F477952
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 317 | 719 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100011641|Ga0070698_1000116416 |
| Length | 378 |
| Sequence | VAYRTGTFTVPCSARFSAHVSYKHAGNHWTGRHSWGDRSLHSCPPASQTAGLSRHGWQRQVLIRKVMIMRVFVAGGSGVLGRRLVPQLVARGHQVTATTTSAGKLDLLARLGADGVVMDGLDAVSVGEAVAKARPDTIVHEMTGISLTHAGKPDLKHFDRWAVPTIRLRTEGTDHLLAAAEATGVSHFVAQGYANWNGIRQGGWVKTEEDPLDLYEGTAAYTSMAAGRHVEDVVGKAGGAVMRYGGFYGPGATDDQVELVRKRQFPLVGSGAGYASWVHLDDAASATVLAVEQQATGVFNIVDDEPAPASEWLPYLAECAGAKRPMRVPKWLARLLAGEVAVVMMTEGRGFSNAKAKRELGWELRYPSWRQGFKEGMT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 2 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 3 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 4 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 5 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 6 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 7 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 8 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 9 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 10 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 11 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 12 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 15 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 157 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 158 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 163 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 189 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 199 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 200 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 201 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 202 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 203 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 263 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 266 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 267 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 272 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 0.27 |
| Isolates | 1.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.09 |
| Nodule | 0.14 |
| Rhizoplane | 7.25 |
| Rhizosphere | 87.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10012270 | 3300001979 | Bacteria | 3235 |
| 2 | JGI24739J22299_10014039 | 3300001989 | Bacteria | 2917 |
| 3 | JGI24737J22298_10011157 | 3300001990 | Bacteria | 2948 |
| 4 | JGI25406J46586_10044253 | 3300003203 | Bacteria | 1543 |
| 5 | rootH1_10008338 | 3300003316 | Bacteria | 1562 |
| 6 | rootH2_10010881 | 3300003320 | Bacteria | 3708 |
| 7 | rootL2_10241102 | 3300003322 | Bacteria | 1787 |
| 8 | JGI25407J50210_10008113 | 3300003373 | Bacteria | 2644 |
| 9 | JGI25407J50210_10009481 | 3300003373 | Bacteria | 2467 |
| 10 | JGI25407J50210_10009581 | 3300003373 | Bacteria | 2456 |
| 11 | Ga0055527_1000005 | 3300003760 | Bacteria | 504776 |
| 12 | Ga0055542_1000006 | 3300003762 | Bacteria | 504776 |
| 13 | Ga0055529_1000013 | 3300003763 | Bacteria | 373267 |
| 14 | Ga0070658_10006366 | 3300005327 | Bacteria | 9568 |
| 15 | Ga0070658_10035358 | 3300005327 | Bacteria | 4024 |
| 16 | Ga0070658_10047682 | 3300005327 | Bacteria | 3467 |
| 17 | Ga0070676_10083492 | 3300005328 | Bacteria | 1943 |
| 18 | Ga0070683_100000483 | 3300005329 | Bacteria | 28059 |
| 19 | Ga0070683_100001497 | 3300005329 | Bacteria | 18032 |
| 20 | Ga0070683_100045577 | 3300005329 | Bacteria | 4047 |
| 21 | Ga0070683_100206948 | 3300005329 | Bacteria | 1864 |
| 22 | Ga0070683_100248637 | 3300005329 | Bacteria | 1691 |
| 23 | Ga0070680_100050335 | 3300005336 | Bacteria | 3398 |
| 24 | Ga0070680_100230814 | 3300005336 | Bacteria | 1563 |
| 25 | Ga0070682_100086291 | 3300005337 | Bacteria | 2044 |
| 26 | Ga0070682_100092529 | 3300005337 | Bacteria | 1981 |
| 27 | Ga0070660_100013235 | 3300005339 | Bacteria | 5912 |
| 28 | Ga0070691_10034860 | 3300005341 | Bacteria | 2369 |
| 29 | Ga0070687_100101115 | 3300005343 | Bacteria | 1614 |
| 30 | Ga0070692_10009217 | 3300005345 | Bacteria | 4440 |
| 31 | Ga0070668_100231051 | 3300005347 | Bacteria | 1529 |
| 32 | Ga0070659_100018755 | 3300005366 | Bacteria | 5222 |
| 33 | Ga0070659_100019569 | 3300005366 | Bacteria | 5133 |
| 34 | Ga0070709_10231385 | 3300005434 | Bacteria | 1323 |
| 35 | Ga0070714_100005972 | 3300005435 | Bacteria | 9351 |
| 36 | Ga0070714_100055035 | 3300005435 | Bacteria | 3400 |
| 37 | Ga0070714_100091827 | 3300005435 | Bacteria | 2660 |
| 38 | Ga0070713_100075395 | 3300005436 | Bacteria | 2860 |
| 39 | Ga0070713_100123406 | 3300005436 | Bacteria | 2275 |
| 40 | Ga0070713_100139987 | 3300005436 | Bacteria | 2142 |
| 41 | Ga0070713_100271189 | 3300005436 | Bacteria | 1554 |
| 42 | Ga0070713_100365114 | 3300005436 | Bacteria | 1342 |
| 43 | Ga0070710_10256032 | 3300005437 | Bacteria | 1127 |
| 44 | Ga0070711_100232449 | 3300005439 | Bacteria | 1438 |
| 45 | Ga0070700_100190595 | 3300005441 | Bacteria | 1433 |
| 46 | Ga0070708_100106514 | 3300005445 | Bacteria | 2573 |
| 47 | Ga0070708_100206136 | 3300005445 | Bacteria | 1842 |
| 48 | Ga0070708_100226358 | 3300005445 | Bacteria | 1754 |
| 49 | Ga0070663_100030931 | 3300005455 | Bacteria | 3673 |
| 50 | Ga0070663_100072161 | 3300005455 | Bacteria | 2514 |
| 51 | Ga0070663_100072486 | 3300005455 | Bacteria | 2509 |
| 52 | Ga0070663_100350266 | 3300005455 | Bacteria | 1196 |
| 53 | Ga0070678_100158562 | 3300005456 | Bacteria | 1831 |
| 54 | Ga0070678_100176928 | 3300005456 | Bacteria | 1743 |
| 55 | Ga0070662_100069452 | 3300005457 | Bacteria | 2593 |
| 56 | Ga0070681_10187426 | 3300005458 | Bacteria | 1989 |
| 57 | Ga0070706_100000176 | 3300005467 | Bacteria | 81107 |
| 58 | Ga0070706_100007256 | 3300005467 | Bacteria | 10410 |
| 59 | Ga0070706_100033263 | 3300005467 | Bacteria | 4758 |
| 60 | Ga0070706_100033523 | 3300005467 | Bacteria | 4740 |
| 61 | Ga0070706_100095491 | 3300005467 | Bacteria | 2759 |
| 62 | Ga0070706_100110998 | 3300005467 | Bacteria | 2552 |
| 63 | Ga0070707_100001211 | 3300005468 | Bacteria | 25388 |
| 64 | Ga0070707_100030035 | 3300005468 | Bacteria | 5171 |
| 65 | Ga0070707_100031127 | 3300005468 | Bacteria | 5081 |
| 66 | Ga0070707_100070307 | 3300005468 | Bacteria | 3371 |
| 67 | Ga0070698_100011641 | 3300005471 | Bacteria | 9333 |
| 68 | Ga0070698_100012039 | 3300005471 | Bacteria | 9171 |
| 69 | Ga0070698_100012398 | 3300005471 | Bacteria | 9029 |
| 70 | Ga0070698_100013437 | 3300005471 | Bacteria | 8666 |
| 71 | Ga0070699_100010740 | 3300005518 | Bacteria | 7924 |
| 72 | Ga0070699_100186402 | 3300005518 | Bacteria | 1842 |
| 73 | Ga0070679_100091501 | 3300005530 | Bacteria | 3030 |
| 74 | Ga0070679_100105047 | 3300005530 | Bacteria | 2811 |
| 75 | Ga0070679_100125024 | 3300005530 | Bacteria | 2554 |
| 76 | Ga0070684_100002110 | 3300005535 | Bacteria | 14647 |
| 77 | Ga0070684_100018621 | 3300005535 | Bacteria | 5726 |
| 78 | Ga0070684_100085979 | 3300005535 | Bacteria | 2790 |
| 79 | Ga0070684_100092191 | 3300005535 | Bacteria | 2696 |
| 80 | Ga0070684_100092854 | 3300005535 | Bacteria | 2686 |
| 81 | Ga0070697_100000837 | 3300005536 | Bacteria | 23106 |
| 82 | Ga0070665_100000957 | 3300005548 | Bacteria | 36788 |
| 83 | Ga0070665_100056718 | 3300005548 | Bacteria | 3927 |
| 84 | Ga0070665_100120691 | 3300005548 | Bacteria | 2623 |
| 85 | Ga0070665_100122462 | 3300005548 | Bacteria | 2603 |
| 86 | Ga0068855_100045343 | 3300005563 | Bacteria | 5200 |
| 87 | Ga0068855_100050902 | 3300005563 | Bacteria | 4880 |
| 88 | Ga0068855_100172695 | 3300005563 | Bacteria | 2447 |
| 89 | Ga0070664_100155883 | 3300005564 | Bacteria | 2018 |
| 90 | Ga0068857_100007737 | 3300005577 | Bacteria | 9257 |
| 91 | Ga0068857_100316238 | 3300005577 | Bacteria | 1441 |
| 92 | Ga0068857_100388624 | 3300005577 | Bacteria | 1297 |
| 93 | Ga0068854_100014763 | 3300005578 | Bacteria | 5156 |
| 94 | Ga0068856_100017299 | 3300005614 | Bacteria | 6989 |
| 95 | Ga0068856_100027547 | 3300005614 | Bacteria | 5542 |
| 96 | Ga0070702_100036899 | 3300005615 | Bacteria | 2712 |
| 97 | Ga0068852_100012963 | 3300005616 | Bacteria | 6359 |
| 98 | Ga0068852_100068154 | 3300005616 | Bacteria | 3113 |
| 99 | Ga0068852_100338677 | 3300005616 | Bacteria | 1465 |
| 100 | Ga0068852_100763942 | 3300005616 | Bacteria | 979 |
| 101 | Ga0068864_100025281 | 3300005618 | Bacteria | 5000 |
| 102 | Ga0068864_100205781 | 3300005618 | Bacteria | 1810 |
| 103 | Ga0068864_100434364 | 3300005618 | Bacteria | 1253 |
| 104 | Ga0068861_100068442 | 3300005719 | Bacteria | 2744 |
| 105 | Ga0068861_100154169 | 3300005719 | Bacteria | 1888 |
| 106 | Ga0068863_100044588 | 3300005841 | Bacteria | 4208 |
| 107 | Ga0068858_100000054 | 3300005842 | Bacteria | 119686 |
| 108 | Ga0068858_100088463 | 3300005842 | Bacteria | 2882 |
| 109 | Ga0068858_100232197 | 3300005842 | Bacteria | 1749 |
| 110 | Ga0081455_10003970 | 3300005937 | Bacteria | 16776 |
| 111 | Ga0081455_10007936 | 3300005937 | Bacteria | 11107 |
| 112 | Ga0081455_10012717 | 3300005937 | Bacteria | 8375 |
| 113 | Ga0081455_10014692 | 3300005937 | Bacteria | 7648 |
| 114 | Ga0081455_10032172 | 3300005937 | Bacteria | 4731 |
| 115 | Ga0081455_10032348 | 3300005937 | Bacteria | 4714 |
| 116 | Ga0081455_10140333 | 3300005937 | Bacteria | 1877 |
| 117 | Ga0081538_10000077 | 3300005981 | Bacteria | 93624 |
| 118 | Ga0081538_10000164 | 3300005981 | Bacteria | 70649 |
| 119 | Ga0081538_10000223 | 3300005981 | Bacteria | 63727 |
| 120 | Ga0081538_10000327 | 3300005981 | Bacteria | 54457 |
| 121 | Ga0081538_10000671 | 3300005981 | Bacteria | 37656 |
| 122 | Ga0081538_10001086 | 3300005981 | Bacteria | 28963 |
| 123 | Ga0081538_10001230 | 3300005981 | Bacteria | 26863 |
| 124 | Ga0081538_10001334 | 3300005981 | Bacteria | 25379 |
| 125 | Ga0081538_10004928 | 3300005981 | Bacteria | 12159 |
| 126 | Ga0081538_10005814 | 3300005981 | Bacteria | 10994 |
| 127 | Ga0081538_10008447 | 3300005981 | Bacteria | 8737 |
| 128 | Ga0081538_10010361 | 3300005981 | Bacteria | 7648 |
| 129 | Ga0081538_10011370 | 3300005981 | Bacteria | 7217 |
| 130 | Ga0081538_10011964 | 3300005981 | Bacteria | 6995 |
| 131 | Ga0081538_10014900 | 3300005981 | Bacteria | 6054 |
| 132 | Ga0081538_10049706 | 3300005981 | Bacteria | 2541 |
| 133 | Ga0081538_10065101 | 3300005981 | Bacteria | 2056 |
| 134 | Ga0081540_1010943 | 3300005983 | Bacteria | 6093 |
| 135 | Ga0081540_1015521 | 3300005983 | Bacteria | 4820 |
| 136 | Ga0081540_1022919 | 3300005983 | Bacteria | 3671 |
| 137 | Ga0081540_1027370 | 3300005983 | Bacteria | 3232 |
| 138 | Ga0081539_10000312 | 3300005985 | Bacteria | 108472 |
| 139 | Ga0081539_10000594 | 3300005985 | Bacteria | 73925 |
| 140 | Ga0081539_10001504 | 3300005985 | Bacteria | 39371 |
| 141 | Ga0081539_10002251 | 3300005985 | Bacteria | 28053 |
