F477976

General Info

Members Datasets Scaffolds Average Seq Length
731 244 1462 192

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10131632|Ga0265342_101316321
Length 196
Sequence MTQHDDKKMKKIITPLTDDVLKTLRAGDEVLLSGTVYTARDAAHKRMVKCLPAAGCRVAELPFVLNGAVIYYTGPSPEKPRQVIGSCGPTSSYRMDKYTSVLLEHGLKATIGKGTRSEEVKKAMKKNKAIYFAATGGAGALISKRVIKSEVIAYYELGCEAIRKLEVKDFPLVVINDIYGNDFYIDGRRQVTGNRQ

Samples

Sample ID Description Type Environment
1 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
232 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
237 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
238 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
239 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
240 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
241 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
242 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
243 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
244 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.14
Rhizoplane 0.41
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265342_10131632 3300031712 Bacteria 1401
2 JGI25406J46586_10017390 3300003203 Bacteria 2974
3 rootH1_10183144 3300003316 Bacteria 1480
4 rootL2_10180209 3300003322 Bacteria 1139
5 JGI26129J50193_1000967 3300003349 Bacteria 1893
6 Ga0065707_10390632 3300005295 Bacteria 865
7 Ga0070676_10001402 3300005328 Bacteria 12171
8 Ga0070683_100234008 3300005329 Bacteria 1747
9 Ga0070690_100086393 3300005330 Bacteria 2059
10 Ga0070670_100001558 3300005331 Bacteria 18473
11 Ga0068869_100000795 3300005334 Bacteria 18019
12 Ga0070680_100002409 3300005336 Bacteria 13849
13 Ga0070682_100000179 3300005337 Bacteria 47429
14 Ga0070660_100000476 3300005339 Bacteria 26750
15 Ga0070689_100073029 3300005340 Bacteria 2682
16 Ga0070691_10203984 3300005341 Bacteria 1040
17 Ga0070661_100000876 3300005344 Bacteria 21630
18 Ga0070692_10000828 3300005345 Bacteria 10344
19 Ga0070692_10046023 3300005345 Bacteria 2253
20 Ga0070692_10105200 3300005345 Bacteria 1553
21 Ga0070669_100277262 3300005353 Bacteria 1342
22 Ga0070675_100282656 3300005354 Bacteria 1458
23 Ga0070659_100153974 3300005366 Bacteria 1876
24 Ga0070703_10042571 3300005406 Bacteria 1420
25 Ga0070709_10910594 3300005434 Unclassified 696
26 Ga0070711_100109745 3300005439 Bacteria 2023
27 Ga0070705_100000333 3300005440 Bacteria 27695
28 Ga0070705_100101787 3300005440 Bacteria 1815
29 Ga0070705_100122966 3300005440 Bacteria 1679
30 Ga0070705_100438821 3300005440 Bacteria 977
31 Ga0070705_101146624 3300005440 Unclassified 638
32 Ga0070694_100008838 3300005444 Bacteria 6171
33 Ga0070694_100022054 3300005444 Bacteria 4078
34 Ga0070694_100075232 3300005444 Bacteria 2335
35 Ga0070694_100212070 3300005444 Bacteria 1449
36 Ga0070694_100220916 3300005444 Bacteria 1421
37 Ga0070694_100381886 3300005444 Bacteria 1099
38 Ga0070708_100016216 3300005445 Bacteria 6177
39 Ga0070708_100055617 3300005445 Bacteria 3519
40 Ga0070708_100061658 3300005445 Bacteria 3351
41 Ga0070708_100148004 3300005445 Bacteria 2182
42 Ga0070708_100159392 3300005445 Bacteria 2102
43 Ga0070708_100288505 3300005445 Bacteria 1545
44 Ga0070708_100337557 3300005445 Unclassified 1420
45 Ga0070663_100767945 3300005455 Unclassified 824
46 Ga0070662_100027815 3300005457 Bacteria 3931
47 Ga0070662_100471825 3300005457 Bacteria 1044
48 Ga0070662_100781398 3300005457 Unclassified 811
49 Ga0070681_10004124 3300005458 Bacteria 13743
50 Ga0070681_10387683 3300005458 Bacteria 1308
51 Ga0068867_100000455 3300005459 Bacteria 27140
52 Ga0068867_100194989 3300005459 Bacteria 1618
53 Ga0068867_100269575 3300005459 Bacteria 1391
54 Ga0068867_100491618 3300005459 Bacteria 1053
55 Ga0070706_100005118 3300005467 Bacteria 12509
56 Ga0070706_100031118 3300005467 Bacteria 4921
57 Ga0070706_100047684 3300005467 Bacteria 3954
58 Ga0070706_100077558 3300005467 Bacteria 3075
59 Ga0070706_100116134 3300005467 Bacteria 2492
60 Ga0070706_100152467 3300005467 Bacteria 2157
61 Ga0070706_100224884 3300005467 Bacteria 1752
62 Ga0070706_100631058 3300005467 Bacteria 995
63 Ga0070706_100887284 3300005467 Archaea 824
64 Ga0070707_100000653 3300005468 Bacteria 34576
65 Ga0070707_100002097 3300005468 Bacteria 19110
66 Ga0070707_100017934 3300005468 Bacteria 6656
67 Ga0070707_100032582 3300005468 Bacteria 4966
68 Ga0070707_100103935 3300005468 Bacteria 2753
69 Ga0070707_100113897 3300005468 Bacteria 2624
70 Ga0070707_101160595 3300005468 Bacteria 738
71 Ga0070698_100000691 3300005471 Bacteria 36018
72 Ga0070698_100011480 3300005471 Bacteria 9401
73 Ga0070698_100014980 3300005471 Bacteria 8196
74 Ga0070698_100094612 3300005471 Bacteria 2966
75 Ga0070698_100133044 3300005471 Bacteria 2441
76 Ga0070698_100161752 3300005471 Bacteria 2182
77 Ga0070698_100190737 3300005471 Bacteria 1987
78 Ga0070699_100003274 3300005518 Bacteria 14324
79 Ga0070699_100013457 3300005518 Bacteria 7045
80 Ga0070699_100013570 3300005518 Bacteria 7013
81 Ga0070699_100020088 3300005518 Bacteria 5757
82 Ga0070699_100031353 3300005518 Bacteria 4588
83 Ga0070699_100420924 3300005518 Unclassified 1209
84 Ga0070699_100527310 3300005518 Bacteria 1074
85 Ga0070699_100532453 3300005518 Bacteria 1069
86 Ga0070679_100007477 3300005530 Bacteria 10214
87 Ga0070684_100732183 3300005535 Bacteria 923
88 Ga0070697_100023932 3300005536 Bacteria 4860
89 Ga0070697_100031298 3300005536 Bacteria 4279
90 Ga0070697_100065632 3300005536 Bacteria 2966
91 Ga0070697_100070721 3300005536 Bacteria 2861
92 Ga0070697_100090842 3300005536 Bacteria 2524
93 Ga0070697_100093448 3300005536 Bacteria 2490
94 Ga0070697_100124263 3300005536 Bacteria 2161
95 Ga0070697_100930803 3300005536 Bacteria 771
96 Ga0068853_100191463 3300005539 Bacteria 1858
97 Ga0070695_100003891 3300005545 Bacteria 8713
98 Ga0070695_100051338 3300005545 Bacteria 2646
99 Ga0070695_100061321 3300005545 Bacteria 2440
100 Ga0070695_100082910 3300005545 Bacteria 2123
101 Ga0070695_100088122 3300005545 Bacteria 2066
102 Ga0070695_100090045 3300005545 Bacteria 2047
103 Ga0070696_100111286 3300005546 Bacteria 1972
104 Ga0070696_100218306 3300005546 Bacteria 1430
105 Ga0070696_100354617 3300005546 Bacteria 1137
106 Ga0070696_100579039 3300005546 Unclassified 903
107 Ga0070693_100290587 3300005547 Bacteria 1098
108 Ga0070704_100015876 3300005549 Bacteria 4742
109 Ga0070704_100103095 3300005549 Bacteria 2154
110 Ga0070704_100132845 3300005549 Bacteria 1932
111 Ga0070704_100238805 3300005549 Unclassified 1486
112 Ga0070704_100479728 3300005549 Bacteria 1076
113 Ga0070704_100615366 3300005549 Bacteria 956
114 Ga0068855_100000225 3300005563 Bacteria 72196
115 Ga0070664_100017355 3300005564 Bacteria 5910
116 Ga0068854_100129883 3300005578 Bacteria 1922
117 Ga0068854_100730933 3300005578 Bacteria 857
118 Ga0068856_100001169 3300005614 Bacteria 27611
119 Ga0070702_100110874 3300005615 Bacteria 1701
120 Ga0070702_100239369 3300005615 Bacteria 1224
121 Ga0068852_100142485 3300005616 Bacteria 2220
