
739 JGI25160J50197_1023273
740 JGI25160J50197_1023353
741 Ga0007429J51699_1025479
742 Ga0058863_11714285
743 Ga0058862_11821698
744 Ga0070658_10004159
745 Ga0070658_10144585
746 Ga0070658_10170787
747 Ga0070658_10201882
748 Ga0070658_11502276
749 Ga0070683_100271525
750 Ga0070683_100476344
751 Ga0070683_100637817
752 Ga0070677_10436096
753 Ga0068869_100024248
754 Ga0070666_11087232
755 Ga0070680_100000215
756 Ga0070682_100162740
757 Ga0068868_100023128
758 Ga0068868_100293598
759 Ga0068868_101466155
760 Ga0070660_100053693
761 Ga0070660_100637530
762 Ga0070691_10396294
763 Ga0070687_100235702
764 Ga0070692_10041444
765 Ga0070692_10798645
766 Ga0070668_100821742
767 Ga0070675_101271694
768 Ga0070671_100580707
769 Ga0070674_100061314
770 Ga0070674_100365820
771 Ga0070673_100172389
772 Ga0070673_101520662
773 Ga0070673_101619539
774 Ga0070688_100638414
775 Ga0070659_100007849
776 Ga0070659_101350926
777 Ga0070714_101239708
778 Ga0070701_10080296
779 Ga0070663_100612286
780 Ga0070663_100816217
781 Ga0070663_101278574
782 Ga0070678_100385302
783 Ga0070678_101257750
784 Ga0070678_101825019
785 Ga0070662_101299311
786 Ga0070681_10000019
787 Ga0070681_10720038
788 Ga0070681_11099898
789 Ga0070698_101323823
790 Ga0070679_100001348
791 Ga0070679_100641752
792 Ga0070684_100087656
793 Ga0070684_100279204
794 Ga0070684_100847841
795 Ga0070684_101375022
796 Ga0070684_101412399
797 Ga0068853_100122082
798 Ga0068853_101780744
799 Ga0070672_100179930
800 Ga0070686_100094462
801 Ga0070665_100324695
802 Ga0070665_100621147
803 Ga0070665_101204613
804 Ga0068855_101437234
805 Ga0068852_100354424
806 Ga0068852_101431667
807 Ga0068864_100567164
808 Ga0068866_10436225
809 Ga0068870_10653224
810 Ga0068863_101651159
811 Ga0068862_100401561
812 Ga0081455_10070782
813 Ga0081455_11020755
814 Ga0081539_10000479
815 Ga0075365_11199996
816 Ga0075363_100178875
817 Ga0075363_100351346
818 Ga0075370_10238941
819 Ga0075428_100901457
820 Ga0075433_10804967
821 Ga0075434_102097764
822 Ga0099826_10501639
823 Ga0105250_10104785
824 Ga0111539_11424732
825 Ga0105245_10058347
826 Ga0105245_10190415
827 Ga0105245_10780675
828 Ga0105245_11063469
829 Ga0105245_11590952
830 Ga0105245_11677303
831 Ga0114129_10916914
832 Ga0114129_11174260
833 Ga0105243_10045776
834 Ga0105243_12395511
835 Ga0105241_12110881
836 Ga0105242_10271509
837 Ga0105242_10290140
838 Ga0105242_11473826
839 Ga0105242_11656672
840 Ga0105237_10043356
841 Ga0105238_11554853
842 Ga0105249_10348471
843 Ga0105249_13492037
844 Ga0105239_10544153
845 Ga0105239_11596067
846 Ga0105239_12517670
847 Ga0105246_10109244
848 Ga0105246_11193536
849 Ga0157373_10317809
850 Ga0157373_11135124
851 Ga0157370_10010583
852 Ga0157369_10536157
853 Ga0157369_11516587
854 Ga0157369_12339676
855 Ga0157369_12613902
856 Ga0157374_10713708
857 Ga0157374_11120127
858 Ga0157374_11181736
859 Ga0157378_11420385
860 Ga0157378_11893969
861 Ga0157378_12097156
862 Ga0163162_12336516
863 Ga0157372_10259480
864 Ga0157372_10417370
865 Ga0157372_11885625
866 Ga0157372_12423316