| 142 | Ga0081539_10003229 | 3300005985 | Bacteria | 20547 |
| 143 | Ga0081539_10003621 | 3300005985 | Bacteria | 18632 |
| 144 | Ga0081539_10012129 | 3300005985 | Bacteria | 6694 |
| 145 | Ga0081539_10077093 | 3300005985 | Bacteria | 1764 |
| 146 | Ga0070717_10017924 | 3300006028 | Bacteria | 5522 |
| 147 | Ga0070717_10024373 | 3300006028 | Bacteria | 4804 |
| 148 | Ga0070717_10064090 | 3300006028 | Bacteria | 3052 |
| 149 | Ga0070717_10125084 | 3300006028 | Bacteria | 2207 |
| 150 | Ga0070717_10245051 | 3300006028 | Bacteria | 1582 |
| 151 | Ga0070712_100135997 | 3300006175 | Bacteria | 1869 |
| 152 | Ga0075428_100000663 | 3300006844 | Bacteria | 35387 |
| 153 | Ga0075428_100002757 | 3300006844 | Bacteria | 19130 |
| 154 | Ga0075428_100006856 | 3300006844 | Bacteria | 12656 |
| 155 | Ga0075428_100009472 | 3300006844 | Bacteria | 10811 |
| 156 | Ga0075428_100020214 | 3300006844 | Bacteria | 7374 |
| 157 | Ga0075428_100020699 | 3300006844 | Bacteria | 7285 |
| 158 | Ga0075428_100033909 | 3300006844 | Bacteria | 5632 |
| 159 | Ga0075428_100045071 | 3300006844 | Bacteria | 4846 |
| 160 | Ga0075428_100050378 | 3300006844 | Bacteria | 4567 |
| 161 | Ga0075428_100202250 | 3300006844 | Bacteria | 2147 |
| 162 | Ga0075428_100203230 | 3300006844 | Bacteria | 2141 |
| 163 | Ga0075428_100410159 | 3300006844 | Bacteria | 1452 |
| 164 | Ga0075430_100009975 | 3300006846 | Bacteria | 8035 |
| 165 | Ga0075430_100019158 | 3300006846 | Bacteria | 5818 |
| 166 | Ga0075431_100004704 | 3300006847 | Bacteria | 13407 |
| 167 | Ga0075431_100010408 | 3300006847 | Bacteria | 9348 |
| 168 | Ga0075431_100021090 | 3300006847 | Bacteria | 6659 |
| 169 | Ga0075431_100037919 | 3300006847 | Bacteria | 4963 |
| 170 | Ga0075431_100411300 | 3300006847 | Bacteria | 1353 |
| 171 | Ga0075433_10060114 | 3300006852 | Bacteria | 3327 |
| 172 | Ga0075434_100321175 | 3300006871 | Bacteria | 1569 |
| 173 | Ga0075429_100000008 | 3300006880 | Bacteria | 86739 |
| 174 | Ga0075429_100003483 | 3300006880 | Bacteria | 13430 |
| 175 | Ga0075429_100013263 | 3300006880 | Bacteria | 7147 |
| 176 | Ga0075429_100024155 | 3300006880 | Bacteria | 5272 |
| 177 | Ga0075429_100073229 | 3300006880 | Bacteria | 2984 |
| 178 | Ga0068865_100039073 | 3300006881 | Bacteria | 3217 |
| 179 | Ga0068865_100164176 | 3300006881 | Bacteria | 1697 |
| 180 | Ga0105240_10192816 | 3300009093 | Bacteria | 2395 |
| 181 | Ga0111539_10094434 | 3300009094 | Bacteria | 3513 |
| 182 | Ga0111539_10150710 | 3300009094 | Bacteria | 2722 |
| 183 | Ga0111539_10205473 | 3300009094 | Bacteria | 2296 |
| 184 | Ga0111539_10225926 | 3300009094 | Bacteria | 2180 |
| 185 | Ga0111539_10413138 | 3300009094 | Bacteria | 1572 |
| 186 | Ga0105245_10094256 | 3300009098 | Bacteria | 2759 |
| 187 | Ga0105245_10128301 | 3300009098 | Bacteria | 2376 |
| 188 | Ga0105247_10000892 | 3300009101 | Bacteria | 22478 |
| 189 | Ga0105247_10059738 | 3300009101 | Bacteria | 2361 |
| 190 | Ga0114129_10000657 | 3300009147 | Bacteria | 43267 |
| 191 | Ga0114129_10001247 | 3300009147 | Bacteria | 33913 |
| 192 | Ga0114129_10016283 | 3300009147 | Bacteria | 10583 |
| 193 | Ga0114129_10147268 | 3300009147 | Bacteria | 3225 |
| 194 | Ga0114129_10497000 | 3300009147 | Bacteria | 1594 |
| 195 | Ga0105243_10057296 | 3300009148 | Bacteria | 3102 |
| 196 | Ga0105243_10074560 | 3300009148 | Bacteria | 2752 |
| 197 | Ga0105241_10047293 | 3300009174 | Bacteria | 3271 |
| 198 | Ga0105242_10291961 | 3300009176 | Bacteria | 1485 |
| 199 | Ga0105248_10130139 | 3300009177 | Bacteria | 2839 |
| 200 | Ga0105248_10167557 | 3300009177 | Bacteria | 2476 |
| 201 | Ga0105237_10170094 | 3300009545 | Bacteria | 2179 |
| 202 | Ga0105238_10047945 | 3300009551 | Bacteria | 4306 |
| 203 | Ga0105249_10256250 | 3300009553 | Bacteria | 1736 |
| 204 | Ga0105239_10017343 | 3300010375 | Bacteria | 7965 |
| 205 | Ga0105246_10194114 | 3300011119 | Bacteria | 1574 |
| 206 | Ga0105246_10303339 | 3300011119 | Bacteria | 1290 |
| 207 | Ga0157373_10171813 | 3300013100 | Bacteria | 1525 |
| 208 | Ga0157371_10092779 | 3300013102 | Bacteria | 2139 |
| 209 | Ga0157370_10012750 | 3300013104 | Bacteria | 8693 |
| 210 | Ga0157369_10034217 | 3300013105 | Bacteria | 5578 |
| 211 | Ga0157369_10484930 | 3300013105 | Bacteria | 1279 |
| 212 | Ga0157374_10051781 | 3300013296 | Bacteria | 3821 |
| 213 | Ga0157378_10031404 | 3300013297 | Bacteria | 4692 |
| 214 | Ga0163162_10321744 | 3300013306 | Bacteria | 1679 |
| 215 | Ga0157372_10017497 | 3300013307 | Bacteria | 7692 |
| 216 | Ga0157372_10202844 | 3300013307 | Bacteria | 2298 |
| 217 | Ga0157372_10256280 | 3300013307 | Bacteria | 2031 |
| 218 | Ga0157372_10799249 | 3300013307 | Bacteria | 1096 |
| 219 | Ga0157375_10265047 | 3300013308 | Bacteria | 1880 |
| 220 | Ga0163163_10050496 | 3300014325 | Bacteria | 4096 |
| 221 | Ga0157377_10253718 | 3300014745 | Bacteria | 1141 |
| 222 | Ga0157379_10054667 | 3300014968 | Bacteria | 3567 |
| 223 | Ga0163161_10080068 | 3300017792 | Bacteria | 2403 |
| 224 | Ga0213875_10001296 | 3300021388 | Bacteria | 16625 |
| 225 | Ga0224712_10063666 | 3300022467 | Bacteria | 1477 |
| 226 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 227 | Ga0209147_101200 | 3300025229 | Bacteria | 10460 |
| 228 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 229 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 230 | Ga0207692_10013344 | 3300025898 | Bacteria | 3562 |
| 231 | Ga0207710_10000548 | 3300025900 | Bacteria | 22601 |
| 232 | Ga0207710_10030240 | 3300025900 | Bacteria | 2361 |
| 233 | Ga0207688_10061609 | 3300025901 | Bacteria | 2115 |
| 234 | Ga0207688_10213150 | 3300025901 | Bacteria | 1161 |
| 235 | Ga0207647_10009660 | 3300025904 | Bacteria | 6848 |
| 236 | Ga0207647_10013593 | 3300025904 | Bacteria | 5637 |
| 237 | Ga0207647_10017159 | 3300025904 | Bacteria | 4926 |
| 238 | Ga0207647_10020533 | 3300025904 | Bacteria | 4427 |
| 239 | Ga0207647_10025083 | 3300025904 | Bacteria | 3924 |
| 240 | Ga0207647_10036923 | 3300025904 | Bacteria | 3101 |
| 241 | Ga0207647_10047501 | 3300025904 | Bacteria | 2670 |
| 242 | Ga0207699_10137141 | 3300025906 | Bacteria | 1604 |
| 243 | Ga0207645_10165965 | 3300025907 | Bacteria | 1446 |
| 244 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 245 | Ga0207705_10010070 | 3300025909 | Bacteria | 6881 |
| 246 | Ga0207705_10013985 | 3300025909 | Bacteria | 5784 |
| 247 | Ga0207705_10083798 | 3300025909 | Bacteria | 2327 |
| 248 | Ga0207684_10000494 | 3300025910 | Bacteria | 50002 |
| 249 | Ga0207684_10004954 | 3300025910 | Bacteria | 12422 |
| 250 | Ga0207654_10010796 | 3300025911 | Bacteria | 4650 |
| 251 | Ga0207707_10091731 | 3300025912 | Bacteria | 2655 |
| 252 | Ga0207671_10001058 | 3300025914 | Bacteria | 33358 |
| 253 | Ga0207693_10142821 | 3300025915 | Bacteria | 1882 |
| 254 | Ga0207693_10199392 | 3300025915 | Bacteria | 1574 |
| 255 | Ga0207693_10380138 | 3300025915 | Bacteria | 1104 |
| 256 | Ga0207657_10030888 | 3300025919 | Bacteria | 4856 |
| 257 | Ga0207657_10218357 | 3300025919 | Bacteria | 1528 |
| 258 | Ga0207649_10101944 | 3300025920 | Bacteria | 1902 |
| 259 | Ga0207652_10064266 | 3300025921 | Bacteria | 3175 |
| 260 | Ga0207652_10341150 | 3300025921 | Bacteria | 1352 |
| 261 | Ga0207652_10356150 | 3300025921 | Bacteria | 1321 |
| 262 | Ga0207646_10003853 | 3300025922 | Bacteria | 16660 |
| 263 | Ga0207646_10005806 | 3300025922 | Bacteria | 12920 |
| 264 | Ga0207646_10062241 | 3300025922 | Bacteria | 3331 |
| 265 | Ga0207646_10123758 | 3300025922 | Bacteria | 2324 |
| 266 | Ga0207694_10105587 | 3300025924 | Bacteria | 2236 |
| 267 | Ga0207687_10003716 | 3300025927 | Bacteria | 10271 |
| 268 | Ga0207700_10078916 | 3300025928 | Bacteria | 2562 |
| 269 | Ga0207700_10187479 | 3300025928 | Bacteria | 1736 |
| 270 | Ga0207700_10316264 | 3300025928 | Bacteria | 1352 |
| 271 | Ga0207664_10002832 | 3300025929 | Bacteria | 11519 |
| 272 | Ga0207664_10071483 | 3300025929 | Bacteria | 2795 |
| 273 | Ga0207664_10078846 | 3300025929 | Bacteria | 2672 |
| 274 | Ga0207690_10132441 | 3300025932 | Bacteria | 1826 |
| 275 | Ga0207690_10322715 | 3300025932 | Bacteria | 1214 |
| 276 | Ga0207706_10049304 | 3300025933 | Bacteria | 3721 |
| 277 | Ga0207686_10080137 | 3300025934 | Bacteria | 2128 |
| 278 | Ga0207686_10270712 | 3300025934 | Bacteria | 1249 |
| 279 | Ga0207709_10052281 | 3300025935 | Bacteria | 2508 |
| 280 | Ga0207669_10266573 | 3300025937 | Bacteria | 1284 |
| 281 | Ga0207691_10142536 | 3300025940 | Bacteria | 2111 |
| 282 | Ga0207711_10088721 | 3300025941 | Bacteria | 2716 |
| 283 | Ga0207661_10000475 | 3300025944 | Bacteria | 25973 |
| 284 | Ga0207661_10023816 | 3300025944 | Bacteria | 4631 |
| 285 | Ga0207661_10159304 | 3300025944 | Bacteria | 1957 |
| 286 | Ga0207661_10353887 | 3300025944 | Bacteria | 1325 |
| 287 | Ga0207679_10081933 | 3300025945 | Bacteria | 2469 |
| 288 | Ga0207667_10015499 | 3300025949 | Bacteria | 8653 |
| 289 | Ga0207667_10321241 | 3300025949 | Bacteria | 1581 |
| 290 | Ga0207712_10172320 | 3300025961 | Bacteria | 1693 |
| 291 | Ga0207712_10174263 | 3300025961 | Bacteria | 1684 |
| 292 | Ga0207668_10231882 | 3300025972 | Bacteria | 1489 |
| 293 | Ga0207703_10000002 | 3300026035 | Bacteria | 600711 |
| 294 | Ga0207703_10262580 | 3300026035 | Bacteria | 1561 |
| 295 | Ga0207639_10124702 | 3300026041 | Bacteria | 2122 |
| 296 | Ga0207678_10011795 | 3300026067 | Bacteria | 7674 |
| 297 | Ga0207678_10031474 | 3300026067 | Bacteria | 4628 |
| 298 | Ga0207678_10062415 | 3300026067 | Bacteria | 3203 |
| 299 | Ga0207708_10102651 | 3300026075 | Bacteria | 2214 |
| 300 | Ga0207702_10093931 | 3300026078 | Bacteria | 2632 |
| 301 | Ga0207702_10131341 | 3300026078 | Bacteria | 2254 |
| 302 | Ga0207702_10313258 | 3300026078 | Bacteria | 1493 |
| 303 | Ga0207702_10327051 | 3300026078 | Bacteria | 1461 |
| 304 | Ga0207676_10010726 | 3300026095 | Bacteria | 6533 |
| 305 | Ga0207676_10062133 | 3300026095 | Bacteria | 2961 |
| 306 | Ga0207674_10013524 | 3300026116 | Bacteria | 9049 |
| 307 | Ga0207674_10088825 | 3300026116 | Bacteria | 3083 |
| 308 | Ga0207674_10270286 | 3300026116 | Bacteria | 1647 |
| 309 | Ga0207674_10417324 | 3300026116 | Bacteria | 1297 |
| 310 | Ga0207675_100030582 | 3300026118 | Bacteria | 5016 |
| 311 | Ga0207675_100311650 | 3300026118 | Bacteria | 1535 |
| 312 | Ga0207683_10279658 | 3300026121 | Bacteria | 1525 |
| 313 | Ga0207698_10106707 | 3300026142 | Bacteria | 2336 |
| 314 | Ga0207698_10484354 | 3300026142 | Bacteria | 1201 |
| 315 | Ga0207428_10005790 | 3300027907 | Bacteria | 11470 |
| 316 | Ga0268266_10009722 | 3300028379 | Bacteria | 8454 |
| 317 | Ga0268264_10420731 | 3300028381 | Unclassified | 1288 |
| 318 | Ga0307517_10083258 | 3300028786 | Bacteria | 2706 |
| 319 | Ga0307517_10092861 | 3300028786 | Bacteria | 2452 |
| 320 | Ga0307517_10175185 | 3300028786 | Bacteria | 1399 |