122 Ga0068859_100001393 3300005617 Bacteria 24544
123 Ga0068866_10060874 3300005718 Bacteria 1959
124 Ga0068861_100819802 3300005719 Bacteria 875
125 Ga0068870_10000139 3300005840 Bacteria 25224
126 Ga0068863_100032824 3300005841 Bacteria 4947
127 Ga0068863_100767169 3300005841 Unclassified 961
128 Ga0068858_100189302 3300005842 Bacteria 1944
129 Ga0068858_100513696 3300005842 Bacteria 1158
130 Ga0068860_100001109 3300005843 Bacteria 29627
131 Ga0068860_100284175 3300005843 Bacteria 1618
132 Ga0068862_100003750 3300005844 Bacteria 12958
133 Ga0068862_100087038 3300005844 Bacteria 2717
134 Ga0068862_100143465 3300005844 Bacteria 2121
135 Ga0068862_100520989 3300005844 Bacteria 1131
136 Ga0081455_10001810 3300005937 Bacteria 25776
137 Ga0081538_10015371 3300005981 Bacteria 5929
138 Ga0081539_10000005 3300005985 Bacteria 549026
139 Ga0070716_100085712 3300006173 Bacteria 1893
140 Ga0070712_100006589 3300006175 Bacteria 7212
141 Ga0068871_100259299 3300006358 Bacteria 1516
142 Ga0075428_100000924 3300006844 Bacteria 31024
143 Ga0075428_100001380 3300006844 Bacteria 25833
144 Ga0075428_100023900 3300006844 Bacteria 6763
145 Ga0075428_100030517 3300006844 Bacteria 5961
146 Ga0075428_100054921 3300006844 Bacteria 4364
147 Ga0075428_100148309 3300006844 Bacteria 2549
148 Ga0075428_100197674 3300006844 Bacteria 2174
149 Ga0075428_100561473 3300006844 Bacteria 1220
150 Ga0075428_100717959 3300006844 Bacteria 1064
151 Ga0075430_100000019 3300006846 Bacteria 86721
152 Ga0075430_100000487 3300006846 Bacteria 29740
153 Ga0075430_100016723 3300006846 Bacteria 6247
154 Ga0075430_100046733 3300006846 Bacteria 3656
155 Ga0075430_100061652 3300006846 Bacteria 3151
156 Ga0075430_100147154 3300006846 Bacteria 1962
157 Ga0075430_100177697 3300006846 Bacteria 1771
158 Ga0075430_100191515 3300006846 Bacteria 1700
159 Ga0075431_100000797 3300006847 Bacteria 27524
160 Ga0075431_100002180 3300006847 Bacteria 18719
161 Ga0075431_100002229 3300006847 Bacteria 18559
162 Ga0075431_100008469 3300006847 Bacteria 10298
163 Ga0075431_100023868 3300006847 Bacteria 6261
164 Ga0075431_100072397 3300006847 Bacteria 3556
165 Ga0075431_100168828 3300006847 Bacteria 2249
166 Ga0075431_100187053 3300006847 Bacteria 2123
167 Ga0075431_100312236 3300006847 Bacteria 1587
168 Ga0075431_100340004 3300006847 Bacteria 1511
169 Ga0075431_100379091 3300006847 Bacteria 1419
170 Ga0075431_100461715 3300006847 Bacteria 1264
171 Ga0075431_100559326 3300006847 Bacteria 1131
172 Ga0075431_100983240 3300006847 Bacteria 811
173 Ga0075433_10006420 3300006852 Bacteria 9298
174 Ga0075433_10040066 3300006852 Bacteria 4053
175 Ga0075433_10051693 3300006852 Bacteria 3579
176 Ga0075433_10056759 3300006852 Bacteria 3421
177 Ga0075433_10157687 3300006852 Bacteria 2019
178 Ga0075433_10209438 3300006852 Unclassified 1732
179 Ga0075433_10361249 3300006852 Bacteria 1283
180 Ga0075433_10885883 3300006852 Unclassified 779
181 Ga0075434_100022146 3300006871 Bacteria 6189
182 Ga0075434_100031633 3300006871 Bacteria 5217
183 Ga0075434_100033398 3300006871 Bacteria 5078
184 Ga0075434_100076744 3300006871 Bacteria 3336
185 Ga0075434_100156094 3300006871 Bacteria 2301
186 Ga0075434_100167389 3300006871 Bacteria 2218
187 Ga0075434_100197129 3300006871 Bacteria 2033
188 Ga0075434_100223242 3300006871 Bacteria 1904
189 Ga0075434_100232081 3300006871 Bacteria 1865
190 Ga0075434_100371253 3300006871 Bacteria 1451
191 Ga0075434_100470265 3300006871 Bacteria 1278
192 Ga0075434_100652340 3300006871 Bacteria 1071
193 Ga0075434_100709239 3300006871 Bacteria 1023
194 Ga0075434_101469734 3300006871 Unclassified 691
195 Ga0075429_100000859 3300006880 Bacteria 23924
196 Ga0075429_100010038 3300006880 Bacteria 8205
197 Ga0075429_100011531 3300006880 Bacteria 7665
198 Ga0075429_100021240 3300006880 Bacteria 5627
199 Ga0075429_100027920 3300006880 Bacteria 4899
200 Ga0075429_100030148 3300006880 Bacteria 4712
201 Ga0075429_100107459 3300006880 Bacteria 2438
202 Ga0075429_100144173 3300006880 Bacteria 2084
203 Ga0075429_100144176 3300006880 Bacteria 2084
204 Ga0075429_100284026 3300006880 Bacteria 1449
205 Ga0075429_100385766 3300006880 Bacteria 1227
206 Ga0068865_100124729 3300006881 Bacteria 1920
207 Ga0075436_100001157 3300006914 Bacteria 17854
208 Ga0075436_100049119 3300006914 Bacteria 2911
209 Ga0075436_100281372 3300006914 Bacteria 1189
210 Ga0097620_100001393 3300006931 Bacteria 24544
211 Ga0075435_100015296 3300007076 Bacteria 5766
212 Ga0075435_100033102 3300007076 Bacteria 4085
213 Ga0075435_100057817 3300007076 Bacteria 3138
214 Ga0075435_100131566 3300007076 Bacteria 2094
215 Ga0075435_100220786 3300007076 Bacteria 1609
216 Ga0075435_100274139 3300007076 Bacteria 1439
217 Ga0075435_100606107 3300007076 Unclassified 950
218 Ga0099794_10003275 3300007265 Bacteria 6148
219 Ga0099794_10033382 3300007265 Bacteria 2420
220 Ga0099794_10059008 3300007265 Bacteria 1861
221 Ga0105251_10006103 3300009011 Bacteria 7761
222 Ga0105240_10868874 3300009093 Unclassified 972
223 Ga0111539_10018495 3300009094 Bacteria 8631
224 Ga0111539_10082769 3300009094 Bacteria 3775
225 Ga0111539_10114639 3300009094 Bacteria 3161
226 Ga0111539_10192811 3300009094 Bacteria 2377
227 Ga0111539_11030675 3300009094 Bacteria 957
228 Ga0111539_11260875 3300009094 Unclassified 858
229 Ga0111539_11525077 3300009094 Unclassified 775
230 Ga0114129_10000115 3300009147 Bacteria 80576
231 Ga0114129_10001447 3300009147 Bacteria 32031
232 Ga0114129_10001631 3300009147 Bacteria 30466
233 Ga0114129_10008441 3300009147 Bacteria 14680
234 Ga0114129_10009875 3300009147 Bacteria 13607
235 Ga0114129_10012822 3300009147 Bacteria 11929
236 Ga0114129_10036324 3300009147 Bacteria 6958
237 Ga0114129_10079508 3300009147 Bacteria 4559
238 Ga0114129_10088357 3300009147 Bacteria 4296
239 Ga0114129_10102712 3300009147 Bacteria 3953
240 Ga0114129_10102978 3300009147 Bacteria 3947
241 Ga0114129_10114996 3300009147 Bacteria 3709
242 Ga0114129_10119347 3300009147 Bacteria 3632
243 Ga0114129_10225093 3300009147 Bacteria 2529
244 Ga0114129_10232391 3300009147 Bacteria 2483
245 Ga0114129_10273784 3300009147 Bacteria 2258
246 Ga0114129_10574426 3300009147 Bacteria 1463
247 Ga0114129_10986130 3300009147 Unclassified 1062
248 Ga0114129_11264721 3300009147 Bacteria 916
249 Ga0105243_10285133 3300009148 Bacteria 1489
250 Ga0105241_10001038 3300009174 Bacteria 21150
251 Ga0105242_10589273 3300009176 Bacteria 1072
252 Ga0105242_10664580 3300009176 Bacteria 1015
253 Ga0105242_11044536 3300009176 Bacteria 828
254 Ga0105249_10082436 3300009553 Bacteria 2992
255 Ga0105249_10227328 3300009553 Bacteria 1839
256 Ga0105249_10984313 3300009553 Bacteria 912
257 Ga0105249_11010074 3300009553 Bacteria 901
258 Ga0105239_11297894 3300010375 Bacteria 840
259 Ga0157373_10000388 3300013100 Bacteria 35150
260 Ga0157373_10205914 3300013100 Bacteria 1387
261 Ga0157371_10324448 3300013102 Bacteria 1118
262 Ga0157369_10232425 3300013105 Bacteria 1927
263 Ga0157378_10933805 3300013297 Unclassified 900