867 Ga0157372_12643599
868 Ga0157375_10219539
869 Ga0157375_11916112
870 Ga0157375_13318643
871 Ga0163163_10422691
872 Ga0157380_10719250
873 Ga0157380_11233185
874 Ga0157377_11178584
875 Ga0157379_11584812
876 Ga0157376_11416703
877 Ga0157376_11538809
878 Ga0163161_10035610
879 Ga0197907_10474894
880 Ga0206356_10819511
881 Ga0206352_10231614
882 Ga0206350_11556875
883 Ga0206354_11374769
884 Ga0206354_11711784
885 Ga0206353_10047350
886 Ga0206353_11141798
887 Ga0206353_11664766
888 Ga0213875_10030561
889 Ga0224712_10000799
890 Ga0224712_10154764
891 Ga0224712_10493855
892 Ga0207426_1000911
893 Ga0207426_1001346
894 Ga0207426_1047697
895 Ga0207682_10097460
896 Ga0207688_10074365
897 Ga0207705_10024296
898 Ga0207705_10052754
899 Ga0207705_10429077
900 Ga0207684_10119489
901 Ga0207707_10000046
902 Ga0207707_10804844
903 Ga0207671_10025620
904 Ga0207660_10001571
905 Ga0207660_11436103
906 Ga0207662_10241339
907 Ga0207662_10414341
908 Ga0207657_10316380
909 Ga0207657_11194141
910 Ga0207652_10003303
911 Ga0207652_10434240
912 Ga0207646_11042188
913 Ga0207694_11662176
914 Ga0207659_11076023
915 Ga0207659_11776625
916 Ga0207687_10059653
917 Ga0207687_10193854
918 Ga0207664_11501042
919 Ga0207690_10000087
920 Ga0207690_10036753
921 Ga0207690_10883006
922 Ga0207690_11457078
923 Ga0207686_10492868
924 Ga0207686_11196147
925 Ga0207709_10159890
926 Ga0207669_10105884
927 Ga0207669_10872125
928 Ga0207665_11044470
929 Ga0207691_10173309
930 Ga0207691_11373555
931 Ga0207711_10991563
932 Ga0207689_10077211
933 Ga0207661_10303465
934 Ga0207679_11677899
935 Ga0207667_11082957
936 Ga0207651_10972462
937 Ga0207651_12002986
938 Ga0207712_11190235
939 Ga0207668_11804322
940 Ga0207677_10005107
941 Ga0207677_10577294
942 Ga0207677_11710886
943 Ga0207639_10158536
944 Ga0207678_10049840
945 Ga0207678_10255796
946 Ga0207678_10484151
947 Ga0207678_10498616
948 Ga0207641_11987328
949 Ga0207648_11761129
950 Ga0207676_10496959
951 Ga0207675_100539382
952 Ga0207675_101118800
953 Ga0207683_10238732
954 Ga0207683_10350072
955 Ga0207683_10837368
956 Ga0207698_10963814
957 Ga0207698_11160631
958 Ga0268266_10313234
959 Ga0268266_10602577
960 Ga0307517_10008743
961 Ga0307515_10000325
962 Ga0307515_10040244
963 Ga0307515_10337220
964 Ga0265338_10477781
965 Ga0307511_10000010
966 Ga0307511_10023329
967 Ga0307511_10086730
968 Ga0307512_10123845
969 Ga0265325_10032702
970 Ga0307513_10011395
971 Ga0307513_10141324
972 Ga0307509_10006748
973 Ga0307509_10007319
974 Ga0307509_10217935
975 Ga0307408_100735396
976 Ga0307408_101719897
977 Ga0307508_10236605
978 Ga0307508_10292414
979 Ga0307514_10103178
980 Ga0307514_10137806
981 Ga0307516_10029243
982 Ga0307518_10058965
983 Ga0307410_11165528
984 Ga0307412_11418573
985 Ga0307409_100876613
986 Ga0307409_101627421
987 Ga0307416_100555411
988 Ga0307416_100886389
989 Ga0307414_11048701
990 Ga0307411_11218486
991 Ga0307411_12306748
992 Ga0307415_100989368
993 Ga0307415_101063689
994 Ga0307415_101234358
995 Ga0316593_10222179
996 Ga0307507_10000017