| 321 | Ga0307515_10019662 | 3300028794 | Bacteria | 12128 |
| 322 | Ga0307515_10116065 | 3300028794 | Bacteria | 3077 |
| 323 | Ga0307512_10017852 | 3300030522 | Bacteria | 6495 |
| 324 | Ga0307408_100002184 | 3300031548 | Bacteria | 13990 |
| 325 | Ga0307408_100022366 | 3300031548 | Bacteria | 4295 |
| 326 | Ga0307408_100027020 | 3300031548 | Bacteria | 3951 |
| 327 | Ga0307408_100079291 | 3300031548 | Bacteria | 2450 |
| 328 | Ga0307408_100234881 | 3300031548 | Bacteria | 1504 |
| 329 | Ga0307408_100249427 | 3300031548 | Bacteria | 1463 |
| 330 | Ga0307408_100381087 | 3300031548 | Bacteria | 1206 |
| 331 | Ga0310117_100046 | 3300031592 | Bacteria | 5080 |
| 332 | Ga0307508_10011061 | 3300031616 | Bacteria | 8251 |
| 333 | Ga0307514_10010571 | 3300031649 | Bacteria | 7713 |
| 334 | Ga0307516_10142314 | 3300031730 | Bacteria | 2166 |
| 335 | Ga0307405_10000410 | 3300031731 | Bacteria | 16136 |
| 336 | Ga0307405_10027949 | 3300031731 | Bacteria | 3278 |
| 337 | Ga0307405_10032075 | 3300031731 | Bacteria | 3101 |
| 338 | Ga0307405_10068998 | 3300031731 | Bacteria | 2265 |
| 339 | Ga0307405_10071120 | 3300031731 | Bacteria | 2237 |
| 340 | Ga0307405_10086361 | 3300031731 | Bacteria | 2065 |
| 341 | Ga0307405_10091983 | 3300031731 | Bacteria | 2011 |
| 342 | Ga0307405_10197733 | 3300031731 | Bacteria | 1457 |
| 343 | Ga0307413_10036731 | 3300031824 | Bacteria | 2823 |
| 344 | Ga0307413_10094623 | 3300031824 | Bacteria | 1956 |
| 345 | Ga0307413_10208155 | 3300031824 | Bacteria | 1418 |
| 346 | Ga0307518_10277984 | 3300031838 | Bacteria | 1039 |
| 347 | Ga0307410_10000900 | 3300031852 | Bacteria | 12700 |
| 348 | Ga0307410_10029720 | 3300031852 | Bacteria | 3483 |
| 349 | Ga0307410_10196868 | 3300031852 | Bacteria | 1536 |
| 350 | Ga0307410_10344409 | 3300031852 | Bacteria | 1189 |
| 351 | Ga0326468_10000094 | 3300031889 | Bacteria | 7752 |
| 352 | Ga0307406_10000850 | 3300031901 | Bacteria | 17184 |
| 353 | Ga0307406_10006925 | 3300031901 | Bacteria | 6279 |
| 354 | Ga0307406_10154755 | 3300031901 | Bacteria | 1640 |
| 355 | Ga0307406_10470821 | 3300031901 | Bacteria | 1012 |
| 356 | Ga0307407_10000978 | 3300031903 | Bacteria | 9776 |
| 357 | Ga0307407_10024342 | 3300031903 | Bacteria | 3173 |
| 358 | Ga0307407_10026227 | 3300031903 | Bacteria | 3082 |
| 359 | Ga0307407_10151590 | 3300031903 | Bacteria | 1507 |
| 360 | Ga0307407_10232069 | 3300031903 | Bacteria | 1254 |
| 361 | Ga0307412_10005158 | 3300031911 | Bacteria | 7319 |
| 362 | Ga0307412_10081110 | 3300031911 | Bacteria | 2243 |
| 363 | Ga0307412_10093944 | 3300031911 | Bacteria | 2105 |
| 364 | Ga0307412_10328172 | 3300031911 | Bacteria | 1220 |
| 365 | Ga0307409_100003158 | 3300031995 | Bacteria | 8857 |
| 366 | Ga0307409_100003924 | 3300031995 | Bacteria | 8233 |
| 367 | Ga0307409_100018892 | 3300031995 | Bacteria | 4650 |
| 368 | Ga0307409_100093825 | 3300031995 | Bacteria | 2467 |
| 369 | Ga0307409_100097594 | 3300031995 | Bacteria | 2427 |
| 370 | Ga0307409_100103712 | 3300031995 | Bacteria | 2366 |
| 371 | Ga0307409_100139338 | 3300031995 | Bacteria | 2087 |
| 372 | Ga0307409_100339340 | 3300031995 | Bacteria | 1413 |
| 373 | Ga0307416_100000687 | 3300032002 | Bacteria | 17613 |
| 374 | Ga0307416_100001992 | 3300032002 | Bacteria | 11456 |
| 375 | Ga0307416_100009781 | 3300032002 | Bacteria | 6300 |
| 376 | Ga0307416_100422656 | 3300032002 | Bacteria | 1377 |
| 377 | Ga0307416_100532060 | 3300032002 | Bacteria | 1245 |
| 378 | Ga0307414_10001230 | 3300032004 | Bacteria | 13197 |
| 379 | Ga0307414_10005150 | 3300032004 | Bacteria | 7170 |
| 380 | Ga0307414_10011793 | 3300032004 | Bacteria | 5143 |
| 381 | Ga0307414_10266033 | 3300032004 | Bacteria | 1433 |
| 382 | Ga0307414_10369661 | 3300032004 | Bacteria | 1236 |
| 383 | Ga0307414_10513938 | 3300032004 | Bacteria | 1062 |
| 384 | Ga0307411_10104095 | 3300032005 | Bacteria | 2015 |
| 385 | Ga0307415_100001567 | 3300032126 | Bacteria | 11014 |
| 386 | Ga0307415_100002406 | 3300032126 | Bacteria | 9330 |
| 387 | Ga0307415_100005752 | 3300032126 | Bacteria | 6613 |
| 388 | Ga0307415_100019187 | 3300032126 | Bacteria | 4146 |
| 389 | Ga0307415_100040597 | 3300032126 | Bacteria | 3084 |
| 390 | Ga0307415_100055788 | 3300032126 | Bacteria | 2705 |
| 391 | Ga0307415_100060812 | 3300032126 | Bacteria | 2612 |
| 392 | Ga0307415_100077660 | 3300032126 | Bacteria | 2358 |
| 393 | Ga0307415_100112081 | 3300032126 | Bacteria | 2026 |
| 394 | Ga0307415_100269770 | 3300032126 | Bacteria | 1393 |
| 395 | Ga0307510_10206310 | 3300033180 | Bacteria | 1493 |
| 396 | Ga0373951_0000031 | 3300035091 | Bacteria | 55817 |
| 397 | Ga0373951_0000049 | 3300035091 | Bacteria | 47611 |
| 398 | Ga0373947_0209264 | 3300035725 | Bacteria | 1279 |
| 399 | Ga0373937_0215536 | 3300036401 | Bacteria | 1807 |
| 400 | Ga0373925_0000041 | 3300037068 | Bacteria | 137281 |
| 401 | Ga0395899_0057477 | 3300037312 | Bacteria | 2872 |
| 402 | Ga0395900_0005888 | 3300037418 | Bacteria | 12803 |
| 403 | Ga0395900_0017136 | 3300037418 | Bacteria | 7395 |
| 404 | Ga0395900_0303734 | 3300037418 | Bacteria | 1581 |
| 405 | Ga0395898_0000481 | 3300037466 | Bacteria | 79375 |
| 406 | Ga0395898_0020662 | 3300037466 | Bacteria | 6685 |
| 407 | Ga0395898_0133973 | 3300037466 | Bacteria | 2372 |
| 408 | Ga0395898_0271446 | 3300037466 | Bacteria | 1618 |
| 409 | Ga0395898_0518419 | 3300037466 | Bacteria | 1133 |
| 410 | Ga0395905_0067547 | 3300037471 | Bacteria | 3349 |
| 411 | Ga0395905_0103983 | 3300037471 | Bacteria | 2666 |
| 412 | Ga0436364_0553737 | 3300037853 | Bacteria | 30167 |
| 413 | Ga0436364_1441645 | 3300037853 | Bacteria | 3651 |
| 414 | Ga0395901_0019372 | 3300038443 | Bacteria | 6957 |
| 415 | Ga0395901_0022357 | 3300038443 | Bacteria | 6480 |
| 416 | Ga0395901_0077168 | 3300038443 | Bacteria | 3477 |
| 417 | Ga0395901_0098727 | 3300038443 | Bacteria | 3062 |
| 418 | Ga0395901_0327872 | 3300038443 | Bacteria | 1583 |
| 419 | Ga0395901_0435419 | 3300038443 | Bacteria | 1343 |
| 420 | Ga0436362_0515864 | 3300039453 | Bacteria | 1985 |
| 421 | Ga0436362_1052748 | 3300039453 | Bacteria | 1171 |
| 422 | Ga0451787_028479 | 3300041441 | Bacteria | 1411 |
| 423 | Ga0451789_0062521 | 3300041443 | Bacteria | 2317 |
| 424 | Ga0451789_0531975 | 3300041443 | Bacteria | 3075 |
| 425 | Ga0451791_1784313 | 3300041451 | Bacteria | 8012 |
| 426 | Ga0451793_0091432 | 3300041452 | Bacteria | 15713 |
| 427 | Ga0451795_1242366 | 3300041456 | Bacteria | 3241 |
| 428 | Ga0451800_0883887 | 3300041459 | Bacteria | 1411 |
| 429 | Ga0451802_0281666 | 3300041460 | Bacteria | 3385 |
| 430 | Ga0451841_0340205 | 3300041498 | Bacteria | 1368 |
| 431 | Ga0451853_0826964 | 3300041512 | Bacteria | 12719 |
| 432 | Ga0439448_0007026 | 3300042005 | Bacteria | 3251 |
| 433 | Ga0439450_044169 | 3300042008 | Bacteria | 1043 |
| 434 | Ga0439455_0061535 | 3300042012 | Bacteria | 996 |
| 435 | Ga0439457_022707 | 3300042014 | Bacteria | 1389 |
| 436 | Ga0439463_009684 | 3300042016 | Bacteria | 2369 |
| 437 | Ga0439464_0013545 | 3300042439 | Bacteria | 2185 |
| 438 | Ga0466969_0004700 | 3300044656 | Bacteria | 7274 |
| 439 | Ga0466972_0155140 | 3300044658 | Bacteria | 1076 |
| 440 | Ga0466965_0065953 | 3300044683 | Bacteria | 1814 |
| 441 | Ga0466966_0007054 | 3300044684 | Bacteria | 7443 |
| 442 | Ga0466961_0047081 | 3300044693 | Bacteria | 2758 |
| 443 | Ga0466961_0082203 | 3300044693 | Bacteria | 2038 |
| 444 | Ga0466963_0034080 | 3300044694 | Bacteria | 3312 |
| 445 | Ga0466963_0039612 | 3300044694 | Bacteria | 3087 |
| 446 | Ga0466963_0058918 | 3300044694 | Bacteria | 2562 |
| 447 | Ga0466963_0102314 | 3300044694 | Bacteria | 1962 |
| 448 | Ga0466963_0191427 | 3300044694 | Bacteria | 1429 |
| 449 | Ga0466971_0036722 | 3300044719 | Bacteria | 2197 |
| 450 | Ga0466970_0083405 | 3300044765 | Bacteria | 1729 |
| 451 | Ga0466957_0168848 | 3300044842 | Bacteria | 1424 |
| 452 | Ga0466957_0269968 | 3300044842 | Bacteria | 1136 |
| 453 | Ga0466957_0273791 | 3300044842 | Bacteria | 1128 |
| 454 | Ga0466960_0010294 | 3300044901 | Bacteria | 3881 |
| 455 | Ga0466960_0028942 | 3300044901 | Bacteria | 2539 |
| 456 | Ga0466960_0045165 | 3300044901 | Bacteria | 2103 |
| 457 | Ga0466959_0091803 | 3300045049 | Bacteria | 2180 |
| 458 | Ga0466958_0069820 | 3300045836 | Bacteria | 2149 |
| 459 | Ga0466967_0005997 | 3300045976 | Bacteria | 8534 |
| 460 | Ga0466967_0062754 | 3300045976 | Bacteria | 3299 |
| 461 | Ga0466967_0095501 | 3300045976 | Bacteria | 2710 |
| 462 | Ga0466967_0149766 | 3300045976 | Bacteria | 2180 |
| 463 | Ga0466967_0208951 | 3300045976 | Bacteria | 1851 |
| 464 | Ga0466967_0244389 | 3300045976 | Bacteria | 1713 |
| 465 | Ga0466967_0278579 | 3300045976 | Bacteria | 1604 |
| 466 | Ga0466967_0279188 | 3300045976 | Bacteria | 1602 |
| 467 | Ga0466967_0293659 | 3300045976 | Bacteria | 1562 |
| 468 | Ga0466967_0368728 | 3300045976 | Bacteria | 1392 |
| 469 | Ga0466967_0558288 | 3300045976 | Bacteria | 1127 |
| 470 | Ga0466967_0650416 | 3300045976 | Bacteria | 1042 |
| 471 | Ga0495617_012949 | 3300046452 | Bacteria | 2842 |
| 472 | Ga0495592_0011720 | 3300046454 | Bacteria | 6639 |
| 473 | Ga0495603_0016363 | 3300046455 | Bacteria | 4486 |
| 474 | Ga0495603_0041322 | 3300046455 | Bacteria | 2758 |
| 475 | Ga0495603_0066074 | 3300046455 | Bacteria | 2130 |
| 476 | Ga0495590_0045855 | 3300046457 | Bacteria | 1525 |
| 477 | Ga0495629_0007601 | 3300046459 | Bacteria | 7984 |
| 478 | Ga0495629_0010003 | 3300046459 | Bacteria | 6921 |
| 479 | Ga0495629_0019118 | 3300046459 | Bacteria | 4898 |
| 480 | Ga0495629_0074170 | 3300046459 | Bacteria | 2376 |
| 481 | Ga0495629_0103496 | 3300046459 | Bacteria | 1986 |
| 482 | Ga0495629_0213070 | 3300046459 | Bacteria | 1334 |
| 483 | Ga0495641_0119509 | 3300046461 | Bacteria | 1176 |
| 484 | Ga0495651_0078500 | 3300046462 | Bacteria | 2497 |
| 485 | Ga0495651_0218541 | 3300046462 | Bacteria | 1321 |
| 486 | Ga0495662_0000568 | 3300046476 | Bacteria | 16984 |
| 487 | Ga0495662_0001073 | 3300046476 | Bacteria | 13436 |
| 488 | Ga0495594_0035998 | 3300046499 | Bacteria | 2698 |
| 489 | Ga0495594_0058825 | 3300046499 | Bacteria | 2124 |
| 490 | Ga0495594_0071917 | 3300046499 | Bacteria | 1924 |
| 491 | Ga0495594_0152077 | 3300046499 | Bacteria | 1314 |
| 492 | Ga0495610_0034663 | 3300046512 | Bacteria | 2598 |
| 493 | Ga0495618_0121259 | 3300046514 | Bacteria | 1675 |
| 494 | Ga0495628_0063601 | 3300046516 | Bacteria | 2891 |
| 495 | Ga0495628_0345109 | 3300046516 | Bacteria | 1095 |
| 496 | Ga0495630_0052990 | 3300046517 | Bacteria | 3037 |
| 497 | Ga0495632_0023301 | 3300046519 | Bacteria | 3308 |
| 498 | Ga0495652_0031272 | 3300046529 | Bacteria | 4662 |
| 499 | Ga0495652_0196865 | 3300046529 | Bacteria | 1533 |
| 500 | Ga0495665_0172492 | 3300046531 | Bacteria | 1126 |