264 Ga0163162_10015647 3300013306 Bacteria 7413
265 Ga0157372_10000105 3300013307 Bacteria 88007
266 Ga0157372_10072881 3300013307 Bacteria 3870
267 Ga0157375_10255141 3300013308 Bacteria 1915
268 Ga0163163_10150574 3300014325 Bacteria 2370
269 Ga0157380_10475568 3300014326 Bacteria 1207
270 Ga0207713_1022753 3300025735 Bacteria 2965
271 Ga0207653_10019880 3300025885 Bacteria 2120
272 Ga0207642_10089212 3300025899 Bacteria 1519
273 Ga0207688_10012816 3300025901 Bacteria 4558
274 Ga0207699_10229099 3300025906 Bacteria 1272
275 Ga0207645_10005499 3300025907 Bacteria 9176
276 Ga0207645_10117004 3300025907 Bacteria 1728
277 Ga0207643_10001465 3300025908 Bacteria 13545
278 Ga0207684_10000115 3300025910 Bacteria 149762
279 Ga0207684_10018826 3300025910 Bacteria 5907
280 Ga0207684_10019692 3300025910 Bacteria 5772
281 Ga0207684_10036906 3300025910 Bacteria 4148
282 Ga0207684_10073541 3300025910 Bacteria 2903
283 Ga0207684_10108911 3300025910 Bacteria 2371
284 Ga0207684_10132276 3300025910 Bacteria 2141
285 Ga0207684_10159932 3300025910 Bacteria 1939
286 Ga0207684_10210168 3300025910 Bacteria 1679
287 Ga0207684_10213506 3300025910 Bacteria 1664
288 Ga0207684_10251823 3300025910 Bacteria 1524
289 Ga0207684_10509497 3300025910 Unclassified 1031
290 Ga0207654_10190036 3300025911 Bacteria 1345
291 Ga0207707_10000352 3300025912 Bacteria 48248
292 Ga0207707_10283306 3300025912 Bacteria 1435
293 Ga0207693_10025215 3300025915 Bacteria 4715
294 Ga0207693_10186612 3300025915 Bacteria 1632
295 Ga0207663_10388572 3300025916 Archaea 1064
296 Ga0207660_10000334 3300025917 Bacteria 30356
297 Ga0207660_10127028 3300025917 Bacteria 1937
298 Ga0207660_10900651 3300025917 Bacteria 722
299 Ga0207662_10145280 3300025918 Bacteria 1505
300 Ga0207657_10002597 3300025919 Bacteria 19548
301 Ga0207649_10006035 3300025920 Bacteria 6576
302 Ga0207652_10000466 3300025921 Bacteria 41482
303 Ga0207652_10097233 3300025921 Bacteria 2595
304 Ga0207646_10000250 3300025922 Bacteria 73162
305 Ga0207646_10003851 3300025922 Bacteria 16662
306 Ga0207646_10008684 3300025922 Bacteria 10147
307 Ga0207646_10014285 3300025922 Bacteria 7549
308 Ga0207646_10028619 3300025922 Bacteria 5069
309 Ga0207646_10032828 3300025922 Bacteria 4696
310 Ga0207646_10035039 3300025922 Bacteria 4536
311 Ga0207646_10083233 3300025922 Bacteria 2862
312 Ga0207646_10084314 3300025922 Bacteria 2843
313 Ga0207646_10108278 3300025922 Bacteria 2493
314 Ga0207646_10299330 3300025922 Bacteria 1453
315 Ga0207646_10976971 3300025922 Bacteria 749
316 Ga0207681_10963595 3300025923 Unclassified 715
317 Ga0207650_10025156 3300025925 Bacteria 4239
318 Ga0207659_10148540 3300025926 Bacteria 1828
319 Ga0207644_10203632 3300025931 Bacteria 1562
320 Ga0207706_10024583 3300025933 Bacteria 5400
321 Ga0207706_10323362 3300025933 Bacteria 1342
322 Ga0207706_10911078 3300025933 Unclassified 742
323 Ga0207709_10127879 3300025935 Bacteria 1726
324 Ga0207670_10088095 3300025936 Bacteria 2188
325 Ga0207704_10421945 3300025938 Unclassified 1058
326 Ga0207665_10114297 3300025939 Bacteria 1900
327 Ga0207665_10165423 3300025939 Bacteria 1594
328 Ga0207689_10003685 3300025942 Bacteria 13959
329 Ga0207689_10074531 3300025942 Bacteria 2789
330 Ga0207661_10148620 3300025944 Bacteria 2024
331 Ga0207679_10000878 3300025945 Bacteria 19200
332 Ga0207667_10000497 3300025949 Bacteria 51927
333 Ga0207651_10184560 3300025960 Bacteria 1658
334 Ga0207668_10196221 3300025972 Bacteria 1604
335 Ga0207640_10278268 3300025981 Bacteria 1313
336 Ga0207703_10019303 3300026035 Bacteria 5325
337 Ga0207639_10002384 3300026041 Bacteria 12612
338 Ga0207678_10013961 3300026067 Bacteria 7060
339 Ga0207641_10071148 3300026088 Bacteria 2991
340 Ga0207641_10167672 3300026088 Bacteria 2001
341 Ga0207641_10192178 3300026088 Bacteria 1877
342 Ga0207648_10015946 3300026089 Bacteria 6885
343 Ga0207648_10153126 3300026089 Bacteria 2035
344 Ga0207674_10000550 3300026116 Bacteria 49205
345 Ga0207675_100005709 3300026118 Bacteria 11909
346 Ga0207675_100132891 3300026118 Bacteria 2360
347 Ga0207698_10116523 3300026142 Bacteria 2252
348 Ga0209981_1000490 3300027378 Bacteria 5020
349 Ga0209996_1000338 3300027395 Bacteria 5808
350 Ga0209984_1015316 3300027424 Bacteria 1018
351 Ga0210000_1008761 3300027462 Bacteria 1485
352 Ga0209968_1000579 3300027526 Bacteria 5659
353 Ga0209999_1000243 3300027543 Bacteria 7873
354 Ga0209982_1001041 3300027552 Bacteria 3693
355 Ga0209983_1000034 3300027665 Bacteria 19527
356 Ga0209588_1045530 3300027671 Bacteria 1419
357 Ga0209588_1051939 3300027671 Bacteria 1326
358 Ga0209971_1000028 3300027682 Bacteria 53458
359 Ga0209971_1005708 3300027682 Bacteria 2948
360 Ga0209971_1036225 3300027682 Unclassified 1187
361 Ga0209966_1000073 3300027695 Bacteria 44067
362 Ga0209966_1009155 3300027695 Bacteria 1764
363 Ga0209998_10000001 3300027717 Bacteria 203589
364 Ga0209998_10116032 3300027717 Unclassified 672
365 Ga0209974_10000369 3300027876 Bacteria 14852
366 Ga0209974_10015144 3300027876 Bacteria 2560
367 Ga0209974_10093959 3300027876 Unclassified 1042
368 Ga0207428_10000176 3300027907 Bacteria 89634
369 Ga0207428_10000394 3300027907 Bacteria 54660
370 Ga0207428_10123151 3300027907 Bacteria 1987
371 Ga0207428_10141454 3300027907 Bacteria 1836
372 Ga0268265_10024098 3300028380 Bacteria 4300
373 Ga0268265_10088185 3300028380 Bacteria 2471
374 Ga0268264_10031393 3300028381 Bacteria 4356
375 Ga0268264_11014898 3300028381 Bacteria 836
376 Ga0265332_10091490 3300031238 Bacteria 1286
377 Ga0307408_100034524 3300031548 Bacteria 3543
378 Ga0307408_100222462 3300031548 Bacteria 1541
379 Ga0307405_10157785 3300031731 Bacteria 1603
380 Ga0307405_11237454 3300031731 Bacteria 647
381 Ga0307410_10059238 3300031852 Bacteria 2614
382 Ga0307410_10130784 3300031852 Bacteria 1844
383 Ga0307409_100572154 3300031995 Bacteria 1112
384 Ga0307416_100553296 3300032002 Bacteria 1224
385 Ga0307416_101979282 3300032002 Unclassified 685
386 Ga0307411_10034095 3300032005 Bacteria 3164
387 Ga0307411_10069622 3300032005 Bacteria 2377
388 Ga0307415_100326416 3300032126 Bacteria 1282
389 Ga0373928_0075756 3300035084 Bacteria 840
390 Ga0373929_0145897 3300035085 Bacteria 631
391 Ga0373949_0034097 3300035090 Bacteria 1226
392 Ga0373932_0003143 3300035112 Bacteria 4023
393 Ga0373939_0007077 3300035114 Bacteria 2716
394 Ga0373941_0062149 3300035115 Bacteria 1218
395 Ga0373962_0064142 3300035242 Bacteria 1085
396 Ga0373931_0008836 3300035691 Bacteria 4795
397 Ga0373931_0081418 3300035691 Bacteria 1788
398 Ga0395899_0005401 3300037312 Bacteria 9925
399 Ga0395899_0025520 3300037312 Bacteria 4461
400 Ga0395899_0265576 3300037312 Bacteria 1172
401 Ga0395900_0038990 3300037418 Bacteria 4897
402 Ga0395900_0333236 3300037418 Bacteria 1495
403 Ga0395905_0139761 3300037471 Bacteria 2279
404 Ga0395901_0103437 3300038443 Bacteria 2988
405 Ga0242420_018422 3300038996 Bacteria 1229
406 Ga0439448_0009418 3300042005 Bacteria 2879
407 Ga0439450_116358 3300042008 Bacteria 686
408 Ga0439455_0013689 3300042012 Bacteria 1842