997 Ga0307507_10009781
998 Ga0307507_10096223
999 Ga0307510_10006935
1000 Ga0307510_10009726
1001 Ga0307510_10429035
1002 Ga0316596_1059953
1003 Ga0373946_0550303
1004 Ga0373955_0576937
1005 Ga0373935_0217506
1006 Ga0373933_0088389
1007 Ga0373947_0044793
1008 Ga0373937_0009931
1009 Ga0316582_0013953
1010 Ga0395900_0075214
1011 Ga0395900_0238964
1012 Ga0395900_0700482
1013 Ga0395898_0002046
1014 Ga0395898_0197376
1015 Ga0395898_0648881
1016 Ga0395898_1575143
1017 Ga0395905_1208835
1018 Ga0436364_0116545
1019 Ga0436364_1364354
1020 Ga0395901_0102550
1021 Ga0395901_0280019
1022 Ga0395901_0372500
1023 Ga0436363_1379767
1024 Ga0436362_1238058
1025 Ga0451793_0594397
1026 Ga0451797_0389516
1027 Ga0451795_1556856
1028 Ga0451802_0790062
1029 Ga0451802_1999616
1030 Ga0451804_0813560
1031 Ga0451807_0065561
1032 Ga0451833_0572314
1033 Ga0451833_0941305
1034 Ga0451837_0836637
1035 Ga0451841_0309167
1036 Ga0451849_0671702
1037 Ga0451849_0787754
1038 Ga0451851_0439997
1039 Ga0451843_0585716
1040 Ga0451853_0644947
1041 Ga0451853_1295071
1042 Ga0451853_2582090
1043 Ga0439448_0000998
1044 Ga0439450_041379
1045 Ga0439455_0000753
1046 Ga0450903_001241
1047 Ga0439458_0000266
1048 Ga0439458_0023738
1049 Ga0466969_0009890
1050 Ga0466969_0044935
1051 Ga0466969_0071966
1052 Ga0466969_0405996
1053 Ga0466972_0004287
1054 Ga0466972_0087747
1055 Ga0466965_0009387
1056 Ga0466965_0127554
1057 Ga0466965_0788634
1058 Ga0466965_0829155
1059 Ga0466965_0859459
1060 Ga0466966_0000456
1061 Ga0466966_0014511
1062 Ga0466966_0015414
1063 Ga0466966_0043666
1064 Ga0466966_0266104
1065 Ga0466961_0000862
1066 Ga0466961_0002796
1067 Ga0466961_0003411
1068 Ga0466961_0035241
1069 Ga0466961_0042677
1070 Ga0466961_0168397
1071 Ga0466961_0208141
1072 Ga0466961_0381109
1073 Ga0466961_0633654
1074 Ga0466961_0691908
1075 Ga0466963_0001691
1076 Ga0466963_0009011
1077 Ga0466963_0270014
1078 Ga0466963_0596727
1079 Ga0466963_0717600
1080 Ga0466963_0941871
1081 Ga0466963_1274588
1082 Ga0466964_0015148
1083 Ga0466964_0826657
1084 Ga0466971_0000175
1085 Ga0466971_0000235
1086 Ga0466971_0160426
1087 Ga0466971_0205273
1088 Ga0466971_0540832
1089 Ga0466968_0019572
1090 Ga0466968_0099494
1091 Ga0466970_0002379
1092 Ga0466970_0033291
1093 Ga0466970_0970915
1094 Ga0466957_0000357
1095 Ga0466957_0012868
1096 Ga0466957_0063918
1097 Ga0466957_0236504
1098 Ga0466957_0559456
1099 Ga0466957_1393270
1100 Ga0466959_0000302
1101 Ga0466959_0000965
1102 Ga0466959_0024342
1103 Ga0466959_0054593
1104 Ga0466959_0192864
1105 Ga0466959_0950829
1106 Ga0466958_0000082
1107 Ga0466958_0123677
1108 Ga0466958_0993606
1109 Ga0466958_1018259
1110 Ga0466967_0002873
1111 Ga0466967_0011599
1112 Ga0466967_0139995
1113 Ga0466967_0257678
1114 Ga0466967_0483836
1115 Ga0466967_0798610
1116 Ga0495617_022623
1117 Ga0495627_194031
1118 Ga0495592_0009668
1119 Ga0495592_0054685
1120 Ga0495592_0503085
1121 Ga0495603_0004796
1122 Ga0495603_0007000
1123 Ga0495603_0009932
1124 Ga0495603_0010268
1125 Ga0495603_0206390
1126 Ga0495629_0003791
1127 Ga0495629_0016312