| 501 | Ga0495640_0017011 | 3300046533 | Bacteria | 5427 |
| 502 | Ga0495640_0032572 | 3300046533 | Bacteria | 3712 |
| 503 | Ga0495640_0172068 | 3300046533 | Bacteria | 1383 |
| 504 | Ga0495609_0087478 | 3300046538 | Bacteria | 1357 |
| 505 | Ga0495597_0059807 | 3300046542 | Bacteria | 1663 |
| 506 | Ga0495622_0068081 | 3300046557 | Bacteria | 1644 |
| 507 | Ga0495667_0057926 | 3300046559 | Bacteria | 2546 |
| 508 | Ga0495634_0047173 | 3300046642 | Bacteria | 2904 |
| 509 | Ga0495657_0000588 | 3300046675 | Bacteria | 33293 |
| 510 | Ga0495657_0022323 | 3300046675 | Bacteria | 4535 |
| 511 | Ga0495613_0001976 | 3300046689 | Bacteria | 15561 |
| 512 | Ga0495613_0010586 | 3300046689 | Bacteria | 6840 |
| 513 | Ga0495613_0079441 | 3300046689 | Bacteria | 2385 |
| 514 | Ga0495613_0083380 | 3300046689 | Bacteria | 2321 |
| 515 | Ga0495613_0167846 | 3300046689 | Bacteria | 1559 |
| 516 | Ga0495624_0013797 | 3300046690 | Bacteria | 5502 |
| 517 | Ga0495624_0074558 | 3300046690 | Bacteria | 2108 |
| 518 | Ga0495624_0109116 | 3300046690 | Bacteria | 1702 |
| 519 | Ga0495624_0137680 | 3300046690 | Bacteria | 1496 |
| 520 | Ga0495649_0031689 | 3300046694 | Bacteria | 2914 |
| 521 | Ga0495660_0060276 | 3300046810 | Bacteria | 2039 |
| 522 | Ga0495581_0071385 | 3300047315 | Bacteria | 2009 |
| 523 | Ga0495581_0092819 | 3300047315 | Bacteria | 1752 |
| 524 | Ga0495604_0012907 | 3300047317 | Bacteria | 6655 |
| 525 | Ga0495604_0053457 | 3300047317 | Bacteria | 3121 |
| 526 | Ga0495636_0006927 | 3300047318 | Bacteria | 4457 |
| 527 | Ga0495674_0006056 | 3300047319 | Bacteria | 11606 |
| 528 | Ga0495674_0193631 | 3300047319 | Bacteria | 1689 |
| 529 | Ga0495674_0292154 | 3300047319 | Bacteria | 1333 |
| 530 | Ga0495674_0440769 | 3300047319 | Bacteria | 1048 |
| 531 | Ga0495676_0001890 | 3300047321 | Bacteria | 18373 |
| 532 | Ga0495676_0023565 | 3300047321 | Bacteria | 5340 |
| 533 | Ga0495676_0051363 | 3300047321 | Bacteria | 3299 |
| 534 | Ga0495676_0052583 | 3300047321 | Bacteria | 3250 |
| 535 | Ga0495676_0180782 | 3300047321 | Bacteria | 1478 |
| 536 | Ga0495676_0364564 | 3300047321 | Bacteria | 964 |
| 537 | Ga0495680_0160065 | 3300047322 | Unclassified | 1635 |
| 538 | Ga0495687_001586 | 3300047443 | Bacteria | 20547 |
| 539 | Ga0495687_005483 | 3300047443 | Bacteria | 8065 |
| 540 | Ga0495687_020854 | 3300047443 | Bacteria | 3186 |
| 541 | Ga0495687_077493 | 3300047443 | Bacteria | 1312 |
| 542 | Ga0495687_104949 | 3300047443 | Bacteria | 1051 |
| 543 | Ga0495675_0010945 | 3300047444 | Bacteria | 5684 |
| 544 | Ga0495685_010796 | 3300047447 | Bacteria | 3069 |
| 545 | Ga0495593_0002108 | 3300047673 | Bacteria | 11883 |
| 546 | Ga0495593_0044644 | 3300047673 | Bacteria | 2369 |
| 547 | Ga0495593_0191395 | 3300047673 | Bacteria | 1029 |
| 548 | Ga0495602_0121051 | 3300048088 | Bacteria | 2106 |
| 549 | Ga0495614_0008434 | 3300048089 | Bacteria | 4582 |
| 550 | Ga0495614_0021167 | 3300048089 | Bacteria | 2810 |
| 551 | Ga0495614_0027613 | 3300048089 | Bacteria | 2447 |
| 552 | Ga0496100_0006953 | 3300048903 | Bacteria | 6202 |
| 553 | Ga0496101_0039771 | 3300048904 | Bacteria | 3346 |
| 554 | Ga0496101_0528235 | 3300048904 | Bacteria | 933 |
| 555 | Ga0496102_0002512 | 3300048905 | Bacteria | 15653 |
| 556 | Ga0496104_0000004 | 3300048907 | Bacteria | 641830 |
| 557 | Ga0496104_0000441 | 3300048907 | Bacteria | 36043 |
| 558 | Ga0496104_0009109 | 3300048907 | Bacteria | 8827 |
| 559 | Ga0496104_0071151 | 3300048907 | Bacteria | 3307 |
| 560 | Ga0496104_0303730 | 3300048907 | Bacteria | 1508 |
| 561 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 562 | Ga0496105_0003381 | 3300048908 | Bacteria | 11797 |
| 563 | Ga0496105_0005310 | 3300048908 | Bacteria | 9766 |
| 564 | Ga0496105_0100261 | 3300048908 | Bacteria | 2392 |
| 565 | Ga0496105_0466508 | 3300048908 | Unclassified | 995 |
| 566 | Ga0496106_0037840 | 3300048909 | Bacteria | 3610 |
| 567 | Ga0496107_0478287 | 3300048910 | Bacteria | 924 |
| 568 | Ga0496108_0000748 | 3300048911 | Bacteria | 25330 |
| 569 | Ga0496108_0384146 | 3300048911 | Bacteria | 1226 |
| 570 | Ga0496109_0001743 | 3300048912 | Bacteria | 18151 |
| 571 | Ga0496109_0119726 | 3300048912 | Bacteria | 2452 |
| 572 | Ga0496109_0175198 | 3300048912 | Bacteria | 2013 |
| 573 | Ga0496109_0180246 | 3300048912 | Bacteria | 1984 |
| 574 | Ga0496109_0239644 | 3300048912 | Bacteria | 1707 |
| 575 | Ga0496110_0003033 | 3300048913 | Bacteria | 12739 |
| 576 | Ga0496111_0001177 | 3300048914 | Bacteria | 14549 |
| 577 | Ga0496111_0013312 | 3300048914 | Bacteria | 5594 |
| 578 | Ga0496112_0020363 | 3300048915 | Bacteria | 6287 |
| 579 | Ga0496112_0025278 | 3300048915 | Bacteria | 5701 |
| 580 | Ga0496112_0029713 | 3300048915 | Bacteria | 5288 |
| 581 | Ga0496112_0059212 | 3300048915 | Bacteria | 3773 |
| 582 | Ga0496112_0076561 | 3300048915 | Bacteria | 3309 |
| 583 | Ga0496112_0078829 | 3300048915 | Bacteria | 3257 |
| 584 | Ga0496112_0323332 | 3300048915 | Bacteria | 1487 |
| 585 | Ga0496113_0039585 | 3300048916 | Bacteria | 3470 |
| 586 | Ga0496113_0055968 | 3300048916 | Bacteria | 2959 |
| 587 | Ga0496113_0106014 | 3300048916 | Bacteria | 2183 |
| 588 | Ga0496113_0188040 | 3300048916 | Bacteria | 1639 |
| 589 | Ga0496114_0101621 | 3300048917 | Bacteria | 2455 |
| 590 | Ga0496114_0147469 | 3300048917 | Bacteria | 2040 |
| 591 | Ga0496114_0232122 | 3300048917 | Bacteria | 1621 |
| 592 | Ga0496114_0322141 | 3300048917 | Bacteria | 1366 |
| 593 | Ga0496115_0098511 | 3300048918 | Bacteria | 2394 |
| 594 | Ga0496115_0172439 | 3300048918 | Bacteria | 1789 |
| 595 | Ga0496115_0210563 | 3300048918 | Bacteria | 1606 |
| 596 | Ga0496115_0287239 | 3300048918 | Bacteria | 1350 |
| 597 | Ga0496119_0006668 | 3300048922 | Bacteria | 10617 |
| 598 | Ga0496121_0005940 | 3300048924 | Bacteria | 15443 |
| 599 | Ga0496126_0031840 | 3300048929 | Bacteria | 4976 |
| 600 | Ga0496126_0200014 | 3300048929 | Bacteria | 1688 |
| 601 | Ga0501031_0003764 | 3300049568 | Bacteria | 9755 |
| 602 | Ga0501032_0004275 | 3300049569 | Bacteria | 10782 |
| 603 | Ga0501033_0016260 | 3300049570 | Bacteria | 5635 |
| 604 | Ga0501034_0032491 | 3300049571 | Bacteria | 5298 |
| 605 | Ga0501034_0291088 | 3300049571 | Bacteria | 1571 |
| 606 | Ga0501036_0004014 | 3300049572 | Bacteria | 11838 |
| 607 | Ga0501036_0178811 | 3300049572 | Bacteria | 1786 |
| 608 | Ga0501037_0000877 | 3300049573 | Bacteria | 22482 |
| 609 | Ga0501038_0006616 | 3300049574 | Bacteria | 10718 |
| 610 | Ga0501039_0046069 | 3300049575 | Bacteria | 3369 |
| 611 | Ga0501039_0084294 | 3300049575 | Bacteria | 2475 |
| 612 | Ga0501039_0205060 | 3300049575 | Bacteria | 1550 |
| 613 | Ga0501039_0279409 | 3300049575 | Bacteria | 1312 |
| 614 | Ga0501040_0010811 | 3300049576 | Bacteria | 5965 |
| 615 | Ga0501040_0031064 | 3300049576 | Bacteria | 3609 |
| 616 | Ga0501041_0095430 | 3300049577 | Bacteria | 1838 |
| 617 | Ga0501041_0181299 | 3300049577 | Bacteria | 1318 |
| 618 | Ga0501043_0001649 | 3300049579 | Bacteria | 19380 |
| 619 | Ga0501043_0226003 | 3300049579 | Bacteria | 1447 |
| 620 | Ga0501046_0003745 | 3300049580 | Bacteria | 13920 |
| 621 | Ga0501046_0030742 | 3300049580 | Bacteria | 4357 |
| 622 | Ga0501047_0004742 | 3300049581 | Bacteria | 12787 |
| 623 | Ga0501047_0017565 | 3300049581 | Bacteria | 6855 |
| 624 | Ga0501047_0026531 | 3300049581 | Bacteria | 5575 |
| 625 | Ga0501047_0030159 | 3300049581 | Bacteria | 5229 |
| 626 | Ga0501047_0055403 | 3300049581 | Bacteria | 3835 |
| 627 | Ga0501047_0062892 | 3300049581 | Bacteria | 3580 |
| 628 | Ga0501047_0099811 | 3300049581 | Bacteria | 2782 |
| 629 | Ga0501048_0002977 | 3300049582 | Bacteria | 12929 |
| 630 | Ga0501048_0253126 | 3300049582 | Bacteria | 1251 |
| 631 | Ga0501067_0001377 | 3300049583 | Bacteria | 13174 |
| 632 | Ga0501067_0005852 | 3300049583 | Bacteria | 6818 |
| 633 | Ga0501068_0204239 | 3300049584 | Bacteria | 1253 |
| 634 | Ga0501069_0116644 | 3300049585 | Bacteria | 1523 |
| 635 | Ga0501070_0004792 | 3300049586 | Bacteria | 11571 |
| 636 | Ga0501070_0023946 | 3300049586 | Bacteria | 5117 |
| 637 | Ga0501070_0041857 | 3300049586 | Bacteria | 3815 |
| 638 | Ga0501070_0060774 | 3300049586 | Bacteria | 3132 |
| 639 | Ga0501071_0005296 | 3300049587 | Bacteria | 8273 |
| 640 | Ga0501071_0031462 | 3300049587 | Bacteria | 3762 |
| 641 | Ga0501071_0260904 | 3300049587 | Bacteria | 1309 |
| 642 | Ga0501072_0008248 | 3300049588 | Bacteria | 7913 |
| 643 | Ga0501072_0015071 | 3300049588 | Bacteria | 5929 |
| 644 | Ga0501072_0154762 | 3300049588 | Bacteria | 1828 |
| 645 | Ga0501072_0281554 | 3300049588 | Bacteria | 1323 |
| 646 | Ga0501073_0130822 | 3300049589 | Bacteria | 1739 |
| 647 | Ga0501073_0144561 | 3300049589 | Bacteria | 1648 |
| 648 | Ga0501074_0004185 | 3300049590 | Bacteria | 10311 |
| 649 | Ga0501074_0015924 | 3300049590 | Bacteria | 5468 |
| 650 | Ga0501074_0016792 | 3300049590 | Bacteria | 5311 |
| 651 | Ga0501074_0056073 | 3300049590 | Bacteria | 2839 |
| 652 | Ga0501075_0067090 | 3300049591 | Bacteria | 2709 |
| 653 | Ga0501075_0181821 | 3300049591 | Bacteria | 1604 |
| 654 | Ga0501076_0011933 | 3300049592 | Bacteria | 6489 |
| 655 | Ga0501076_0148716 | 3300049592 | Bacteria | 1905 |
| 656 | Ga0501076_0203831 | 3300049592 | Bacteria | 1616 |
| 657 | Ga0501076_0335443 | 3300049592 | Bacteria | 1241 |
| 658 | Ga0501076_0418397 | 3300049592 | Bacteria | 1102 |
| 659 | Ga0501077_0005792 | 3300049593 | Bacteria | 7529 |
| 660 | Ga0501077_0015350 | 3300049593 | Bacteria | 4822 |
| 661 | Ga0501079_0011050 | 3300049741 | Bacteria | 6884 |
| 662 | Ga0501079_0023680 | 3300049741 | Bacteria | 4711 |
| 663 | Ga0501079_0059357 | 3300049741 | Bacteria | 2951 |
| 664 | Ga0501079_0236770 | 3300049741 | Bacteria | 1426 |
| 665 | Ga0501080_0000857 | 3300049742 | Bacteria | 24883 |
| 666 | Ga0501080_0007636 | 3300049742 | Bacteria | 9779 |
| 667 | Ga0501083_0010270 | 3300049744 | Bacteria | 6597 |
| 668 | Ga0501083_0089782 | 3300049744 | Bacteria | 2030 |
| 669 | Ga0501083_0097650 | 3300049744 | Bacteria | 1938 |
| 670 | Ga0501083_0220825 | 3300049744 | Bacteria | 1235 |
| 671 | Ga0501083_0221694 | 3300049744 | Bacteria | 1232 |
| 672 | Ga0501035_0002421 | 3300049822 | Bacteria | 18251 |
| 673 | Ga0501044_0001494 | 3300049823 | Bacteria | 27388 |
| 674 | Ga0501044_0004920 | 3300049823 | Bacteria | 14935 |
| 675 | Ga0501044_0027151 | 3300049823 | Bacteria | 6055 |
| 676 | Ga0501044_0199338 | 3300049823 | Bacteria | 1961 |
| 677 | Ga0501045_0025753 | 3300049824 | Bacteria | 4229 |
| 678 | Ga0501045_0050324 | 3300049824 | Bacteria | 3040 |
| 679 | Ga0501045_0217544 | 3300049824 | Bacteria | 1423 |
| 680 | nmdc:mga05p37_109_c1 | 3300050507 | Bacteria | 74571 |
| 681 | nmdc:mga05p37_22243_c1 | 3300050507 | Bacteria | 7687 |