409 Ga0439455_0027803 3300042012 Bacteria 1388
410 Ga0439458_0002296 3300042157 Bacteria 4694
411 Ga0439434_0053749 3300042435 Bacteria 1252
412 Ga0439435_0129585 3300042436 Unclassified 796
413 Ga0439459_0012077 3300042438 Bacteria 1532
414 Ga0439460_0001203 3300042461 Bacteria 6099
415 Ga0439460_0073831 3300042461 Bacteria 1061
416 Ga0451577_0010038 3300042876 Bacteria 9071
417 Ga0451577_0025265 3300042876 Bacteria 5391
418 Ga0451577_0035839 3300042876 Bacteria 4469
419 Ga0451577_0351582 3300042876 Bacteria 1337
420 Ga0451577_0411462 3300042876 Bacteria 1228
421 Ga0451577_0559300 3300042876 Bacteria 1038
422 Ga0453683_0003008 3300044673 Bacteria 12624
423 Ga0453683_0005950 3300044673 Bacteria 8409
424 Ga0453683_0013136 3300044673 Bacteria 5414
425 Ga0453683_0025100 3300044673 Bacteria 3789
426 Ga0453683_0033515 3300044673 Bacteria 3239
427 Ga0453684_0032377 3300044712 Bacteria 7318
428 Ga0453684_0082341 3300044712 Bacteria 4009
429 Ga0453684_0185691 3300044712 Bacteria 2437
430 Ga0451576_0024239 3300045051 Bacteria 6555
431 Ga0451576_0026201 3300045051 Bacteria 6272
432 Ga0451576_0028871 3300045051 Bacteria 5941
433 Ga0451576_0036861 3300045051 Bacteria 5181
434 Ga0451576_0049195 3300045051 Bacteria 4424
435 Ga0451576_0263638 3300045051 Bacteria 1801
436 Ga0451576_0278038 3300045051 Bacteria 1750
437 Ga0451576_0353374 3300045051 Unclassified 1539
438 Ga0495580_0029596 3300046472 Bacteria 3973
439 Ga0495580_0202467 3300046472 Bacteria 1367
440 Ga0495580_0277844 3300046472 Bacteria 1143
441 Ga0495594_0214590 3300046499 Bacteria 1097
442 Ga0495642_0088081 3300046528 Bacteria 1312
443 Ga0495609_0203461 3300046538 Unclassified 827
444 Ga0495656_0070364 3300046615 Bacteria 1552
445 Ga0495659_0054774 3300046664 Bacteria 1460
446 Ga0495669_0032522 3300046684 Bacteria 2293
447 Ga0495669_0141691 3300046684 Unclassified 1135
448 Ga0495669_0152784 3300046684 Bacteria 1093
449 Ga0496102_0001871 3300048905 Bacteria 18136
450 Ga0496106_0239711 3300048909 Bacteria 1449
451 Ga0496108_0361939 3300048911 Bacteria 1266
452 Ga0501031_0090122 3300049568 Bacteria 2000
453 Ga0501031_0193282 3300049568 Bacteria 1329
454 Ga0501033_0225203 3300049570 Bacteria 1334
455 Ga0501033_0231740 3300049570 Bacteria 1312
456 Ga0501036_0025187 3300049572 Bacteria 5019
457 Ga0501036_0224031 3300049572 Bacteria 1579
458 Ga0501036_0308257 3300049572 Bacteria 1324
459 Ga0501036_0386286 3300049572 Bacteria 1168
460 Ga0501036_0448893 3300049572 Bacteria 1074
461 Ga0501036_0710671 3300049572 Bacteria 830
462 Ga0501037_0308819 3300049573 Bacteria 1097
463 Ga0501038_0100011 3300049574 Bacteria 2417
464 Ga0501038_0110847 3300049574 Bacteria 2274
465 Ga0501038_0197507 3300049574 Bacteria 1616
466 Ga0501038_0473156 3300049574 Bacteria 961
467 Ga0501038_0597343 3300049574 Bacteria 835
468 Ga0501039_0164062 3300049575 Bacteria 1747
469 Ga0501039_0201418 3300049575 Bacteria 1565
470 Ga0501039_0291456 3300049575 Bacteria 1283
471 Ga0501039_0311493 3300049575 Bacteria 1237
472 Ga0501039_0336090 3300049575 Bacteria 1187
473 Ga0501039_0517763 3300049575 Bacteria 937
474 Ga0501040_0006783 3300049576 Bacteria 7424
475 Ga0501040_0016619 3300049576 Bacteria 4876
476 Ga0501040_0055431 3300049576 Bacteria 2718
477 Ga0501040_0055533 3300049576 Bacteria 2715
478 Ga0501040_0067285 3300049576 Bacteria 2469
479 Ga0501040_0113952 3300049576 Bacteria 1892
480 Ga0501040_0120591 3300049576 Bacteria 1840
481 Ga0501040_0154345 3300049576 Bacteria 1621
482 Ga0501040_0156057 3300049576 Bacteria 1612
483 Ga0501040_0177175 3300049576 Bacteria 1510
484 Ga0501040_0204399 3300049576 Bacteria 1403
485 Ga0501040_0266368 3300049576 Bacteria 1223
486 Ga0501040_0437225 3300049576 Bacteria 941
487 Ga0501040_0870403 3300049576 Bacteria 652
488 Ga0501041_0009513 3300049577 Bacteria 5729
489 Ga0501041_0031877 3300049577 Bacteria 3186
490 Ga0501041_0041434 3300049577 Bacteria 2797
491 Ga0501041_0165786 3300049577 Bacteria 1382
492 Ga0501041_0255052 3300049577 Bacteria 1103
493 Ga0501042_0007739 3300049578 Bacteria 7058
494 Ga0501042_0030821 3300049578 Bacteria 3792
495 Ga0501042_0071625 3300049578 Bacteria 2480
496 Ga0501042_0106688 3300049578 Bacteria 2016
497 Ga0501042_0160808 3300049578 Bacteria 1620
498 Ga0501042_0339482 3300049578 Bacteria 1086
499 Ga0501046_0002061 3300049580 Bacteria 19077
500 Ga0501046_0016933 3300049580 Bacteria 6097
501 Ga0501046_0162774 3300049580 Bacteria 1677
502 Ga0501046_0202866 3300049580 Bacteria 1475
503 Ga0501046_0502094 3300049580 Bacteria 868
504 Ga0501047_0056714 3300049581 Bacteria 3789
505 Ga0501048_0021144 3300049582 Bacteria 4765
506 Ga0501048_0044237 3300049582 Bacteria 3185
507 Ga0501048_0058521 3300049582 Bacteria 2731
508 Ga0501048_0305062 3300049582 Bacteria 1133
509 Ga0501067_0048491 3300049583 Bacteria 2355
510 Ga0501068_0047035 3300049584 Bacteria 2602
511 Ga0501068_0064635 3300049584 Bacteria 2227
512 Ga0501068_0087739 3300049584 Bacteria 1916
513 Ga0501069_0007927 3300049585 Bacteria 5578
514 Ga0501070_0316882 3300049586 Unclassified 1269
515 Ga0501071_0096534 3300049587 Bacteria 2175
516 Ga0501071_0124817 3300049587 Bacteria 1910
517 Ga0501071_0186637 3300049587 Bacteria 1554
518 Ga0501071_0219441 3300049587 Bacteria 1431
519 Ga0501071_0602815 3300049587 Unclassified 844
520 Ga0501072_0015809 3300049588 Bacteria 5786
521 Ga0501072_0025773 3300049588 Bacteria 4581
522 Ga0501072_0026080 3300049588 Bacteria 4554
523 Ga0501072_0054150 3300049588 Bacteria 3160
524 Ga0501072_0059434 3300049588 Bacteria 3014
525 Ga0501072_0116890 3300049588 Bacteria 2124
526 Ga0501072_0124331 3300049588 Bacteria 2055
527 Ga0501072_0188867 3300049588 Bacteria 1643
528 Ga0501072_0236008 3300049588 Bacteria 1456
529 Ga0501072_0260974 3300049588 Bacteria 1379
530 Ga0501072_0276920 3300049588 Bacteria 1335
531 Ga0501072_0298420 3300049588 Bacteria 1281
532 Ga0501072_0333483 3300049588 Unclassified 1205
533 Ga0501072_0380619 3300049588 Bacteria 1120
534 Ga0501073_0260566 3300049589 Bacteria 1197
535 Ga0501074_0019321 3300049590 Bacteria 4950
536 Ga0501074_0021260 3300049590 Bacteria 4712
537 Ga0501074_0080958 3300049590 Bacteria 2329
538 Ga0501074_0102039 3300049590 Bacteria 2054
539 Ga0501074_0505234 3300049590 Unclassified 856
540 Ga0501075_0014948 3300049591 Bacteria 5567
541 Ga0501075_0029861 3300049591 Bacteria 4033
542 Ga0501075_0076372 3300049591 Bacteria 2534
543 Ga0501075_0076992 3300049591 Bacteria 2524
544 Ga0501075_0097421 3300049591 Bacteria 2232
545 Ga0501075_0104215 3300049591 Bacteria 2156
546 Ga0501075_0108503 3300049591 Bacteria 2110
547 Ga0501075_0186754 3300049591 Bacteria 1581
548 Ga0501075_0298672 3300049591 Bacteria 1227
549 Ga0501075_0370131 3300049591 Bacteria 1092
550 Ga0501075_0441825 3300049591 Unclassified 992
551 Ga0501076_0002878 3300049592 Bacteria 11918
552 Ga0501076_0019643 3300049592 Bacteria 5166
553 Ga0501076_0021226 3300049592 Bacteria 4980
554 Ga0501076_0024534 3300049592 Bacteria 4661
555 Ga0501076_0055972 3300049592 Bacteria 3129