1128 Ga0495629_0021371
1129 Ga0495629_0052224
1130 Ga0495629_0068073
1131 Ga0495629_0135493
1132 Ga0495629_0290698
1133 Ga0495629_0883353
1134 Ga0495638_0033893
1135 Ga0495638_0070486
1136 Ga0495651_0065044
1137 Ga0495651_0116395
1138 Ga0495651_0448988
1139 Ga0495653_0035507
1140 Ga0495580_0061262
1141 Ga0495582_0093088
1142 Ga0495605_0001251
1143 Ga0495639_0097557
1144 Ga0495662_0002690
1145 Ga0495662_0005342
1146 Ga0495662_0035156
1147 Ga0495662_0528869
1148 Ga0495664_0002229
1149 Ga0495664_0017350
1150 Ga0495664_0772506
1151 Ga0495584_0074369
1152 Ga0495594_0002086
1153 Ga0495594_0828783
1154 Ga0495596_0114528
1155 Ga0495607_0023972
1156 Ga0495607_0314928
1157 Ga0495583_0040981
1158 Ga0495583_0081375
1159 Ga0495583_0223551
1160 Ga0495606_0003973
1161 Ga0495608_0014400
1162 Ga0495608_0290679
1163 Ga0495610_0086203
1164 Ga0495616_0002179
1165 Ga0495618_0125522
1166 Ga0495620_0043132
1167 Ga0495620_0072462
1168 Ga0495628_0048518
1169 Ga0495628_0120604
1170 Ga0495628_0156821
1171 Ga0495628_0244786
1172 Ga0495630_0038818
1173 Ga0495630_0096451
1174 Ga0495630_0503182
1175 Ga0495631_0013527
1176 Ga0495632_0135029
1177 Ga0495643_0003401
1178 Ga0495643_0213549
1179 Ga0495648_0064384
1180 Ga0495648_0354173
1181 Ga0495666_0009784
1182 Ga0495666_0051653
1183 Ga0495666_0089204
1184 Ga0495666_0154936
1185 Ga0495642_0124606
1186 Ga0495652_0082633
1187 Ga0495652_0260976
1188 Ga0495665_0014306
1189 Ga0495665_0661401
1190 Ga0495640_0000601
1191 Ga0495640_0038975
1192 Ga0495640_0133597
1193 Ga0495640_0146857
1194 Ga0495586_0035391
1195 Ga0495587_0011922
1196 Ga0495587_0148998
1197 Ga0495609_0090821
1198 Ga0495597_0006030
1199 Ga0495645_0016653
1200 Ga0495645_0637015
1201 Ga0495622_0006294
1202 Ga0495622_0068079
1203 Ga0495633_0385122
1204 Ga0495667_0096721
1205 Ga0495667_0116416
1206 Ga0495656_0284895
1207 Ga0495668_0036836
1208 Ga0495668_0439714
1209 Ga0495634_0003156
1210 Ga0495634_0010839
1211 Ga0495634_0034929
1212 Ga0495634_0283662
1213 Ga0495611_0037273
1214 Ga0495611_0104938
1215 Ga0495611_0130392
1216 Ga0495611_0380123
1217 Ga0495625_0056521
1218 Ga0495625_0150379
1219 Ga0495625_0215669
1220 Ga0495625_0404363
1221 Ga0495625_0610848
1222 Ga0495625_0654791
1223 Ga0495635_0000315
1224 Ga0495635_0030325
1225 Ga0495635_0055882
1226 Ga0495661_0079304
1227 Ga0495588_0012700
1228 Ga0495588_0013520
1229 Ga0495588_0037060
1230 Ga0495657_0001674
1231 Ga0495657_0003809
1232 Ga0495657_0009737
1233 Ga0495657_0053430
1234 Ga0495599_0069940
1235 Ga0495599_0627400
1236 Ga0495623_0035471
1237 Ga0495623_0130404
1238 Ga0495623_0225894
1239 Ga0495646_0002621
1240 Ga0495646_0030520
1241 Ga0495646_0205744
1242 Ga0495647_0147443
1243 Ga0495647_0407909
1244 Ga0495658_0037067
1245 Ga0495669_0004360
1246 Ga0495613_0001781
1247 Ga0495613_0004939
1248 Ga0495613_0005385
1249 Ga0495613_0013302
1250 Ga0495613_0015359
1251 Ga0495613_0389786
1252 Ga0495624_0111996
1253 Ga0495624_0891397
1254 Ga0495670_0454072
1255 Ga0495671_0364716
1256 Ga0495671_0469443
1257 Ga0495649_0025591