| 682 | nmdc:mga05p37_284166_c1 | 3300050507 | Bacteria | 1972 |
| 683 | nmdc:mga05p37_3308_c1 | 3300050507 | Bacteria | 18807 |
| 684 | nmdc:mga05p37_404903_c1 | 3300050507 | Bacteria | 1592 |
| 685 | nmdc:mga09592_19572_c1 | 3300050508 | Bacteria | 5559 |
| 686 | nmdc:mga09592_198255_c1 | 3300050508 | Bacteria | 1738 |
| 687 | nmdc:mga09592_31_c1 | 3300050508 | Bacteria | 79922 |
| 688 | nmdc:mga09592_32514_c1 | 3300050508 | Bacteria | 4349 |
| 689 | nmdc:mga09592_56963_c1 | 3300050508 | Bacteria | 3303 |
| 690 | nmdc:mga09592_74448_c1 | 3300050508 | Bacteria | 2885 |
| 691 | nmdc:mga09592_754_c1 | 3300050508 | Bacteria | 24849 |
| 692 | nmdc:mga09592_86710_c1 | 3300050508 | Bacteria | 2672 |
| 693 | nmdc:mga0qj67_43_c1 | 3300050509 | Bacteria | 88150 |
| 694 | nmdc:mga0qj67_49457_c1 | 3300050509 | Bacteria | 3323 |
| 695 | nmdc:mga0qj67_52075_c1 | 3300050509 | Bacteria | 3239 |
| 696 | nmdc:mga0qj67_8184_c1 | 3300050509 | Bacteria | 7750 |
| 697 | nmdc:mga06r32_22005_c1 | 3300050510 | Bacteria | 5889 |
| 698 | nmdc:mga06r32_3193_c1 | 3300050510 | Bacteria | 14680 |
| 699 | nmdc:mga06r32_356103_c1 | 3300050510 | Bacteria | 1448 |
| 700 | nmdc:mga06r32_430968_c1 | 3300050510 | Bacteria | 1299 |
| 701 | nmdc:mga06r32_57_c2 | 3300050510 | Bacteria | 51506 |
| 702 | nmdc:mga06r32_58976_c1 | 3300050510 | Bacteria | 3690 |
| 703 | nmdc:mga06r32_8007_c1 | 3300050510 | Bacteria | 9502 |
| 704 | nmdc:mga08y16_210584_c1 | 3300050511 | Bacteria | 2013 |
| 705 | nmdc:mga08y16_394399_c1 | 3300050511 | Bacteria | 1417 |
| 706 | nmdc:mga08y16_40272_c1 | 3300050511 | Bacteria | 4898 |
| 707 | nmdc:mga0n895_324722_c1 | 3300050512 | Bacteria | 1559 |
| 708 | nmdc:mga0a205_8359_c1 | 3300050515 | Bacteria | 7953 |
| 709 | Ga0495601_0042765 | 3300053077 | Bacteria | 2844 |
| 710 | Ga0495619_0087798 | 3300053085 | Bacteria | 2103 |
| 711 | Ga0495619_0361105 | 3300053085 | Bacteria | 1004 |
| 712 | Ga0500641_0053055 | 3300053096 | Bacteria | 1673 |
| 713 | Ga0501084_0076125 | 3300054114 | Bacteria | 2812 |
| 714 | Ga0501084_0110505 | 3300054114 | Bacteria | 2309 |
| 715 | Ga0501082_0034173 | 3300060353 | Bacteria | 4386 |
| 716 | Ga0501082_0200449 | 3300060353 | Bacteria | 1736 |
| 717 | Ga0501082_0508298 | 3300060353 | Bacteria | 1053 |
| 718 | Ga0530510_0110129 | 3300061734 | Bacteria | 2017 |
| 719 | Ga0530510_0381888 | 3300061734 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048908 | Ga0496105_0466508 | Ga0496105_0466508_170_970 | 245 |
| 2 | 3300047319 | Ga0495674_0440769 | Ga0495674_0440769_12_758 | 248 |
| 3 | 3300047322 | Ga0495680_0160065 | Ga0495680_0160065_271_1074 | 253 |
| 4 | 3300031548 | Ga0307408_100027020 | Ga0307408_1000270202 | 255 |
| 5 | 3300031903 | Ga0307407_10026227 | Ga0307407_100262274 | 255 |
| 6 | 3300032004 | Ga0307414_10369661 | Ga0307414_103696611 | 255 |
| 7 | 3300039453 | Ga0436362_1052748 | Ga0436362_1052748_60_851 | 255 |
| 8 | 3300046457 | Ga0495590_0045855 | Ga0495590_0045855_732_1499 | 255 |
| 9 | 3300048910 | Ga0496107_0478287 | Ga0496107_0478287_28_798 | 255 |
| 10 | 3300049575 | Ga0501039_0205060 | Ga0501039_0205060_712_1539 | 257 |
| 11 | 3300047321 | Ga0495676_0364564 | Ga0495676_0364564_28_828 | 258 |
| 12 | 3300013307 | Ga0157372_10017497 | Ga0157372_100174976 | 260 |
| 13 | 3300005329 | Ga0070683_100206948 | Ga0070683_1002069481 | 265 |
| 14 | 3300009177 | Ga0105248_10167557 | Ga0105248_101675573 | 265 |
| 15 | 3300014325 | Ga0163163_10050496 | Ga0163163_100504962 | 265 |
| 16 | 3300025944 | Ga0207661_10353887 | Ga0207661_103538871 | 265 |
| 17 | 3300048915 | Ga0496112_0078829 | Ga0496112_0078829_1360_2280 | 265 |
| 18 | 3300048916 | Ga0496113_0039585 | Ga0496113_0039585_1540_2460 | 265 |
| 19 | 3300044901 | Ga0466960_0028942 | Ga0466960_0028942_1629_2441 | 267 |
| 20 | 3300045976 | Ga0466967_0293659 | Ga0466967_0293659_736_1542 | 268 |
| 21 | 3300009094 | Ga0111539_10413138 | Ga0111539_104131383 | 270 |
| 22 | 3300005985 | Ga0081539_10003621 | Ga0081539_100036216 | 272 |
| 23 | 3300048904 | Ga0496101_0528235 | Ga0496101_0528235_17_862 | 273 |
| 24 | 3300039453 | Ga0436362_0515864 | Ga0436362_0515864_719_1567 | 274 |
| 25 | 3300041498 | Ga0451841_0340205 | Ga0451841_0340205_464_1333 | 282 |
| 26 | 3300046459 | Ga0495629_0074170 | Ga0495629_0074170_165_1217 | 283 |
| 27 | 3300041441 | Ga0451787_028479 | Ga0451787_028479_505_1362 | 285 |
| 28 | 3300041443 | Ga0451789_0062521 | Ga0451789_0062521_1422_2279 | 285 |
| 29 | 3300003316 | rootH1_10008338 | rootH1_100083382 | 286 |
| 30 | 3300005455 | Ga0070663_100350266 | Ga0070663_1003502661 | 288 |
| 31 | 3300009176 | Ga0105242_10291961 | Ga0105242_102919612 | 288 |
| 32 | 3300046531 | Ga0495665_0172492 | Ga0495665_0172492_29_895 | 288 |
| 33 | 3300046542 | Ga0495597_0059807 | Ga0495597_0059807_34_900 | 288 |
| 34 | 3300042016 | Ga0439463_009684 | Ga0439463_009684_27_896 | 289 |
| 35 | 3300046462 | Ga0495651_0218541 | Ga0495651_0218541_162_1079 | 289 |
| 36 | 3300050509 | nmdc:mga0qj67_49457_c1 | nmdc:mga0qj67_49457_c1_369_1280 | 289 |
| 37 | 3300005985 | Ga0081539_10003229 | Ga0081539_1000322918 | 290 |
| 38 | 3300009094 | Ga0111539_10225926 | Ga0111539_102259262 | 290 |
| 39 | 3300037466 | Ga0395898_0271446 | Ga0395898_0271446_593_1492 | 291 |
| 40 | 3300046461 | Ga0495641_0119509 | Ga0495641_0119509_171_1085 | 291 |
| 41 | 3300047673 | Ga0495593_0191395 | Ga0495593_0191395_56_970 | 291 |
| 42 | 3300005456 | Ga0070678_100176928 | Ga0070678_1001769282 | 292 |
| 43 | 3300006028 | Ga0070717_10064090 | Ga0070717_100640902 | 292 |
| 44 | 3300026121 | Ga0207683_10279658 | Ga0207683_102796582 | 292 |
| 45 | 3300038443 | Ga0395901_0327872 | Ga0395901_0327872_127_1065 | 292 |
| 46 | 3300005981 | Ga0081538_10001334 | Ga0081538_1000133426 | 293 |
| 47 | 3300031911 | Ga0307412_10093944 | Ga0307412_100939442 | 293 |
| 48 | 3300005471 | Ga0070698_100013437 | Ga0070698_10001343711 | 294 |
| 49 | 3300009098 | Ga0105245_10094256 | Ga0105245_100942562 | 294 |
| 50 | 3300049572 | Ga0501036_0178811 | Ga0501036_0178811_556_1488 | 294 |
| 51 | 3300049576 | Ga0501040_0031064 | Ga0501040_0031064_1165_2097 | 294 |
| 52 | 3300049577 | Ga0501041_0181299 | Ga0501041_0181299_320_1252 | 294 |
| 53 | 3300049579 | Ga0501043_0226003 | Ga0501043_0226003_64_996 | 294 |
| 54 | 3300049591 | Ga0501075_0067090 | Ga0501075_0067090_913_1845 | 294 |
| 55 | 3300049592 | Ga0501076_0011933 | Ga0501076_0011933_5489_6421 | 294 |
| 56 | 3300049741 | Ga0501079_0011050 | Ga0501079_0011050_242_1174 | 294 |
| 57 | 3300049742 | Ga0501080_0007636 | Ga0501080_0007636_2578_3510 | 294 |
| 58 | 3300049744 | Ga0501083_0097650 | Ga0501083_0097650_344_1276 | 294 |
| 59 | 3300054114 | Ga0501084_0076125 | Ga0501084_0076125_1597_2529 | 294 |
| 60 | 3300060353 | Ga0501082_0034173 | Ga0501082_0034173_72_1004 | 294 |
| 61 | 3300005467 | Ga0070706_100007256 | Ga0070706_1000072562 | 295 |
| 62 | 3300006028 | Ga0070717_10017924 | Ga0070717_100179243 | 295 |
| 63 | 3300006844 | Ga0075428_100009472 | Ga0075428_10000947214 | 295 |
| 64 | 3300006844 | Ga0075428_100203230 | Ga0075428_1002032304 | 295 |
| 65 | 3300006847 | Ga0075431_100037919 | Ga0075431_1000379194 | 295 |
| 66 | 3300006880 | Ga0075429_100000008 | Ga0075429_10000000878 | 295 |
| 67 | 3300009147 | Ga0114129_10001247 | Ga0114129_1000124732 | 295 |
| 68 | 3300010375 | Ga0105239_10017343 | Ga0105239_100173439 | 295 |
| 69 | 3300013100 | Ga0157373_10171813 | Ga0157373_101718131 | 295 |
| 70 | 3300013307 | Ga0157372_10799249 | Ga0157372_107992491 | 295 |
| 71 | 3300014745 | Ga0157377_10253718 | Ga0157377_102537181 | 295 |
| 72 | 3300025910 | Ga0207684_10004954 | Ga0207684_100049542 | 295 |
| 73 | 3300025915 | Ga0207693_10380138 | Ga0207693_103801381 | 295 |
| 74 | 3300025940 | Ga0207691_10142536 | Ga0207691_101425361 | 295 |
| 75 | 3300046459 | Ga0495629_0213070 | Ga0495629_0213070_316_1245 | 295 |
| 76 | 3300049577 | Ga0501041_0095430 | Ga0501041_0095430_585_1532 | 295 |
| 77 | 3300049741 | Ga0501079_0059357 | Ga0501079_0059357_525_1472 | 295 |
| 78 | 3300050507 | nmdc:mga05p37_109_c1 | nmdc:mga05p37_109_c1_57074_58018 | 295 |
| 79 | 3300050508 | nmdc:mga09592_754_c1 | nmdc:mga09592_754_c1_7353_8297 | 295 |
| 80 | 3300050510 | nmdc:mga06r32_8007_c1 | nmdc:mga06r32_8007_c1_1787_2731 | 295 |
| 81 | 3300053085 | Ga0495619_0087798 | Ga0495619_0087798_581_1510 | 295 |
| 82 | 3300005548 | Ga0070665_100056718 | Ga0070665_1000567187 | 296 |
| 83 | 3300009177 | Ga0105248_10130139 | Ga0105248_101301392 | 296 |
| 84 | 3300026095 | Ga0207676_10010726 | Ga0207676_100107265 | 296 |
| 85 | 3300045976 | Ga0466967_0062754 | Ga0466967_0062754_1844_2851 | 296 |
| 86 | 3300048915 | Ga0496112_0020363 | Ga0496112_0020363_3661_4605 | 296 |
| 87 | 3300048915 | Ga0496112_0025278 | Ga0496112_0025278_4256_5200 | 296 |
| 88 | 3300048917 | Ga0496114_0101621 | Ga0496114_0101621_364_1320 | 296 |
| 89 | 3300049587 | Ga0501071_0260904 | Ga0501071_0260904_19_984 | 296 |
| 90 | 3300049592 | Ga0501076_0203831 | Ga0501076_0203831_315_1280 | 296 |
| 91 | 3300049824 | Ga0501045_0217544 | Ga0501045_0217544_19_963 | 296 |
| 92 | 3300003373 | JGI25407J50210_10008113 | JGI25407J50210_100081131 | 297 |
| 93 | 3300003373 | JGI25407J50210_10009581 | JGI25407J50210_100095813 | 297 |
| 94 | 3300005337 | Ga0070682_100086291 | Ga0070682_1000862912 | 297 |
| 95 | 3300005981 | Ga0081538_10000223 | Ga0081538_1000022323 | 297 |
| 96 | 3300005981 | Ga0081538_10000671 | Ga0081538_100006717 | 297 |
| 97 | 3300005981 | Ga0081538_10049706 | Ga0081538_100497062 | 297 |
| 98 | 3300031731 | Ga0307405_10086361 | Ga0307405_100863611 | 297 |
| 99 | 3300032126 | Ga0307415_100077660 | Ga0307415_1000776602 | 297 |
| 100 | 3300041443 | Ga0451789_0531975 | Ga0451789_0531975_1312_2226 | 297 |
| 101 | 3300041451 | Ga0451791_1784313 | Ga0451791_1784313_3817_4731 | 297 |
| 102 | 3300041452 | Ga0451793_0091432 | Ga0451793_0091432_1481_2395 | 297 |
| 103 | 3300041456 | Ga0451795_1242366 | Ga0451795_1242366_938_1852 | 297 |
| 104 | 3300041459 | Ga0451800_0883887 | Ga0451800_0883887_415_1329 | 297 |
| 105 | 3300048911 | Ga0496108_0384146 | Ga0496108_0384146_300_1214 | 297 |
| 106 | 3300005467 | Ga0070706_100033523 | Ga0070706_1000335235 | 299 |
| 107 | 3300005719 | Ga0068861_100154169 | Ga0068861_1001541692 | 299 |
| 108 | 3300028786 | Ga0307517_10175185 | Ga0307517_101751852 | 299 |
| 109 | 3300032005 | Ga0307411_10104095 | Ga0307411_101040952 | 299 |
| 110 | 3300006844 | Ga0075428_100202250 | Ga0075428_1002022503 | 300 |
| 111 | 3300009094 | Ga0111539_10150710 | Ga0111539_101507104 | 300 |
| 112 | 3300050507 | nmdc:mga05p37_404903_c1 | nmdc:mga05p37_404903_c1_525_1523 | 300 |
| 113 | iso_pu_bacteria | 2643221961 | 2645722251 | 300 |
| 114 | iso_pu_bacteria | 2643221962 | 2645725122 | 300 |
| 115 | iso_pu_bacteria | 2795385472 | 2795795565 | 300 |