556 Ga0501076_0065644 3300049592 Bacteria 2895
557 Ga0501076_0109288 3300049592 Bacteria 2235
558 Ga0501076_0110518 3300049592 Bacteria 2222
559 Ga0501076_0121304 3300049592 Bacteria 2117
560 Ga0501076_0220677 3300049592 Bacteria 1549
561 Ga0501076_0270085 3300049592 Bacteria 1393
562 Ga0501076_0471809 3300049592 Bacteria 1034
563 Ga0501076_0502749 3300049592 Bacteria 999
564 Ga0501077_0009924 3300049593 Bacteria 5926
565 Ga0501077_0009995 3300049593 Bacteria 5905
566 Ga0501077_0086190 3300049593 Bacteria 1991
567 Ga0501077_0118791 3300049593 Bacteria 1675
568 Ga0501077_0149061 3300049593 Bacteria 1484
569 Ga0501077_0191364 3300049593 Bacteria 1300
570 Ga0501079_0001185 3300049741 Bacteria 18261
571 Ga0501079_0011862 3300049741 Bacteria 6649
572 Ga0501079_0017090 3300049741 Bacteria 5540
573 Ga0501079_0018925 3300049741 Bacteria 5262
574 Ga0501079_0043772 3300049741 Bacteria 3456
575 Ga0501079_0218232 3300049741 Bacteria 1490
576 Ga0501079_0247687 3300049741 Bacteria 1392
577 Ga0501079_0436105 3300049741 Bacteria 1029
578 Ga0501080_0059941 3300049742 Bacteria 3542
579 Ga0501080_0113479 3300049742 Bacteria 2512
580 Ga0501080_0122207 3300049742 Bacteria 2412
581 Ga0501080_0318970 3300049742 Bacteria 1407
582 Ga0501081_0001033 3300049743 Bacteria 16654
583 Ga0501081_0003182 3300049743 Bacteria 10436
584 Ga0501081_0008697 3300049743 Bacteria 6598
585 Ga0501081_0016788 3300049743 Bacteria 4840
586 Ga0501081_0021956 3300049743 Bacteria 4265
587 Ga0501081_0036313 3300049743 Bacteria 3360
588 Ga0501081_0112229 3300049743 Bacteria 1935
589 Ga0501081_0324469 3300049743 Bacteria 1132
590 Ga0501081_0404848 3300049743 Bacteria 1010
591 Ga0501081_0474753 3300049743 Bacteria 930
592 Ga0501081_0554960 3300049743 Unclassified 858
593 Ga0501081_0618435 3300049743 Bacteria 811
594 Ga0501081_0881902 3300049743 Bacteria 674
595 Ga0501083_0031778 3300049744 Bacteria 3623
596 Ga0501083_0113204 3300049744 Bacteria 1783
597 Ga0501083_0240779 3300049744 Unclassified 1178
598 Ga0501045_0024468 3300049824 Bacteria 4336
599 Ga0501045_0073786 3300049824 Bacteria 2513
600 Ga0501045_0156523 3300049824 Bacteria 1695
601 Ga0501045_0485680 3300049824 Bacteria 917
602 Ga0501045_0550117 3300049824 Bacteria 856
603 Ga0501045_0602268 3300049824 Unclassified 814
604 Ga0501045_0708612 3300049824 Bacteria 742
605 nmdc:mga05p37_141781_c1 3300050507 Bacteria 2944
606 nmdc:mga05p37_14582_c1 3300050507 Bacteria 9438
607 nmdc:mga05p37_189936_c1 3300050507 Bacteria 2495
608 nmdc:mga05p37_21565_c1 3300050507 Bacteria 7806
609 nmdc:mga05p37_218253_c1 3300050507 Bacteria 2303
610 nmdc:mga05p37_23238_c1 3300050507 Bacteria 7520
611 nmdc:mga05p37_28205_c1 3300050507 Bacteria 6844
612 nmdc:mga05p37_331825_c1 3300050507 Bacteria 1796
613 nmdc:mga05p37_336224_c1 3300050507 Unclassified 1782
614 nmdc:mga05p37_339410_c1 3300050507 Bacteria 1772
615 nmdc:mga05p37_3396_c1 3300050507 Bacteria 18593
616 nmdc:mga05p37_35596_c1 3300050507 Bacteria 6106
617 nmdc:mga05p37_363045_c1 3300050507 Bacteria 1702
618 nmdc:mga05p37_37629_c1 3300050507 Bacteria 5933
619 nmdc:mga05p37_413792_c1 3300050507 Bacteria 1571
620 nmdc:mga05p37_433261_c1 3300050507 Bacteria 1527
621 nmdc:mga05p37_65962_c1 3300050507 Bacteria 4454
622 nmdc:mga05p37_736607_c1 3300050507 Unclassified 1089
623 nmdc:mga05p37_85453_c1 3300050507 Bacteria 3888
624 nmdc:mga05p37_89_c1 3300050507 Bacteria 81482
625 nmdc:mga09592_1406_c1 3300050508 Bacteria 19268
626 nmdc:mga09592_21339_c1 3300050508 Bacteria 5338
627 nmdc:mga09592_349513_c1 3300050508 Bacteria 1280
628 nmdc:mga09592_36258_c1 3300050508 Bacteria 4131
629 nmdc:mga09592_41843_c1 3300050508 Bacteria 3854
630 nmdc:mga09592_6345_c1 3300050508 Bacteria 9637
631 nmdc:mga09592_837_c1 3300050508 Bacteria 23885
632 nmdc:mga0qj67_130140_c1 3300050509 Bacteria 2038
633 nmdc:mga0qj67_22992_c1 3300050509 Bacteria 4790
634 nmdc:mga0qj67_246111_c1 3300050509 Bacteria 1451
635 nmdc:mga0qj67_343_c1 3300050509 Bacteria 32121
636 nmdc:mga0qj67_43339_c1 3300050509 Bacteria 3544
637 nmdc:mga0qj67_798_c1 3300050509 Bacteria 21472
638 nmdc:mga06r32_10348_c1 3300050510 Bacteria 8414
639 nmdc:mga06r32_1324267_c1 3300050510 Unclassified 664
640 nmdc:mga06r32_14068_c1 3300050510 Bacteria 7257
641 nmdc:mga06r32_181961_c1 3300050510 Bacteria 2087
642 nmdc:mga06r32_20307_c1 3300050510 Bacteria 6114
643 nmdc:mga06r32_27649_c1 3300050510 Bacteria 5302
644 nmdc:mga06r32_287705_c1 3300050510 Unclassified 1630
645 nmdc:mga06r32_32294_c1 3300050510 Bacteria 4924
646 nmdc:mga06r32_345196_c1 3300050510 Bacteria 1473
647 nmdc:mga06r32_4631_c1 3300050510 Bacteria 12337
648 nmdc:mga06r32_523226_c1 3300050510 Bacteria 1162
649 nmdc:mga06r32_654930_c1 3300050510 Bacteria 1018
650 nmdc:mga06r32_705351_c1 3300050510 Bacteria 974
651 nmdc:mga06r32_76392_c1 3300050510 Bacteria 3253
652 nmdc:mga06r32_87705_c1 3300050510 Bacteria 3037
653 nmdc:mga08y16_108945_c1 3300050511 Bacteria 2884
654 nmdc:mga08y16_1417_c1 3300050511 Bacteria 24061
655 nmdc:mga08y16_163309_c1 3300050511 Bacteria 2314
656 nmdc:mga08y16_2945_c1 3300050511 Bacteria 17531
657 nmdc:mga08y16_556387_c1 3300050511 Bacteria 1160
658 nmdc:mga08y16_90439_c1 3300050511 Bacteria 3191
659 nmdc:mga0n895_1008327_c1 3300050512 Unclassified 813
660 nmdc:mga0n895_1302219_c1 3300050512 Bacteria 697
661 nmdc:mga0n895_176870_c1 3300050512 Bacteria 2165
662 nmdc:mga0n895_203_c1 3300050512 Bacteria 21253
663 nmdc:mga0n895_230485_c1 3300050512 Bacteria 1880
664 nmdc:mga0n895_300974_c1 3300050512 Bacteria 1626
665 nmdc:mga0n895_35010_c1 3300050512 Bacteria 4838
666 nmdc:mga0n895_41940_c1 3300050512 Bacteria 4451
667 nmdc:mga0n895_43098_c1 3300050512 Bacteria 4396
668 nmdc:mga0n895_469973_c1 3300050512 Bacteria 1269
669 nmdc:mga0n895_61867_c1 3300050512 Bacteria 3698
670 nmdc:mga0n895_647060_c1 3300050512 Bacteria 1056
671 nmdc:mga0n895_677592_c1 3300050512 Bacteria 1028
672 nmdc:mga0n895_735924_c1 3300050512 Unclassified 980
673 nmdc:mga0n895_88977_c1 3300050512 Bacteria 3088
674 nmdc:mga0rr50_152938_c1 3300050513 Bacteria 1866
675 nmdc:mga0rr50_33149_c1 3300050513 Bacteria 3688
676 nmdc:mga0rr50_389073_c1 3300050513 Bacteria 1177
677 nmdc:mga0rr50_551275_c1 3300050513 Bacteria 982
678 nmdc:mga0rr50_599997_c1 3300050513 Bacteria 939
679 nmdc:mga0rr50_694_c1 3300050513 Bacteria 18015
680 nmdc:mga08x19_153171_c1 3300050514 Bacteria 1562
681 nmdc:mga08x19_384020_c1 3300050514 Bacteria 984
682 nmdc:mga08x19_4220_c1 3300050514 Bacteria 8518
683 nmdc:mga08x19_470_c1 3300050514 Bacteria 27216
684 nmdc:mga0a205_1021094_c1 3300050515 Unclassified 674
685 nmdc:mga0a205_12060_c1 3300050515 Bacteria 7985
686 nmdc:mga0a205_156907_c1 3300050515 Bacteria 2174
687 nmdc:mga0a205_156982_c1 3300050515 Bacteria 2173
688 nmdc:mga0a205_205119_c1 3300050515 Bacteria 1861
689 nmdc:mga0a205_22996_c1 3300050515 Bacteria 5910
690 nmdc:mga0a205_24042_c1 3300050515 Bacteria 5786
691 nmdc:mga0a205_432933_c1 3300050515 Bacteria 1177
692 nmdc:mga0a205_49115_c1 3300050515 Bacteria 4072