1258 Ga0495649_0177725
1259 Ga0495589_0018380
1260 Ga0495589_0030028
1261 Ga0495589_0085998
1262 Ga0495589_0113013
1263 Ga0495589_0151110
1264 Ga0495600_0032906
1265 Ga0495600_0556163
1266 Ga0495660_0045431
1267 Ga0495660_0063969
1268 Ga0495660_0511420
1269 Ga0495581_0008162
1270 Ga0495581_0080251
1271 Ga0495581_0118555
1272 Ga0495581_0246337
1273 Ga0495581_0450797
1274 Ga0495604_0000708
1275 Ga0495604_0002256
1276 Ga0495604_0018254
1277 Ga0495636_0001078
1278 Ga0495636_0008407
1279 Ga0495636_0033757
1280 Ga0495636_0343719
1281 Ga0495674_0005206
1282 Ga0495672_0112404
1283 Ga0495676_0004649
1284 Ga0495676_0009141
1285 Ga0495676_0015618
1286 Ga0495676_0019396
1287 Ga0495676_0020839
1288 Ga0495676_0023170
1289 Ga0495676_0643017
1290 Ga0495680_0109839
1291 Ga0495683_0140588
1292 Ga0495687_003376
1293 Ga0495687_005470
1294 Ga0495687_014353
1295 Ga0495687_059187
1296 Ga0495687_069874
1297 Ga0495687_083794
1298 Ga0495687_095181
1299 Ga0495687_182909
1300 Ga0495675_0047597
1301 Ga0495685_034543
1302 Ga0495685_043452
1303 Ga0495685_044360
1304 Ga0495685_061215
1305 Ga0495685_074184
1306 Ga0495685_126188
1307 Ga0495681_0003263
1308 Ga0495684_0278535
1309 Ga0495684_0521689
1310 Ga0495686_0030954
1311 Ga0495593_0044651
1312 Ga0495593_0102180
1313 Ga0495593_0547414
1314 Ga0495602_0087836
1315 Ga0495602_0203806
1316 Ga0495602_0461543
1317 Ga0495614_0006496
1318 Ga0495614_0011415
1319 Ga0495614_0019582
1320 Ga0495614_0150532
1321 Ga0495614_0439118
1322 Ga0495626_0011919
1323 Ga0496100_1048838
1324 Ga0496102_1339960
1325 Ga0496104_0426665
1326 Ga0496104_0453109
1327 Ga0496105_0653860
1328 Ga0496105_0691164
1329 Ga0496106_0065276
1330 Ga0496108_0157794
1331 Ga0496108_0740826
1332 Ga0496109_0059760
1333 Ga0496109_0441182
1334 Ga0496109_0973898
1335 Ga0496110_0547669
1336 Ga0496114_0016357
1337 Ga0496114_0205471
1338 Ga0496114_0733806
1339 Ga0496115_0596074
1340 Ga0495682_0337968
1341 Ga0501031_0026048
1342 Ga0501032_0016306
1343 Ga0501032_0041770
1344 Ga0501032_0378797
1345 Ga0501033_0025313
1346 Ga0501033_0040546
1347 Ga0501033_0069325
1348 Ga0501033_0360033
1349 Ga0501033_0728292
1350 Ga0501034_0001719
1351 Ga0501034_0037309
1352 Ga0501034_0264121
1353 Ga0501034_0504303
1354 Ga0501036_0006468
1355 Ga0501036_0008623
1356 Ga0501036_0009238
1357 Ga0501036_0155580
1358 Ga0501036_0797349
1359 Ga0501037_0035455
1360 Ga0501037_1061995
1361 Ga0501038_0039784
1362 Ga0501038_0128824
1363 Ga0501038_0465471
1364 Ga0501038_0576800
1365 Ga0501039_0015271
1366 Ga0501039_0020427
1367 Ga0501039_0870121
1368 Ga0501039_0922782
1369 Ga0501040_0054853
1370 Ga0501040_0649676
1371 Ga0501041_0006424
1372 Ga0501042_0013215
1373 Ga0501042_0236714
1374 Ga0501043_0002922
1375 Ga0501043_0069431
1376 Ga0501043_0090452
1377 Ga0501043_0205766
1378 Ga0501046_0067865
1379 Ga0501046_0208630
1380 Ga0501047_0005559
1381 Ga0501047_0052000
1382 Ga0501047_0185166
1383 Ga0501047_0336865
1384 Ga0501047_0732532
1385 Ga0501047_0892245
1386 Ga0501048_0010780
1387 Ga0501067_0004952
1388 Ga0501069_0010547
1389 Ga0501069_0935819