| 116 | 3300026118 | Ga0207675_100311650 | Ga0207675_1003116502 | 301 |
| 117 | 3300005336 | Ga0070680_100230814 | Ga0070680_1002308141 | 302 |
| 118 | 3300005439 | Ga0070711_100232449 | Ga0070711_1002324492 | 302 |
| 119 | 3300005983 | Ga0081540_1010943 | Ga0081540_10109436 | 302 |
| 120 | 3300006175 | Ga0070712_100135997 | Ga0070712_1001359971 | 302 |
| 121 | 3300013307 | Ga0157372_10202844 | Ga0157372_102028443 | 302 |
| 122 | 3300025915 | Ga0207693_10142821 | Ga0207693_101428212 | 302 |
| 123 | 3300038443 | Ga0395901_0435419 | Ga0395901_0435419_142_1101 | 302 |
| 124 | 3300045976 | Ga0466967_0149766 | Ga0466967_0149766_1083_2015 | 302 |
| 125 | 3300046455 | Ga0495603_0041322 | Ga0495603_0041322_239_1171 | 302 |
| 126 | 3300048912 | Ga0496109_0175198 | Ga0496109_0175198_155_1087 | 302 |
| 127 | 3300048915 | Ga0496112_0076561 | Ga0496112_0076561_135_1067 | 302 |
| 128 | 3300048915 | Ga0496112_0323332 | Ga0496112_0323332_189_1121 | 302 |
| 129 | 3300048916 | Ga0496113_0106014 | Ga0496113_0106014_563_1495 | 302 |
| 130 | 3300048916 | Ga0496113_0188040 | Ga0496113_0188040_175_1107 | 302 |
| 131 | 3300003322 | rootL2_10241102 | rootL2_102411022 | 303 |
| 132 | 3300005435 | Ga0070714_100005972 | Ga0070714_10000597211 | 303 |
| 133 | 3300005435 | Ga0070714_100091827 | Ga0070714_1000918272 | 303 |
| 134 | 3300005436 | Ga0070713_100365114 | Ga0070713_1003651141 | 303 |
| 135 | 3300005445 | Ga0070708_100226358 | Ga0070708_1002263582 | 303 |
| 136 | 3300005467 | Ga0070706_100095491 | Ga0070706_1000954912 | 303 |
| 137 | 3300005467 | Ga0070706_100110998 | Ga0070706_1001109982 | 303 |
| 138 | 3300005468 | Ga0070707_100030035 | Ga0070707_1000300354 | 303 |
| 139 | 3300005471 | Ga0070698_100012039 | Ga0070698_1000120399 | 303 |
| 140 | 3300005471 | Ga0070698_100012398 | Ga0070698_1000123982 | 303 |
| 141 | 3300005518 | Ga0070699_100186402 | Ga0070699_1001864021 | 303 |
| 142 | 3300006028 | Ga0070717_10245051 | Ga0070717_102450512 | 303 |
| 143 | 3300025922 | Ga0207646_10123758 | Ga0207646_101237582 | 303 |
| 144 | 3300025928 | Ga0207700_10316264 | Ga0207700_103162642 | 303 |
| 145 | 3300025929 | Ga0207664_10002832 | Ga0207664_1000283210 | 303 |
| 146 | 3300037853 | Ga0436364_1441645 | Ga0436364_1441645_1879_2814 | 303 |
| 147 | 3300048918 | Ga0496115_0210563 | Ga0496115_0210563_539_1507 | 303 |
| 148 | 3300049585 | Ga0501069_0116644 | Ga0501069_0116644_288_1202 | 303 |
| 149 | 3300049586 | Ga0501070_0060774 | Ga0501070_0060774_637_1551 | 303 |
| 150 | 3300003203 | JGI25406J46586_10044253 | JGI25406J46586_100442532 | 304 |
| 151 | 3300005329 | Ga0070683_100045577 | Ga0070683_1000455773 | 304 |
| 152 | 3300005337 | Ga0070682_100092529 | Ga0070682_1000925292 | 304 |
| 153 | 3300005435 | Ga0070714_100055035 | Ga0070714_1000550354 | 304 |
| 154 | 3300005436 | Ga0070713_100075395 | Ga0070713_1000753953 | 304 |
| 155 | 3300005456 | Ga0070678_100158562 | Ga0070678_1001585622 | 304 |
| 156 | 3300005468 | Ga0070707_100070307 | Ga0070707_1000703071 | 304 |
| 157 | 3300005530 | Ga0070679_100091501 | Ga0070679_1000915013 | 304 |
| 158 | 3300005548 | Ga0070665_100120691 | Ga0070665_1001206912 | 304 |
| 159 | 3300005548 | Ga0070665_100122462 | Ga0070665_1001224623 | 304 |
| 160 | 3300005563 | Ga0068855_100172695 | Ga0068855_1001726953 | 304 |
| 161 | 3300005577 | Ga0068857_100316238 | Ga0068857_1003162382 | 304 |
| 162 | 3300005577 | Ga0068857_100388624 | Ga0068857_1003886242 | 304 |
| 163 | 3300005578 | Ga0068854_100014763 | Ga0068854_1000147637 | 304 |
| 164 | 3300005614 | Ga0068856_100027547 | Ga0068856_1000275472 | 304 |
| 165 | 3300005616 | Ga0068852_100012963 | Ga0068852_1000129636 | 304 |
| 166 | 3300005842 | Ga0068858_100000054 | Ga0068858_1000000542 | 304 |
| 167 | 3300005937 | Ga0081455_10003970 | Ga0081455_100039706 | 304 |
| 168 | 3300005937 | Ga0081455_10014692 | Ga0081455_100146923 | 304 |
| 169 | 3300005985 | Ga0081539_10001504 | Ga0081539_1000150431 | 304 |
| 170 | 3300005985 | Ga0081539_10002251 | Ga0081539_1000225120 | 304 |
| 171 | 3300006028 | Ga0070717_10125084 | Ga0070717_101250842 | 304 |
| 172 | 3300006844 | Ga0075428_100000663 | Ga0075428_10000066321 | 304 |
| 173 | 3300006844 | Ga0075428_100006856 | Ga0075428_1000068566 | 304 |
| 174 | 3300006844 | Ga0075428_100020214 | Ga0075428_1000202148 | 304 |
| 175 | 3300006844 | Ga0075428_100033909 | Ga0075428_1000339093 | 304 |
| 176 | 3300006844 | Ga0075428_100045071 | Ga0075428_1000450713 | 304 |
| 177 | 3300006844 | Ga0075428_100050378 | Ga0075428_1000503781 | 304 |
| 178 | 3300006846 | Ga0075430_100009975 | Ga0075430_1000099756 | 304 |
| 179 | 3300006847 | Ga0075431_100004704 | Ga0075431_1000047043 | 304 |
| 180 | 3300006847 | Ga0075431_100021090 | Ga0075431_1000210905 | 304 |
| 181 | 3300006847 | Ga0075431_100411300 | Ga0075431_1004113001 | 304 |
| 182 | 3300006880 | Ga0075429_100003483 | Ga0075429_1000034833 | 304 |
| 183 | 3300006880 | Ga0075429_100013263 | Ga0075429_1000132633 | 304 |
| 184 | 3300009098 | Ga0105245_10128301 | Ga0105245_101283012 | 304 |
| 185 | 3300009101 | Ga0105247_10059738 | Ga0105247_100597381 | 304 |
| 186 | 3300009147 | Ga0114129_10016283 | Ga0114129_100162836 | 304 |
| 187 | 3300009147 | Ga0114129_10147268 | Ga0114129_101472681 | 304 |
| 188 | 3300009174 | Ga0105241_10047293 | Ga0105241_100472935 | 304 |
| 189 | 3300009551 | Ga0105238_10047945 | Ga0105238_100479452 | 304 |
| 190 | 3300009553 | Ga0105249_10256250 | Ga0105249_102562502 | 304 |
| 191 | 3300011119 | Ga0105246_10194114 | Ga0105246_101941142 | 304 |
| 192 | 3300013105 | Ga0157369_10484930 | Ga0157369_104849301 | 304 |
| 193 | 3300013296 | Ga0157374_10051781 | Ga0157374_100517812 | 304 |
| 194 | 3300014968 | Ga0157379_10054667 | Ga0157379_100546672 | 304 |
| 195 | 3300021388 | Ga0213875_10001296 | Ga0213875_100012966 | 304 |
| 196 | 3300025900 | Ga0207710_10030240 | Ga0207710_100302402 | 304 |
| 197 | 3300025904 | Ga0207647_10013593 | Ga0207647_100135932 | 304 |
| 198 | 3300025904 | Ga0207647_10025083 | Ga0207647_100250835 | 304 |
| 199 | 3300025907 | Ga0207645_10165965 | Ga0207645_101659651 | 304 |
| 200 | 3300025911 | Ga0207654_10010796 | Ga0207654_100107962 | 304 |
| 201 | 3300025914 | Ga0207671_10001058 | Ga0207671_1000105823 | 304 |
| 202 | 3300025915 | Ga0207693_10199392 | Ga0207693_101993921 | 304 |
| 203 | 3300025921 | Ga0207652_10064266 | Ga0207652_100642662 | 304 |
| 204 | 3300025922 | Ga0207646_10062241 | Ga0207646_100622414 | 304 |
| 205 | 3300025924 | Ga0207694_10105587 | Ga0207694_101055871 | 304 |
| 206 | 3300025928 | Ga0207700_10078916 | Ga0207700_100789163 | 304 |
| 207 | 3300025929 | Ga0207664_10078846 | Ga0207664_100788462 | 304 |
| 208 | 3300026035 | Ga0207703_10000002 | Ga0207703_10000002571 | 304 |
| 209 | 3300026067 | Ga0207678_10062415 | Ga0207678_100624152 | 304 |
| 210 | 3300026078 | Ga0207702_10093931 | Ga0207702_100939312 | 304 |
| 211 | 3300026116 | Ga0207674_10270286 | Ga0207674_102702861 | 304 |
| 212 | 3300026116 | Ga0207674_10417324 | Ga0207674_104173242 | 304 |
| 213 | 3300028794 | Ga0307515_10116065 | Ga0307515_101160652 | 304 |
| 214 | 3300031548 | Ga0307408_100381087 | Ga0307408_1003810871 | 304 |
| 215 | 3300031731 | Ga0307405_10197733 | Ga0307405_101977331 | 304 |
| 216 | 3300031838 | Ga0307518_10277984 | Ga0307518_102779841 | 304 |
| 217 | 3300031852 | Ga0307410_10196868 | Ga0307410_101968681 | 304 |
| 218 | 3300031852 | Ga0307410_10344409 | Ga0307410_103444092 | 304 |
| 219 | 3300031889 | Ga0326468_10000094 | Ga0326468_100000943 | 304 |
| 220 | 3300031901 | Ga0307406_10470821 | Ga0307406_104708212 | 304 |
| 221 | 3300031903 | Ga0307407_10151590 | Ga0307407_101515902 | 304 |
| 222 | 3300031903 | Ga0307407_10232069 | Ga0307407_102320691 | 304 |
| 223 | 3300031995 | Ga0307409_100093825 | Ga0307409_1000938254 | 304 |
| 224 | 3300031995 | Ga0307409_100339340 | Ga0307409_1003393401 | 304 |
| 225 | 3300032002 | Ga0307416_100422656 | Ga0307416_1004226561 | 304 |
| 226 | 3300032004 | Ga0307414_10513938 | Ga0307414_105139381 | 304 |
| 227 | 3300032126 | Ga0307415_100040597 | Ga0307415_1000405972 | 304 |
| 228 | 3300032126 | Ga0307415_100112081 | Ga0307415_1001120811 | 304 |
| 229 | 3300032126 | Ga0307415_100269770 | Ga0307415_1002697702 | 304 |
| 230 | 3300037418 | Ga0395900_0303734 | Ga0395900_0303734_467_1384 | 304 |
| 231 | 3300037466 | Ga0395898_0133973 | Ga0395898_0133973_966_1883 | 304 |
| 232 | 3300037471 | Ga0395905_0067547 | Ga0395905_0067547_1459_2376 | 304 |
| 233 | 3300037853 | Ga0436364_0553737 | Ga0436364_0553737_13174_14094 | 304 |
| 234 | 3300038443 | Ga0395901_0077168 | Ga0395901_0077168_1899_2816 | 304 |
| 235 | 3300041460 | Ga0451802_0281666 | Ga0451802_0281666_1812_2726 | 304 |
| 236 | 3300042005 | Ga0439448_0007026 | Ga0439448_0007026_2135_3049 | 304 |
| 237 | 3300042012 | Ga0439455_0061535 | Ga0439455_0061535_36_950 | 304 |
| 238 | 3300042014 | Ga0439457_022707 | Ga0439457_022707_343_1257 | 304 |
| 239 | 3300042439 | Ga0439464_0013545 | Ga0439464_0013545_894_1808 | 304 |
| 240 | 3300045976 | Ga0466967_0278579 | Ga0466967_0278579_110_1030 | 304 |
| 241 | 3300046810 | Ga0495660_0060276 | Ga0495660_0060276_502_1425 | 304 |
| 242 | 3300048905 | Ga0496102_0002512 | Ga0496102_0002512_14305_15237 | 304 |
| 243 | 3300048907 | Ga0496104_0000441 | Ga0496104_0000441_24722_25654 | 304 |
| 244 | 3300048908 | Ga0496105_0003381 | Ga0496105_0003381_1343_2275 | 304 |
| 245 | 3300048908 | Ga0496105_0100261 | Ga0496105_0100261_825_1739 | 304 |
| 246 | 3300048909 | Ga0496106_0037840 | Ga0496106_0037840_1733_2650 | 304 |
| 247 | 3300048911 | Ga0496108_0000748 | Ga0496108_0000748_14452_15384 | 304 |
| 248 | 3300048912 | Ga0496109_0001743 | Ga0496109_0001743_6291_7223 | 304 |
| 249 | 3300048912 | Ga0496109_0119726 | Ga0496109_0119726_1351_2265 | 304 |
| 250 | 3300048913 | Ga0496110_0003033 | Ga0496110_0003033_4796_5728 | 304 |
| 251 | 3300048914 | Ga0496111_0001177 | Ga0496111_0001177_12851_13783 | 304 |
| 252 | 3300048917 | Ga0496114_0232122 | Ga0496114_0232122_171_1115 | 304 |
| 253 | 3300048917 | Ga0496114_0322141 | Ga0496114_0322141_202_1116 | 304 |
| 254 | 3300048924 | Ga0496121_0005940 | Ga0496121_0005940_7495_8412 | 304 |
| 255 | 3300049575 | Ga0501039_0084294 | Ga0501039_0084294_855_1778 | 304 |
| 256 | 3300049587 | Ga0501071_0031462 | Ga0501071_0031462_691_1614 | 304 |
| 257 | 3300049591 | Ga0501075_0181821 | Ga0501075_0181821_145_1068 | 304 |
| 258 | 3300049592 | Ga0501076_0148716 | Ga0501076_0148716_491_1414 | 304 |
| 259 | 3300050507 | nmdc:mga05p37_22243_c1 | nmdc:mga05p37_22243_c1_1404_2318 | 304 |
| 260 | 3300050508 | nmdc:mga09592_19572_c1 | nmdc:mga09592_19572_c1_4339_5295 | 304 |
| 261 | 3300050508 | nmdc:mga09592_56963_c1 | nmdc:mga09592_56963_c1_1969_2883 | 304 |
| 262 | 3300050508 | nmdc:mga09592_74448_c1 | nmdc:mga09592_74448_c1_740_1654 | 304 |