693 nmdc:mga0a205_58667_c1 3300050515 Bacteria 3718
694 nmdc:mga0a205_5896_c1 3300050515 Bacteria 11035
695 Ga0501084_0015809 3300054114 Bacteria 6259
696 Ga0501084_0055736 3300054114 Bacteria 3307
697 Ga0501084_0097754 3300054114 Bacteria 2465
698 Ga0501084_0117206 3300054114 Bacteria 2239
699 Ga0501084_0257276 3300054114 Bacteria 1474
700 Ga0501084_0394375 3300054114 Bacteria 1170
701 Ga0501084_0449865 3300054114 Bacteria 1089
702 Ga0501084_0541814 3300054114 Bacteria 983
703 Ga0501084_0621423 3300054114 Bacteria 912
704 Ga0590071_010281 3300059421 Bacteria 2193
705 Ga0590075_052785 3300059424 Bacteria 1043
706 Ga0501082_0056973 3300060353 Bacteria 3367
707 Ga0501082_0064057 3300060353 Bacteria 3166
708 Ga0501082_0109230 3300060353 Bacteria 2394
709 Ga0501082_0190196 3300060353 Bacteria 1786
710 Ga0501082_0229789 3300060353 Bacteria 1614
711 Ga0501082_0261260 3300060353 Bacteria 1506
712 Ga0501082_0276776 3300060353 Bacteria 1461
713 Ga0501082_0494565 3300060353 Bacteria 1069
714 Ga0530510_0012716 3300061734 Bacteria 5916
715 Ga0530510_0015625 3300061734 Bacteria 5364
716 Ga0530510_0042801 3300061734 Bacteria 3272
717 Ga0530510_0046999 3300061734 Bacteria 3118
718 Ga0530510_0063379 3300061734 Bacteria 2676
719 Ga0530510_0122257 3300061734 Bacteria 1911
720 Ga0530510_0343364 3300061734 Bacteria 1121
721 Ga0530510_0391577 3300061734 Bacteria 1046
722 Ga0530510_0839864 3300061734 Unclassified 701
723 2857607586 2857604169 Bacteria 5111450
724 2864998605 2864997549 Bacteria 5139696
725 2889298289 2889295896 Bacteria 4704906
726 2981286776 2981284811 Bacteria 4641497
727 2981291727 2981289755 Bacteria 4641509
728 2981982416 2981980479 Bacteria 4641628
729 2981987320 2981985349 Bacteria 4641497
730 8022948895 8022948649 Bacteria 5366783
731 8054800799 8054795415 Bacteria 9785225
732 Ga0265342_10131632
733 JGI25406J46586_10017390
734 rootH1_10183144
735 rootL2_10180209
736 JGI26129J50193_1000967
737 Ga0065707_10390632
738 Ga0070676_10001402
739 Ga0070683_100234008
740 Ga0070690_100086393
741 Ga0070670_100001558
742 Ga0068869_100000795
743 Ga0070680_100002409
744 Ga0070682_100000179
745 Ga0070660_100000476
746 Ga0070689_100073029
747 Ga0070691_10203984
748 Ga0070661_100000876
749 Ga0070692_10000828
750 Ga0070692_10046023
751 Ga0070692_10105200
752 Ga0070669_100277262
753 Ga0070675_100282656
754 Ga0070659_100153974
755 Ga0070703_10042571
756 Ga0070709_10910594
757 Ga0070711_100109745
758 Ga0070705_100000333
759 Ga0070705_100101787
760 Ga0070705_100122966
761 Ga0070705_100438821
762 Ga0070705_101146624
763 Ga0070694_100008838
764 Ga0070694_100022054
765 Ga0070694_100075232
766 Ga0070694_100212070
767 Ga0070694_100220916
768 Ga0070694_100381886
769 Ga0070708_100016216
770 Ga0070708_100055617
771 Ga0070708_100061658
772 Ga0070708_100148004
773 Ga0070708_100159392
774 Ga0070708_100288505
775 Ga0070708_100337557
776 Ga0070663_100767945
777 Ga0070662_100027815
778 Ga0070662_100471825
779 Ga0070662_100781398
780 Ga0070681_10004124
781 Ga0070681_10387683
782 Ga0068867_100000455
783 Ga0068867_100194989
784 Ga0068867_100269575
785 Ga0068867_100491618
786 Ga0070706_100005118
787 Ga0070706_100031118
788 Ga0070706_100047684
789 Ga0070706_100077558
790 Ga0070706_100116134
791 Ga0070706_100152467
792 Ga0070706_100224884
793 Ga0070706_100631058
794 Ga0070706_100887284
795 Ga0070707_100000653
796 Ga0070707_100002097
797 Ga0070707_100017934
798 Ga0070707_100032582
799 Ga0070707_100103935
800 Ga0070707_100113897
801 Ga0070707_101160595
802 Ga0070698_100000691
803 Ga0070698_100011480
804 Ga0070698_100014980
805 Ga0070698_100094612
806 Ga0070698_100133044
807 Ga0070698_100161752
808 Ga0070698_100190737
809 Ga0070699_100003274
810 Ga0070699_100013457
811 Ga0070699_100013570
812 Ga0070699_100020088
813 Ga0070699_100031353
814 Ga0070699_100420924
815 Ga0070699_100527310
816 Ga0070699_100532453
817 Ga0070679_100007477
818 Ga0070684_100732183
819 Ga0070697_100023932
820 Ga0070697_100031298
821 Ga0070697_100065632
822 Ga0070697_100070721
823 Ga0070697_100090842
824 Ga0070697_100093448
825 Ga0070697_100124263
826 Ga0070697_100930803
827 Ga0068853_100191463
828 Ga0070695_100003891
829 Ga0070695_100051338
830 Ga0070695_100061321
831 Ga0070695_100082910
832 Ga0070695_100088122
833 Ga0070695_100090045
834 Ga0070696_100111286
835 Ga0070696_100218306
836 Ga0070696_100354617
837 Ga0070696_100579039
838 Ga0070693_100290587
839 Ga0070704_100015876
840 Ga0070704_100103095
841 Ga0070704_100132845
842 Ga0070704_100238805
843 Ga0070704_100479728
844 Ga0070704_100615366
845 Ga0068855_100000225
846 Ga0070664_100017355
847 Ga0068854_100129883
848 Ga0068854_100730933
849 Ga0068856_100001169
850 Ga0070702_100110874
851 Ga0070702_100239369
852 Ga0068852_100142485
853 Ga0068859_100001393
854 Ga0068866_10060874
855 Ga0068861_100819802
856 Ga0068870_10000139
857 Ga0068863_100032824
858 Ga0068863_100767169
859 Ga0068858_100189302
860 Ga0068858_100513696
861 Ga0068860_100001109
862 Ga0068860_100284175
863 Ga0068862_100003750
864 Ga0068862_100087038
865 Ga0068862_100143465
866 Ga0068862_100520989
867 Ga0081455_10001810
868 Ga0081538_10015371
869 Ga0081539_10000005
870 Ga0070716_100085712
871 Ga0070712_100006589
872 Ga0068871_100259299
873 Ga0075428_100000924
874 Ga0075428_100001380
875 Ga0075428_100023900
876 Ga0075428_100030517
877 Ga0075428_100054921
878 Ga0075428_100148309
879 Ga0075428_100197674
880 Ga0075428_100561473
881 Ga0075428_100717959
882 Ga0075430_100000019
883 Ga0075430_100000487
884 Ga0075430_100016723
885 Ga0075430_100046733
886 Ga0075430_100061652
887 Ga0075430_100147154
888 Ga0075430_100177697
889 Ga0075430_100191515
890 Ga0075431_100000797
891 Ga0075431_100002180
892 Ga0075431_100002229
893 Ga0075431_100008469
894 Ga0075431_100023868
895 Ga0075431_100072397
896 Ga0075431_100168828
897 Ga0075431_100187053
898 Ga0075431_100312236
899 Ga0075431_100340004
900 Ga0075431_100379091
901 Ga0075431_100461715
902 Ga0075431_100559326
903 Ga0075431_100983240
904 Ga0075433_10006420
905 Ga0075433_10040066
906 Ga0075433_10051693
907 Ga0075433_10056759
908 Ga0075433_10157687
909 Ga0075433_10209438
910 Ga0075433_10361249
911 Ga0075433_10885883
912 Ga0075434_100022146
913 Ga0075434_100031633
914 Ga0075434_100033398
915 Ga0075434_100076744
916 Ga0075434_100156094
917 Ga0075434_100167389
918 Ga0075434_100197129
919 Ga0075434_100223242
920 Ga0075434_100232081
921 Ga0075434_100371253
922 Ga0075434_100470265
923 Ga0075434_100652340
924 Ga0075434_100709239
925 Ga0075434_101469734
926 Ga0075429_100000859
927 Ga0075429_100010038
928 Ga0075429_100011531
929 Ga0075429_100021240
930 Ga0075429_100027920
931 Ga0075429_100030148
932 Ga0075429_100107459
933 Ga0075429_100144173
934 Ga0075429_100144176
935 Ga0075429_100284026
936 Ga0075429_100385766
937 Ga0068865_100124729
938 Ga0075436_100001157
939 Ga0075436_100049119
940 Ga0075436_100281372
941 Ga0097620_100001393
942 Ga0075435_100015296
943 Ga0075435_100033102
944 Ga0075435_100057817
945 Ga0075435_100131566
946 Ga0075435_100220786