1390 Ga0501070_0007029
1391 Ga0501070_0028846
1392 Ga0501070_0040845
1393 Ga0501070_0519300
1394 Ga0501071_0058498
1395 Ga0501071_1161444
1396 Ga0501072_0009396
1397 Ga0501072_0859171
1398 Ga0501073_0209044
1399 Ga0501073_0290773
1400 Ga0501073_0334840
1401 Ga0501073_0387135
1402 Ga0501074_0015294
1403 Ga0501074_0179707
1404 Ga0501074_0551842
1405 Ga0501076_0029701
1406 Ga0501077_0012757
1407 Ga0501077_0501702
1408 Ga0501077_0813978
1409 Ga0501209_259330
1410 Ga0501079_0017684
1411 Ga0501080_0026223
1412 Ga0501080_1030441
1413 Ga0501083_0003666
1414 Ga0501035_0106099
1415 Ga0501035_0801042
1416 Ga0501044_0009361
1417 Ga0501044_0022612
1418 Ga0501044_0046477
1419 Ga0501044_0058188
1420 Ga0501044_0609680
1421 Ga0501045_0026969
1422 Ga0501045_0320263
1423 nmdc:mga03n38_141181_c1
1424 nmdc:mga03n38_564095_c1
1425 nmdc:mga05p37_1492564_c1
1426 nmdc:mga05p37_278284_c1
1427 nmdc:mga09592_801557_c1
1428 Ga0495601_0091773
1429 Ga0495601_0121407
1430 Ga0495601_0341737
1431 Ga0495612_0020678
1432 Ga0495612_0102620
1433 Ga0495612_0525642
1434 Ga0500610_0293271
1435 Ga0495655_0027403
1436 Ga0495619_0016991
1437 Ga0495619_0164055
1438 Ga0500644_0133400
1439 Ga0500650_0128845
1440 Ga0500553_041386
1441 Ga0500558_285957
1442 Ga0500560_144712
1443 Ga0500572_020536
1444 Ga0500608_363031
1445 Ga0500614_116761
1446 Ga0500559_0370910
1447 Ga0500573_0207251
1448 Ga0500600_0091346
1449 Ga0500624_010093
1450 Ga0500634_0213012
1451 Ga0501084_0005603
1452 Ga0501084_0513296
1453 Ga0587076_167803
1454 Ga0501082_0011682
1455 Ga0466962_0000340
1456 Ga0466962_0000544
1457 Ga0466962_0036422
1458 Ga0530510_0228227
1459 2919446841
1460 2995469546
1461 3006326958
1462 8056668827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

5

69

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cz8-assembly1.cif.gz_D crystal structure of tt0972 protein from thermus thermophilus 0.9686 4 69
2vxa-assembly1.cif.gz_A h. halophila dodecin in complex with riboflavin 0.9632 4 68
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.9629 4 69
2vyx-assembly1.cif.gz_F crystal structure of the t. thermophilus dodecin w38f mutant 0.9624 4 69
2ux9-assembly1.cif.gz_C crystal structure of the t. thermophilus dodecin r65a mutant 0.9621 4 69
ID Description Score Start End Superfamily
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9326 5 68 3.30.1660.10
2vkfA00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9184 5 68 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9167 1 69 3.30.1660.10
3oqtP00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.9043 1 69 3.30.1660.10
3onrC00 Alpha Beta;2-Layer Sandwich;Dodecin subunit-like;Flavin-binding protein dodecin 0.8686 5 68 3.30.1660.10
ID Description Score Start End GO Terms
AF-E6J9C5-F1-model_v4 deleted 0.9919 4 69
AF-A0A399EKL6-F1-model_v4 Dodecin 0.9904 4 69
AF-A0A3C0JLN3-F1-model_v4 Dodecin domain-containing protein 0.9892 9 69
AF-A0A0P6XHX8-F1-model_v4 Dodecin flavoprotein 0.9879 4 69
AF-A0A511DGB1-F1-model_v4 Dodecin 0.9873 9 69

Map