| 263 | 3300050509 | nmdc:mga0qj67_52075_c1 | nmdc:mga0qj67_52075_c1_890_1804 | 304 |
| 264 | 3300050510 | nmdc:mga06r32_22005_c1 | nmdc:mga06r32_22005_c1_3829_4743 | 304 |
| 265 | 3300050510 | nmdc:mga06r32_430968_c1 | nmdc:mga06r32_430968_c1_307_1221 | 304 |
| 266 | 3300050511 | nmdc:mga08y16_394399_c1 | nmdc:mga08y16_394399_c1_481_1401 | 304 |
| 267 | 3300060353 | Ga0501082_0508298 | Ga0501082_0508298_85_1008 | 304 |
| 268 | 3300061734 | Ga0530510_0110129 | Ga0530510_0110129_199_1119 | 304 |
| 269 | iso_pu_bacteria | 2862574272 | 2862580931 | 304 |
| 270 | 3300003373 | JGI25407J50210_10009481 | JGI25407J50210_100094812 | 305 |
| 271 | 3300005328 | Ga0070676_10083492 | Ga0070676_100834922 | 305 |
| 272 | 3300005336 | Ga0070680_100050335 | Ga0070680_1000503352 | 305 |
| 273 | 3300005341 | Ga0070691_10034860 | Ga0070691_100348602 | 305 |
| 274 | 3300005345 | Ga0070692_10009217 | Ga0070692_100092172 | 305 |
| 275 | 3300005366 | Ga0070659_100018755 | Ga0070659_1000187552 | 305 |
| 276 | 3300005441 | Ga0070700_100190595 | Ga0070700_1001905951 | 305 |
| 277 | 3300005458 | Ga0070681_10187426 | Ga0070681_101874262 | 305 |
| 278 | 3300005530 | Ga0070679_100125024 | Ga0070679_1001250242 | 305 |
| 279 | 3300005535 | Ga0070684_100085979 | Ga0070684_1000859791 | 305 |
| 280 | 3300005564 | Ga0070664_100155883 | Ga0070664_1001558832 | 305 |
| 281 | 3300005616 | Ga0068852_100068154 | Ga0068852_1000681542 | 305 |
| 282 | 3300005981 | Ga0081538_10000077 | Ga0081538_1000007737 | 305 |
| 283 | 3300006852 | Ga0075433_10060114 | Ga0075433_100601144 | 305 |
| 284 | 3300006871 | Ga0075434_100321175 | Ga0075434_1003211752 | 305 |
| 285 | 3300006880 | Ga0075429_100073229 | Ga0075429_1000732294 | 305 |
| 286 | 3300006881 | Ga0068865_100164176 | Ga0068865_1001641762 | 305 |
| 287 | 3300009147 | Ga0114129_10000657 | Ga0114129_1000065732 | 305 |
| 288 | 3300025898 | Ga0207692_10013344 | Ga0207692_100133442 | 305 |
| 289 | 3300025901 | Ga0207688_10061609 | Ga0207688_100616091 | 305 |
| 290 | 3300025919 | Ga0207657_10218357 | Ga0207657_102183572 | 305 |
| 291 | 3300025935 | Ga0207709_10052281 | Ga0207709_100522813 | 305 |
| 292 | 3300025945 | Ga0207679_10081933 | Ga0207679_100819332 | 305 |
| 293 | 3300026041 | Ga0207639_10124702 | Ga0207639_101247022 | 305 |
| 294 | 3300026075 | Ga0207708_10102651 | Ga0207708_101026512 | 305 |
| 295 | 3300026142 | Ga0207698_10106707 | Ga0207698_101067072 | 305 |
| 296 | 3300027907 | Ga0207428_10005790 | Ga0207428_100057901 | 305 |
| 297 | 3300035725 | Ga0373947_0209264 | Ga0373947_0209264_289_1254 | 305 |
| 298 | 3300044694 | Ga0466963_0039612 | Ga0466963_0039612_944_1870 | 305 |
| 299 | 3300049575 | Ga0501039_0046069 | Ga0501039_0046069_2391_3356 | 305 |
| 300 | 3300049582 | Ga0501048_0253126 | Ga0501048_0253126_35_1072 | 305 |
| 301 | 3300049824 | Ga0501045_0025753 | Ga0501045_0025753_46_1011 | 305 |
| 302 | 3300050507 | nmdc:mga05p37_3308_c1 | nmdc:mga05p37_3308_c1_7865_8950 | 305 |
| 303 | 3300050508 | nmdc:mga09592_198255_c1 | nmdc:mga09592_198255_c1_637_1635 | 305 |
| 304 | 3300050508 | nmdc:mga09592_31_c1 | nmdc:mga09592_31_c1_9507_10592 | 305 |
| 305 | 3300050508 | nmdc:mga09592_32514_c1 | nmdc:mga09592_32514_c1_2398_3363 | 305 |
| 306 | 3300050509 | nmdc:mga0qj67_43_c1 | nmdc:mga0qj67_43_c1_17615_18700 | 305 |
| 307 | 3300050510 | nmdc:mga06r32_57_c2 | nmdc:mga06r32_57_c2_32807_33892 | 305 |
| 308 | 3300050511 | nmdc:mga08y16_40272_c1 | nmdc:mga08y16_40272_c1_2339_3295 | 305 |
| 309 | 3300050512 | nmdc:mga0n895_324722_c1 | nmdc:mga0n895_324722_c1_421_1377 | 305 |
| 310 | 3300050515 | nmdc:mga0a205_8359_c1 | nmdc:mga0a205_8359_c1_816_1781 | 305 |
| 311 | iso_pu_bacteria | 2808606982 | 2811849211 | 305 |
| 312 | iso_pu_bacteria | 2868088558 | 2868090006 | 305 |
| 313 | iso_pu_bacteria | 3006321560 | 3006327512 | 305 |
| 314 | 3300005327 | Ga0070658_10035358 | Ga0070658_100353584 | 306 |
| 315 | 3300005329 | Ga0070683_100248637 | Ga0070683_1002486372 | 306 |
| 316 | 3300005347 | Ga0070668_100231051 | Ga0070668_1002310512 | 306 |
| 317 | 3300005436 | Ga0070713_100271189 | Ga0070713_1002711891 | 306 |
| 318 | 3300005437 | Ga0070710_10256032 | Ga0070710_102560321 | 306 |
| 319 | 3300005445 | Ga0070708_100206136 | Ga0070708_1002061362 | 306 |
| 320 | 3300005467 | Ga0070706_100000176 | Ga0070706_10000017668 | 306 |
| 321 | 3300005468 | Ga0070707_100001211 | Ga0070707_10000121119 | 306 |
| 322 | 3300005618 | Ga0068864_100205781 | Ga0068864_1002057812 | 306 |
| 323 | 3300005618 | Ga0068864_100434364 | Ga0068864_1004343642 | 306 |
| 324 | 3300005842 | Ga0068858_100232197 | Ga0068858_1002321972 | 306 |
| 325 | 3300005937 | Ga0081455_10032348 | Ga0081455_100323482 | 306 |
| 326 | 3300005981 | Ga0081538_10000164 | Ga0081538_1000016433 | 306 |
| 327 | 3300005981 | Ga0081538_10001086 | Ga0081538_1000108622 | 306 |
| 328 | 3300005981 | Ga0081538_10011964 | Ga0081538_100119645 | 306 |
| 329 | 3300005983 | Ga0081540_1022919 | Ga0081540_10229194 | 306 |
| 330 | 3300005985 | Ga0081539_10012129 | Ga0081539_100121295 | 306 |
| 331 | 3300005985 | Ga0081539_10077093 | Ga0081539_100770931 | 306 |
| 332 | 3300006844 | Ga0075428_100002757 | Ga0075428_10000275714 | 306 |
| 333 | 3300006844 | Ga0075428_100020699 | Ga0075428_1000206995 | 306 |
| 334 | 3300006844 | Ga0075428_100410159 | Ga0075428_1004101592 | 306 |
| 335 | 3300006846 | Ga0075430_100019158 | Ga0075430_1000191588 | 306 |
| 336 | 3300006880 | Ga0075429_100024155 | Ga0075429_1000241557 | 306 |
| 337 | 3300009094 | Ga0111539_10094434 | Ga0111539_100944344 | 306 |
| 338 | 3300009094 | Ga0111539_10205473 | Ga0111539_102054732 | 306 |
| 339 | 3300009101 | Ga0105247_10000892 | Ga0105247_1000089221 | 306 |
| 340 | 3300009147 | Ga0114129_10497000 | Ga0114129_104970001 | 306 |
| 341 | 3300009148 | Ga0105243_10057296 | Ga0105243_100572962 | 306 |
| 342 | 3300009148 | Ga0105243_10074560 | Ga0105243_100745602 | 306 |
| 343 | 3300011119 | Ga0105246_10303339 | Ga0105246_103033391 | 306 |
| 344 | 3300013297 | Ga0157378_10031404 | Ga0157378_100314045 | 306 |
| 345 | 3300013306 | Ga0163162_10321744 | Ga0163162_103217441 | 306 |
| 346 | 3300013308 | Ga0157375_10265047 | Ga0157375_102650472 | 306 |
| 347 | 3300025900 | Ga0207710_10000548 | Ga0207710_100005483 | 306 |
| 348 | 3300025906 | Ga0207699_10137141 | Ga0207699_101371411 | 306 |
| 349 | 3300025909 | Ga0207705_10013985 | Ga0207705_100139854 | 306 |
| 350 | 3300025910 | Ga0207684_10000494 | Ga0207684_1000049412 | 306 |
| 351 | 3300025922 | Ga0207646_10003853 | Ga0207646_100038534 | 306 |
| 352 | 3300025937 | Ga0207669_10266573 | Ga0207669_102665731 | 306 |
| 353 | 3300025949 | Ga0207667_10015499 | Ga0207667_100154995 | 306 |
| 354 | 3300025972 | Ga0207668_10231882 | Ga0207668_102318822 | 306 |
| 355 | 3300026078 | Ga0207702_10313258 | Ga0207702_103132582 | 306 |
| 356 | 3300026078 | Ga0207702_10327051 | Ga0207702_103270512 | 306 |
| 357 | 3300028381 | Ga0268264_10420731 | Ga0268264_104207311 | 306 |
| 358 | 3300031548 | Ga0307408_100022366 | Ga0307408_1000223664 | 306 |
| 359 | 3300031649 | Ga0307514_10010571 | Ga0307514_100105712 | 306 |
| 360 | 3300031730 | Ga0307516_10142314 | Ga0307516_101423142 | 306 |
| 361 | 3300031731 | Ga0307405_10000410 | Ga0307405_1000041015 | 306 |
| 362 | 3300031731 | Ga0307405_10091983 | Ga0307405_100919832 | 306 |
| 363 | 3300031852 | Ga0307410_10000900 | Ga0307410_100009004 | 306 |
| 364 | 3300031903 | Ga0307407_10024342 | Ga0307407_100243423 | 306 |
| 365 | 3300031911 | Ga0307412_10005158 | Ga0307412_100051587 | 306 |
| 366 | 3300031911 | Ga0307412_10081110 | Ga0307412_100811102 | 306 |
| 367 | 3300031995 | Ga0307409_100139338 | Ga0307409_1001393381 | 306 |
| 368 | 3300032002 | Ga0307416_100001992 | Ga0307416_10000199210 | 306 |
| 369 | 3300032004 | Ga0307414_10266033 | Ga0307414_102660331 | 306 |
| 370 | 3300032126 | Ga0307415_100002406 | Ga0307415_1000024061 | 306 |
| 371 | 3300033180 | Ga0307510_10206310 | Ga0307510_102063102 | 306 |
| 372 | 3300035091 | Ga0373951_0000031 | Ga0373951_0000031_5524_6450 | 306 |
| 373 | 3300038443 | Ga0395901_0098727 | Ga0395901_0098727_1608_2561 | 306 |
| 374 | 3300041512 | Ga0451853_0826964 | Ga0451853_0826964_7971_8891 | 306 |
| 375 | 3300042008 | Ga0439450_044169 | Ga0439450_044169_42_965 | 306 |
| 376 | 3300044683 | Ga0466965_0065953 | Ga0466965_0065953_438_1364 | 306 |
| 377 | 3300044694 | Ga0466963_0058918 | Ga0466963_0058918_66_1124 | 306 |
| 378 | 3300044842 | Ga0466957_0269968 | Ga0466957_0269968_138_1091 | 306 |
| 379 | 3300045976 | Ga0466967_0208951 | Ga0466967_0208951_514_1440 | 306 |
| 380 | 3300045976 | Ga0466967_0558288 | Ga0466967_0558288_42_1016 | 306 |
| 381 | 3300047321 | Ga0495676_0023565 | Ga0495676_0023565_933_1859 | 306 |
| 382 | 3300048903 | Ga0496100_0006953 | Ga0496100_0006953_3932_4858 | 306 |
| 383 | 3300048907 | Ga0496104_0000004 | Ga0496104_0000004_498874_499821 | 306 |
| 384 | 3300048907 | Ga0496104_0009109 | Ga0496104_0009109_2407_3396 | 306 |
| 385 | 3300048907 | Ga0496104_0303730 | Ga0496104_0303730_404_1387 | 306 |
| 386 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_142010_142957 | 306 |
| 387 | 3300048912 | Ga0496109_0180246 | Ga0496109_0180246_117_1100 | 306 |
| 388 | 3300048912 | Ga0496109_0239644 | Ga0496109_0239644_384_1367 | 306 |
| 389 | 3300048914 | Ga0496111_0013312 | Ga0496111_0013312_2071_3060 | 306 |
| 390 | 3300048915 | Ga0496112_0029713 | Ga0496112_0029713_2091_3074 | 306 |
| 391 | 3300048915 | Ga0496112_0059212 | Ga0496112_0059212_476_1465 | 306 |
| 392 | 3300048916 | Ga0496113_0055968 | Ga0496113_0055968_1684_2667 | 306 |
| 393 | 3300048918 | Ga0496115_0172439 | Ga0496115_0172439_57_1031 | 306 |
| 394 | 3300048922 | Ga0496119_0006668 | Ga0496119_0006668_5397_6344 | 306 |
| 395 | 3300049581 | Ga0501047_0026531 | Ga0501047_0026531_3915_4874 | 306 |
| 396 | 3300050507 | nmdc:mga05p37_284166_c1 | nmdc:mga05p37_284166_c1_672_1634 | 306 |
| 397 | 3300050508 | nmdc:mga09592_86710_c1 | nmdc:mga09592_86710_c1_68_1021 | 306 |
| 398 | 3300050509 | nmdc:mga0qj67_8184_c1 | nmdc:mga0qj67_8184_c1_4286_5272 | 306 |
| 399 | 3300050510 | nmdc:mga06r32_3193_c1 | nmdc:mga06r32_3193_c1_4192_5178 | 306 |
| 400 | 3300050510 | nmdc:mga06r32_356103_c1 | nmdc:mga06r32_356103_c1_279_1220 | 306 |
| 401 | 3300050511 | nmdc:mga08y16_210584_c1 | nmdc:mga08y16_210584_c1_290_1231 | 306 |
| 402 | iso_pu_bacteria | 2795385470 | 2795787072 | 306 |
| 403 | iso_pu_bacteria | 2837268691 | 2837270897 | 306 |
| 404 | 3300005518 | Ga0070699_100010740 | Ga0070699_1000107404 | 307 |
| 405 | 3300035091 | Ga0373951_0000049 | Ga0373951_0000049_7222_8145 | 307 |
| 406 | 3300045976 | Ga0466967_0650416 | Ga0466967_0650416_88_1020 | 307 |
| 407 | 3300047443 | Ga0495687_020854 | Ga0495687_020854_1966_2895 | 307 |
| 408 | 3300005436 | Ga0070713_100123406 | Ga0070713_1001234062 | 308 |