947 Ga0075435_100274139
948 Ga0075435_100606107
949 Ga0099794_10003275
950 Ga0099794_10033382
951 Ga0099794_10059008
952 Ga0105251_10006103
953 Ga0105240_10868874
954 Ga0111539_10018495
955 Ga0111539_10082769
956 Ga0111539_10114639
957 Ga0111539_10192811
958 Ga0111539_11030675
959 Ga0111539_11260875
960 Ga0111539_11525077
961 Ga0114129_10000115
962 Ga0114129_10001447
963 Ga0114129_10001631
964 Ga0114129_10008441
965 Ga0114129_10009875
966 Ga0114129_10012822
967 Ga0114129_10036324
968 Ga0114129_10079508
969 Ga0114129_10088357
970 Ga0114129_10102712
971 Ga0114129_10102978
972 Ga0114129_10114996
973 Ga0114129_10119347
974 Ga0114129_10225093
975 Ga0114129_10232391
976 Ga0114129_10273784
977 Ga0114129_10574426
978 Ga0114129_10986130
979 Ga0114129_11264721
980 Ga0105243_10285133
981 Ga0105241_10001038
982 Ga0105242_10589273
983 Ga0105242_10664580
984 Ga0105242_11044536
985 Ga0105249_10082436
986 Ga0105249_10227328
987 Ga0105249_10984313
988 Ga0105249_11010074
989 Ga0105239_11297894
990 Ga0157373_10000388
991 Ga0157373_10205914
992 Ga0157371_10324448
993 Ga0157369_10232425
994 Ga0157378_10933805
995 Ga0163162_10015647
996 Ga0157372_10000105
997 Ga0157372_10072881
998 Ga0157375_10255141
999 Ga0163163_10150574
1000 Ga0157380_10475568
1001 Ga0207713_1022753
1002 Ga0207653_10019880
1003 Ga0207642_10089212
1004 Ga0207688_10012816
1005 Ga0207699_10229099
1006 Ga0207645_10005499
1007 Ga0207645_10117004
1008 Ga0207643_10001465
1009 Ga0207684_10000115
1010 Ga0207684_10018826
1011 Ga0207684_10019692
1012 Ga0207684_10036906
1013 Ga0207684_10073541
1014 Ga0207684_10108911
1015 Ga0207684_10132276
1016 Ga0207684_10159932
1017 Ga0207684_10210168
1018 Ga0207684_10213506
1019 Ga0207684_10251823
1020 Ga0207684_10509497
1021 Ga0207654_10190036
1022 Ga0207707_10000352
1023 Ga0207707_10283306
1024 Ga0207693_10025215
1025 Ga0207693_10186612
1026 Ga0207663_10388572
1027 Ga0207660_10000334
1028 Ga0207660_10127028
1029 Ga0207660_10900651
1030 Ga0207662_10145280
1031 Ga0207657_10002597
1032 Ga0207649_10006035
1033 Ga0207652_10000466
1034 Ga0207652_10097233
1035 Ga0207646_10000250
1036 Ga0207646_10003851
1037 Ga0207646_10008684
1038 Ga0207646_10014285
1039 Ga0207646_10028619
1040 Ga0207646_10032828
1041 Ga0207646_10035039
1042 Ga0207646_10083233
1043 Ga0207646_10084314
1044 Ga0207646_10108278
1045 Ga0207646_10299330
1046 Ga0207646_10976971
1047 Ga0207681_10963595
1048 Ga0207650_10025156
1049 Ga0207659_10148540
1050 Ga0207644_10203632
1051 Ga0207706_10024583
1052 Ga0207706_10323362
1053 Ga0207706_10911078
1054 Ga0207709_10127879
1055 Ga0207670_10088095
1056 Ga0207704_10421945
1057 Ga0207665_10114297
1058 Ga0207665_10165423
1059 Ga0207689_10003685
1060 Ga0207689_10074531
1061 Ga0207661_10148620
1062 Ga0207679_10000878
1063 Ga0207667_10000497
1064 Ga0207651_10184560
1065 Ga0207668_10196221
1066 Ga0207640_10278268
1067 Ga0207703_10019303
1068 Ga0207639_10002384
1069 Ga0207678_10013961
1070 Ga0207641_10071148
1071 Ga0207641_10167672
1072 Ga0207641_10192178
1073 Ga0207648_10015946
1074 Ga0207648_10153126
1075 Ga0207674_10000550
1076 Ga0207675_100005709
1077 Ga0207675_100132891
1078 Ga0207698_10116523
1079 Ga0209981_1000490
1080 Ga0209996_1000338
1081 Ga0209984_1015316
1082 Ga0210000_1008761
1083 Ga0209968_1000579
1084 Ga0209999_1000243
1085 Ga0209982_1001041
1086 Ga0209983_1000034
1087 Ga0209588_1045530
1088 Ga0209588_1051939
1089 Ga0209971_1000028
1090 Ga0209971_1005708
1091 Ga0209971_1036225
1092 Ga0209966_1000073
1093 Ga0209966_1009155
1094 Ga0209998_10000001
1095 Ga0209998_10116032
1096 Ga0209974_10000369
1097 Ga0209974_10015144
1098 Ga0209974_10093959
1099 Ga0207428_10000176
1100 Ga0207428_10000394
1101 Ga0207428_10123151
1102 Ga0207428_10141454
1103 Ga0268265_10024098
1104 Ga0268265_10088185
1105 Ga0268264_10031393
1106 Ga0268264_11014898
1107 Ga0265332_10091490
1108 Ga0307408_100034524
1109 Ga0307408_100222462
1110 Ga0307405_10157785
1111 Ga0307405_11237454
1112 Ga0307410_10059238
1113 Ga0307410_10130784
1114 Ga0307409_100572154
1115 Ga0307416_100553296
1116 Ga0307416_101979282
1117 Ga0307411_10034095
1118 Ga0307411_10069622
1119 Ga0307415_100326416
1120 Ga0373928_0075756
1121 Ga0373929_0145897
1122 Ga0373949_0034097
1123 Ga0373932_0003143
1124 Ga0373939_0007077
1125 Ga0373941_0062149
1126 Ga0373962_0064142
1127 Ga0373931_0008836
1128 Ga0373931_0081418
1129 Ga0395899_0005401
1130 Ga0395899_0025520
1131 Ga0395899_0265576
1132 Ga0395900_0038990
1133 Ga0395900_0333236
1134 Ga0395905_0139761
1135 Ga0395901_0103437
1136 Ga0242420_018422
1137 Ga0439448_0009418
1138 Ga0439450_116358
1139 Ga0439455_0013689
1140 Ga0439455_0027803
1141 Ga0439458_0002296
1142 Ga0439434_0053749
1143 Ga0439435_0129585
1144 Ga0439459_0012077
1145 Ga0439460_0001203
1146 Ga0439460_0073831
1147 Ga0451577_0010038
1148 Ga0451577_0025265
1149 Ga0451577_0035839
1150 Ga0451577_0351582
1151 Ga0451577_0411462
1152 Ga0451577_0559300
1153 Ga0453683_0003008
1154 Ga0453683_0005950
1155 Ga0453683_0013136
1156 Ga0453683_0025100
1157 Ga0453683_0033515
1158 Ga0453684_0032377
1159 Ga0453684_0082341
1160 Ga0453684_0185691
1161 Ga0451576_0024239
1162 Ga0451576_0026201
1163 Ga0451576_0028871
1164 Ga0451576_0036861
1165 Ga0451576_0049195
1166 Ga0451576_0263638
1167 Ga0451576_0278038
1168 Ga0451576_0353374
1169 Ga0495580_0029596
1170 Ga0495580_0202467
1171 Ga0495580_0277844
1172 Ga0495594_0214590
1173 Ga0495642_0088081
1174 Ga0495609_0203461
1175 Ga0495656_0070364
1176 Ga0495659_0054774
1177 Ga0495669_0032522
1178 Ga0495669_0141691
1179 Ga0495669_0152784
1180 Ga0496102_0001871
1181 Ga0496106_0239711
1182 Ga0496108_0361939
1183 Ga0501031_0090122
1184 Ga0501031_0193282
1185 Ga0501033_0225203
1186 Ga0501033_0231740
1187 Ga0501036_0025187
1188 Ga0501036_0224031
1189 Ga0501036_0308257
1190 Ga0501036_0386286
1191 Ga0501036_0448893
1192 Ga0501036_0710671
1193 Ga0501037_0308819
1194 Ga0501038_0100011
1195 Ga0501038_0110847
1196 Ga0501038_0197507
1197 Ga0501038_0473156
1198 Ga0501038_0597343
1199 Ga0501039_0164062
1200 Ga0501039_0201418
1201 Ga0501039_0291456
1202 Ga0501039_0311493
1203 Ga0501039_0336090
1204 Ga0501039_0517763
1205 Ga0501040_0006783
1206 Ga0501040_0016619
1207 Ga0501040_0055431
1208 Ga0501040_0055533
1209 Ga0501040_0067285
1210 Ga0501040_0113952
1211 Ga0501040_0120591
1212 Ga0501040_0154345
1213 Ga0501040_0156057
1214 Ga0501040_0177175
1215 Ga0501040_0204399
1216 Ga0501040_0266368
1217 Ga0501040_0437225
1218 Ga0501040_0870403
1219 Ga0501041_0009513
1220 Ga0501041_0031877
1221 Ga0501041_0041434
1222 Ga0501041_0165786
1223 Ga0501041_0255052
1224 Ga0501042_0007739
1225 Ga0501042_0030821
1226 Ga0501042_0071625
1227 Ga0501042_0106688
1228 Ga0501042_0160808
1229 Ga0501042_0339482
1230 Ga0501046_0002061
1231 Ga0501046_0016933
1232 Ga0501046_0162774
1233 Ga0501046_0202866
1234 Ga0501046_0502094
1235 Ga0501047_0056714
1236 Ga0501048_0021144
1237 Ga0501048_0044237
1238 Ga0501048_0058521
1239 Ga0501048_0305062
1240 Ga0501067_0048491
1241 Ga0501068_0047035
1242 Ga0501068_0064635
1243 Ga0501068_0087739
1244 Ga0501069_0007927
1245 Ga0501070_0316882
1246 Ga0501071_0096534
1247 Ga0501071_0124817
1248 Ga0501071_0186637
1249 Ga0501071_0219441
1250 Ga0501071_0602815
1251 Ga0501072_0015809
1252 Ga0501072_0025773
1253 Ga0501072_0026080
1254 Ga0501072_0054150
1255 Ga0501072_0059434
1256 Ga0501072_0116890
1257 Ga0501072_0124331
1258 Ga0501072_0188867
1259 Ga0501072_0236008
1260 Ga0501072_0260974
1261 Ga0501072_0276920
1262 Ga0501072_0298420
1263 Ga0501072_0333483
1264 Ga0501072_0380619
1265 Ga0501073_0260566
1266 Ga0501074_0019321
1267 Ga0501074_0021260
1268 Ga0501074_0080958
1269 Ga0501074_0102039
1270 Ga0501074_0505234
1271 Ga0501075_0014948
1272 Ga0501075_0029861
1273 Ga0501075_0076372
1274 Ga0501075_0076992
1275 Ga0501075_0097421
1276 Ga0501075_0104215
1277 Ga0501075_0108503
1278 Ga0501075_0186754
1279 Ga0501075_0298672
1280 Ga0501075_0370131
1281 Ga0501075_0441825
1282 Ga0501076_0002878
1283 Ga0501076_0019643
1284 Ga0501076_0021226
1285 Ga0501076_0024534
1286 Ga0501076_0055972
1287 Ga0501076_0065644
1288 Ga0501076_0109288
1289 Ga0501076_0110518
1290 Ga0501076_0121304
1291 Ga0501076_0220677
1292 Ga0501076_0270085
1293 Ga0501076_0471809
1294 Ga0501076_0502749
1295 Ga0501077_0009924
1296 Ga0501077_0009995
1297 Ga0501077_0086190
1298 Ga0501077_0118791
1299 Ga0501077_0149061
1300 Ga0501077_0191364
1301 Ga0501079_0001185
1302 Ga0501079_0011862
1303 Ga0501079_0017090
1304 Ga0501079_0018925
1305 Ga0501079_0043772
1306 Ga0501079_0218232
1307 Ga0501079_0247687
1308 Ga0501079_0436105
1309 Ga0501080_0059941
1310 Ga0501080_0113479
1311 Ga0501080_0122207
1312 Ga0501080_0318970
1313 Ga0501081_0001033
1314 Ga0501081_0003182
1315 Ga0501081_0008697
1316 Ga0501081_0016788
1317 Ga0501081_0021956
1318 Ga0501081_0036313
1319 Ga0501081_0112229
1320 Ga0501081_0324469
1321 Ga0501081_0404848
1322 Ga0501081_0474753
1323 Ga0501081_0554960
1324 Ga0501081_0618435
1325 Ga0501081_0881902
1326 Ga0501083_0031778
1327 Ga0501083_0113204
1328 Ga0501083_0240779
1329 Ga0501045_0024468
1330 Ga0501045_0073786
1331 Ga0501045_0156523
1332 Ga0501045_0485680
1333 Ga0501045_0550117
1334 Ga0501045_0602268
1335 Ga0501045_0708612
1336 nmdc:mga05p37_141781_c1
1337 nmdc:mga05p37_14582_c1
1338 nmdc:mga05p37_189936_c1
1339 nmdc:mga05p37_21565_c1
1340 nmdc:mga05p37_218253_c1
1341 nmdc:mga05p37_23238_c1
1342 nmdc:mga05p37_28205_c1
1343 nmdc:mga05p37_331825_c1
1344 nmdc:mga05p37_336224_c1
1345 nmdc:mga05p37_339410_c1
1346 nmdc:mga05p37_3396_c1
1347 nmdc:mga05p37_35596_c1
1348 nmdc:mga05p37_363045_c1
1349 nmdc:mga05p37_37629_c1
1350 nmdc:mga05p37_413792_c1
1351 nmdc:mga05p37_433261_c1
1352 nmdc:mga05p37_65962_c1
1353 nmdc:mga05p37_736607_c1
1354 nmdc:mga05p37_85453_c1
1355 nmdc:mga05p37_89_c1
1356 nmdc:mga09592_1406_c1
1357 nmdc:mga09592_21339_c1
1358 nmdc:mga09592_349513_c1
1359 nmdc:mga09592_36258_c1
1360 nmdc:mga09592_41843_c1
1361 nmdc:mga09592_6345_c1
1362 nmdc:mga09592_837_c1
1363 nmdc:mga0qj67_130140_c1
1364 nmdc:mga0qj67_22992_c1
1365 nmdc:mga0qj67_246111_c1
1366 nmdc:mga0qj67_343_c1
1367 nmdc:mga0qj67_43339_c1
1368 nmdc:mga0qj67_798_c1
1369 nmdc:mga06r32_10348_c1
1370 nmdc:mga06r32_1324267_c1
1371 nmdc:mga06r32_14068_c1
1372 nmdc:mga06r32_181961_c1
1373 nmdc:mga06r32_20307_c1
1374 nmdc:mga06r32_27649_c1
1375 nmdc:mga06r32_287705_c1
1376 nmdc:mga06r32_32294_c1
1377 nmdc:mga06r32_345196_c1
1378 nmdc:mga06r32_4631_c1
1379 nmdc:mga06r32_523226_c1
1380 nmdc:mga06r32_654930_c1
1381 nmdc:mga06r32_705351_c1
1382 nmdc:mga06r32_76392_c1
1383 nmdc:mga06r32_87705_c1
1384 nmdc:mga08y16_108945_c1
1385 nmdc:mga08y16_1417_c1
1386 nmdc:mga08y16_163309_c1
1387 nmdc:mga08y16_2945_c1
1388 nmdc:mga08y16_556387_c1
1389 nmdc:mga08y16_90439_c1
1390 nmdc:mga0n895_1008327_c1
1391 nmdc:mga0n895_1302219_c1
1392 nmdc:mga0n895_176870_c1
1393 nmdc:mga0n895_203_c1
1394 nmdc:mga0n895_230485_c1
1395 nmdc:mga0n895_300974_c1
1396 nmdc:mga0n895_35010_c1
1397 nmdc:mga0n895_41940_c1
1398 nmdc:mga0n895_43098_c1
1399 nmdc:mga0n895_469973_c1
1400 nmdc:mga0n895_61867_c1
1401 nmdc:mga0n895_647060_c1
1402 nmdc:mga0n895_677592_c1
1403 nmdc:mga0n895_735924_c1
1404 nmdc:mga0n895_88977_c1
1405 nmdc:mga0rr50_152938_c1
1406 nmdc:mga0rr50_33149_c1
1407 nmdc:mga0rr50_389073_c1
1408 nmdc:mga0rr50_551275_c1
1409 nmdc:mga0rr50_599997_c1
1410 nmdc:mga0rr50_694_c1
1411 nmdc:mga08x19_153171_c1
1412 nmdc:mga08x19_384020_c1
1413 nmdc:mga08x19_4220_c1
1414 nmdc:mga08x19_470_c1
1415 nmdc:mga0a205_1021094_c1
1416 nmdc:mga0a205_12060_c1
1417 nmdc:mga0a205_156907_c1
1418 nmdc:mga0a205_156982_c1
1419 nmdc:mga0a205_205119_c1
1420 nmdc:mga0a205_22996_c1
1421 nmdc:mga0a205_24042_c1
1422 nmdc:mga0a205_432933_c1
1423 nmdc:mga0a205_49115_c1
1424 nmdc:mga0a205_58667_c1
1425 nmdc:mga0a205_5896_c1
1426 Ga0501084_0015809
1427 Ga0501084_0055736
1428 Ga0501084_0097754
1429 Ga0501084_0117206
1430 Ga0501084_0257276
1431 Ga0501084_0394375
1432 Ga0501084_0449865
1433 Ga0501084_0541814
1434 Ga0501084_0621423
1435 Ga0590071_010281
1436 Ga0590075_052785
1437 Ga0501082_0056973
1438 Ga0501082_0064057
1439 Ga0501082_0109230
1440 Ga0501082_0190196
1441 Ga0501082_0229789
1442 Ga0501082_0261260
1443 Ga0501082_0276776
1444 Ga0501082_0494565
1445 Ga0530510_0012716
1446 Ga0530510_0015625
1447 Ga0530510_0042801
1448 Ga0530510_0046999
1449 Ga0530510_0063379
1450 Ga0530510_0122257
1451 Ga0530510_0343364
1452 Ga0530510_0391577
1453 Ga0530510_0839864
1454 2857607586
1455 2864998605
1456 2889298289
1457 2981286776
1458 2981291727
1459 2981982416
1460 2981987320
1461 8022948895
1462 8054800799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

1

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uq8-assembly1.cif.gz_B crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate and malonate 0.9376 30 192
6uq9-assembly1.cif.gz_B crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.9376 30 192
6uqm-assembly1.cif.gz_B crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.9374 30 192
6uqn-assembly1.cif.gz_B crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate 0.9363 30 192
6uqb-assembly1.cif.gz_A crystal structure of r471a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate and malonate 0.9357 30 192
ID Description Score Start End Superfamily
af_E9AH43_359_548_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9374 30 193 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9278 23 192 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9178 23 192 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9017 23 192 3.20.130.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8892 23 191 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A2V7FHV7-F1-model_v4 TRZ/ATZ family protein 0.9965 23 135 GO:0016836
AF-A0A2V6WXE7-F1-model_v4 TRZ/ATZ family protein 0.9928 29 191 GO:0016836
AF-A0A2V6ZFZ3-F1-model_v4 Fe-S-containing hydro-lyase 0.99 13 200 GO:0016836
AF-A0A2V6SD42-F1-model_v4 TRZ/ATZ family protein 0.9882 23 200 GO:0016836
AF-A0A1V5BMI2-F1-model_v4 Fumarate hydratase class I, anaerobic (EC 4.2.1.2) 0.988 23 199 GO:0004333
GO:0008730

Map