| 409 | 3300005937 | Ga0081455_10007936 | Ga0081455_100079366 | 308 |
| 410 | 3300005937 | Ga0081455_10032172 | Ga0081455_100321724 | 308 |
| 411 | 3300031548 | Ga0307408_100249427 | Ga0307408_1002494271 | 308 |
| 412 | 3300031731 | Ga0307405_10027949 | Ga0307405_100279494 | 308 |
| 413 | 3300031731 | Ga0307405_10068998 | Ga0307405_100689981 | 308 |
| 414 | 3300031824 | Ga0307413_10094623 | Ga0307413_100946232 | 308 |
| 415 | 3300031901 | Ga0307406_10006925 | Ga0307406_100069256 | 308 |
| 416 | 3300031901 | Ga0307406_10154755 | Ga0307406_101547552 | 308 |
| 417 | 3300031911 | Ga0307412_10328172 | Ga0307412_103281721 | 308 |
| 418 | 3300031995 | Ga0307409_100097594 | Ga0307409_1000975942 | 308 |
| 419 | 3300032002 | Ga0307416_100532060 | Ga0307416_1005320602 | 308 |
| 420 | 3300032004 | Ga0307414_10001230 | Ga0307414_100012309 | 308 |
| 421 | 3300032126 | Ga0307415_100005752 | Ga0307415_1000057526 | 308 |
| 422 | 3300044694 | Ga0466963_0102314 | Ga0466963_0102314_353_1279 | 308 |
| 423 | 3300046455 | Ga0495603_0016363 | Ga0495603_0016363_2382_3317 | 308 |
| 424 | 3300046459 | Ga0495629_0007601 | Ga0495629_0007601_3905_4840 | 308 |
| 425 | 3300046499 | Ga0495594_0152077 | Ga0495594_0152077_245_1180 | 308 |
| 426 | 3300046689 | Ga0495613_0001976 | Ga0495613_0001976_8543_9478 | 308 |
| 427 | 3300048089 | Ga0495614_0021167 | Ga0495614_0021167_1812_2747 | 308 |
| 428 | iso_pu_bacteria | 2616644814 | 2616699399 | 308 |
| 429 | iso_pu_bacteria | 2996221748 | 2996221897 | 308 |
| 430 | 3300005985 | Ga0081539_10000594 | Ga0081539_1000059468 | 309 |
| 431 | 3300025904 | Ga0207647_10047501 | Ga0207647_100475011 | 309 |
| 432 | 3300025912 | Ga0207707_10091731 | Ga0207707_100917312 | 309 |
| 433 | 3300031548 | Ga0307408_100002184 | Ga0307408_10000218411 | 309 |
| 434 | 3300031548 | Ga0307408_100234881 | Ga0307408_1002348812 | 309 |
| 435 | 3300031731 | Ga0307405_10032075 | Ga0307405_100320753 | 309 |
| 436 | 3300031824 | Ga0307413_10208155 | Ga0307413_102081552 | 309 |
| 437 | 3300031901 | Ga0307406_10000850 | Ga0307406_1000085012 | 309 |
| 438 | 3300031995 | Ga0307409_100003158 | Ga0307409_1000031581 | 309 |
| 439 | 3300032002 | Ga0307416_100000687 | Ga0307416_10000068712 | 309 |
| 440 | 3300032126 | Ga0307415_100001567 | Ga0307415_10000156710 | 309 |
| 441 | 3300044693 | Ga0466961_0047081 | Ga0466961_0047081_951_1883 | 309 |
| 442 | 3300044842 | Ga0466957_0168848 | Ga0466957_0168848_288_1217 | 309 |
| 443 | 3300047321 | Ga0495676_0001890 | Ga0495676_0001890_15622_16560 | 309 |
| 444 | 3300049580 | Ga0501046_0030742 | Ga0501046_0030742_330_1259 | 309 |
| 445 | 3300049581 | Ga0501047_0062892 | Ga0501047_0062892_669_1601 | 309 |
| 446 | iso_pu_bacteria | 2808606375 | 2808917989 | 309 |
| 447 | 3300001979 | JGI24740J21852_10012270 | JGI24740J21852_100122703 | 310 |
| 448 | 3300001989 | JGI24739J22299_10014039 | JGI24739J22299_100140392 | 310 |
| 449 | 3300001990 | JGI24737J22298_10011157 | JGI24737J22298_100111572 | 310 |
| 450 | 3300003320 | rootH2_10010881 | rootH2_100108812 | 310 |
| 451 | 3300003760 | Ga0055527_1000005 | Ga0055527_1000005197 | 310 |
| 452 | 3300003762 | Ga0055542_1000006 | Ga0055542_1000006197 | 310 |
| 453 | 3300003763 | Ga0055529_1000013 | Ga0055529_1000013106 | 310 |
| 454 | 3300005327 | Ga0070658_10006366 | Ga0070658_100063665 | 310 |
| 455 | 3300005327 | Ga0070658_10047682 | Ga0070658_100476821 | 310 |
| 456 | 3300005329 | Ga0070683_100000483 | Ga0070683_1000004834 | 310 |
| 457 | 3300005329 | Ga0070683_100001497 | Ga0070683_10000149714 | 310 |
| 458 | 3300005339 | Ga0070660_100013235 | Ga0070660_1000132356 | 310 |
| 459 | 3300005343 | Ga0070687_100101115 | Ga0070687_1001011152 | 310 |
| 460 | 3300005366 | Ga0070659_100019569 | Ga0070659_1000195695 | 310 |
| 461 | 3300005434 | Ga0070709_10231385 | Ga0070709_102313852 | 310 |
| 462 | 3300005436 | Ga0070713_100139987 | Ga0070713_1001399873 | 310 |
| 463 | 3300005445 | Ga0070708_100106514 | Ga0070708_1001065142 | 310 |
| 464 | 3300005455 | Ga0070663_100030931 | Ga0070663_1000309313 | 310 |
| 465 | 3300005455 | Ga0070663_100072161 | Ga0070663_1000721612 | 310 |
| 466 | 3300005455 | Ga0070663_100072486 | Ga0070663_1000724863 | 310 |
| 467 | 3300005457 | Ga0070662_100069452 | Ga0070662_1000694521 | 310 |
| 468 | 3300005467 | Ga0070706_100033263 | Ga0070706_1000332632 | 310 |
| 469 | 3300005468 | Ga0070707_100031127 | Ga0070707_1000311273 | 310 |
| 470 | 3300005471 | Ga0070698_100011641 | Ga0070698_1000116416 | 310 |
| 471 | 3300005530 | Ga0070679_100105047 | Ga0070679_1001050472 | 310 |
| 472 | 3300005535 | Ga0070684_100002110 | Ga0070684_1000021109 | 310 |
| 473 | 3300005535 | Ga0070684_100018621 | Ga0070684_1000186212 | 310 |
| 474 | 3300005535 | Ga0070684_100092191 | Ga0070684_1000921912 | 310 |
| 475 | 3300005535 | Ga0070684_100092854 | Ga0070684_1000928544 | 310 |
| 476 | 3300005536 | Ga0070697_100000837 | Ga0070697_1000008378 | 310 |
| 477 | 3300005548 | Ga0070665_100000957 | Ga0070665_10000095735 | 310 |
| 478 | 3300005563 | Ga0068855_100045343 | Ga0068855_1000453434 | 310 |
| 479 | 3300005563 | Ga0068855_100050902 | Ga0068855_1000509023 | 310 |
| 480 | 3300005577 | Ga0068857_100007737 | Ga0068857_1000077371 | 310 |
| 481 | 3300005614 | Ga0068856_100017299 | Ga0068856_1000172993 | 310 |
| 482 | 3300005615 | Ga0070702_100036899 | Ga0070702_1000368992 | 310 |
| 483 | 3300005616 | Ga0068852_100338677 | Ga0068852_1003386772 | 310 |
| 484 | 3300005616 | Ga0068852_100763942 | Ga0068852_1007639421 | 310 |
| 485 | 3300005618 | Ga0068864_100025281 | Ga0068864_1000252814 | 310 |
| 486 | 3300005719 | Ga0068861_100068442 | Ga0068861_1000684421 | 310 |
| 487 | 3300005841 | Ga0068863_100044588 | Ga0068863_1000445884 | 310 |
| 488 | 3300005842 | Ga0068858_100088463 | Ga0068858_1000884631 | 310 |
| 489 | 3300005937 | Ga0081455_10012717 | Ga0081455_100127175 | 310 |
| 490 | 3300005937 | Ga0081455_10140333 | Ga0081455_101403333 | 310 |
| 491 | 3300005981 | Ga0081538_10000327 | Ga0081538_1000032744 | 310 |
| 492 | 3300005981 | Ga0081538_10001230 | Ga0081538_1000123027 | 310 |
| 493 | 3300005981 | Ga0081538_10004928 | Ga0081538_1000492815 | 310 |
| 494 | 3300005981 | Ga0081538_10005814 | Ga0081538_100058148 | 310 |
| 495 | 3300005981 | Ga0081538_10008447 | Ga0081538_1000844711 | 310 |
| 496 | 3300005981 | Ga0081538_10010361 | Ga0081538_100103612 | 310 |
| 497 | 3300005981 | Ga0081538_10011370 | Ga0081538_100113705 | 310 |
| 498 | 3300005981 | Ga0081538_10014900 | Ga0081538_100149004 | 310 |
| 499 | 3300005981 | Ga0081538_10065101 | Ga0081538_100651011 | 310 |
| 500 | 3300005983 | Ga0081540_1015521 | Ga0081540_10155213 | 310 |
| 501 | 3300005983 | Ga0081540_1027370 | Ga0081540_10273703 | 310 |
| 502 | 3300005985 | Ga0081539_10000312 | Ga0081539_1000031271 | 310 |
| 503 | 3300006028 | Ga0070717_10024373 | Ga0070717_100243734 | 310 |
| 504 | 3300006847 | Ga0075431_100010408 | Ga0075431_1000104087 | 310 |
| 505 | 3300006881 | Ga0068865_100039073 | Ga0068865_1000390734 | 310 |
| 506 | 3300009093 | Ga0105240_10192816 | Ga0105240_101928163 | 310 |
| 507 | 3300009545 | Ga0105237_10170094 | Ga0105237_101700943 | 310 |
| 508 | 3300013102 | Ga0157371_10092779 | Ga0157371_100927791 | 310 |
| 509 | 3300013104 | Ga0157370_10012750 | Ga0157370_100127506 | 310 |
| 510 | 3300013105 | Ga0157369_10034217 | Ga0157369_100342176 | 310 |
| 511 | 3300013307 | Ga0157372_10256280 | Ga0157372_102562801 | 310 |
| 512 | 3300017792 | Ga0163161_10080068 | Ga0163161_100800683 | 310 |
| 513 | 3300022467 | Ga0224712_10063666 | Ga0224712_100636662 | 310 |
| 514 | 3300025228 | Ga0209672_100003 | Ga0209672_100003541 | 310 |
| 515 | 3300025229 | Ga0209147_101200 | Ga0209147_1012008 | 310 |
| 516 | 3300025254 | Ga0209148_1000004 | Ga0209148_1000004836 | 310 |
| 517 | 3300025272 | Ga0209455_1000022 | Ga0209455_1000022147 | 310 |
| 518 | 3300025901 | Ga0207688_10213150 | Ga0207688_102131501 | 310 |
| 519 | 3300025904 | Ga0207647_10009660 | Ga0207647_100096602 | 310 |
| 520 | 3300025904 | Ga0207647_10017159 | Ga0207647_100171594 | 310 |
| 521 | 3300025904 | Ga0207647_10020533 | Ga0207647_100205333 | 310 |
| 522 | 3300025904 | Ga0207647_10036923 | Ga0207647_100369232 | 310 |
| 523 | 3300025909 | Ga0207705_10000001 | Ga0207705_10000001363 | 310 |
| 524 | 3300025909 | Ga0207705_10010070 | Ga0207705_100100702 | 310 |
| 525 | 3300025909 | Ga0207705_10083798 | Ga0207705_100837981 | 310 |
| 526 | 3300025919 | Ga0207657_10030888 | Ga0207657_100308882 | 310 |
| 527 | 3300025920 | Ga0207649_10101944 | Ga0207649_101019442 | 310 |
| 528 | 3300025921 | Ga0207652_10341150 | Ga0207652_103411501 | 310 |
| 529 | 3300025921 | Ga0207652_10356150 | Ga0207652_103561501 | 310 |
| 530 | 3300025922 | Ga0207646_10005806 | Ga0207646_100058068 | 310 |
| 531 | 3300025927 | Ga0207687_10003716 | Ga0207687_100037169 | 310 |
| 532 | 3300025928 | Ga0207700_10187479 | Ga0207700_101874792 | 310 |
| 533 | 3300025929 | Ga0207664_10071483 | Ga0207664_100714831 | 310 |
| 534 | 3300025932 | Ga0207690_10132441 | Ga0207690_101324412 | 310 |
| 535 | 3300025932 | Ga0207690_10322715 | Ga0207690_103227151 | 310 |
| 536 | 3300025933 | Ga0207706_10049304 | Ga0207706_100493043 | 310 |
| 537 | 3300025934 | Ga0207686_10080137 | Ga0207686_100801373 | 310 |
| 538 | 3300025934 | Ga0207686_10270712 | Ga0207686_102707122 | 310 |
| 539 | 3300025941 | Ga0207711_10088721 | Ga0207711_100887212 | 310 |
| 540 | 3300025944 | Ga0207661_10000475 | Ga0207661_100004754 | 310 |
| 541 | 3300025944 | Ga0207661_10023816 | Ga0207661_100238164 | 310 |
| 542 | 3300025944 | Ga0207661_10159304 | Ga0207661_101593041 | 310 |
| 543 | 3300025949 | Ga0207667_10321241 | Ga0207667_103212411 | 310 |
| 544 | 3300025961 | Ga0207712_10172320 | Ga0207712_101723202 | 310 |
| 545 | 3300025961 | Ga0207712_10174263 | Ga0207712_101742632 | 310 |
| 546 | 3300026035 | Ga0207703_10262580 | Ga0207703_102625802 | 310 |
| 547 | 3300026067 | Ga0207678_10011795 | Ga0207678_100117953 | 310 |
| 548 | 3300026067 | Ga0207678_10031474 | Ga0207678_100314744 | 310 |
| 549 | 3300026078 | Ga0207702_10131341 | Ga0207702_101313412 | 310 |
| 550 | 3300026095 | Ga0207676_10062133 | Ga0207676_100621332 | 310 |
| 551 | 3300026116 | Ga0207674_10013524 | Ga0207674_100135244 | 310 |
| 552 | 3300026116 | Ga0207674_10088825 | Ga0207674_100888253 | 310 |
| 553 | 3300026118 | Ga0207675_100030582 | Ga0207675_1000305824 | 310 |
| 554 | 3300026142 | Ga0207698_10484354 | Ga0207698_104843542 | 310 |
| 555 | 3300028379 | Ga0268266_10009722 | Ga0268266_100097227 | 310 |
| 556 | 3300028786 | Ga0307517_10083258 | Ga0307517_100832582 | 310 |
| 557 | 3300028786 | Ga0307517_10092861 | Ga0307517_100928612 | 310 |
| 558 | 3300028794 | Ga0307515_10019662 | Ga0307515_1001966211 | 310 |
| 559 | 3300030522 | Ga0307512_10017852 | Ga0307512_100178523 | 310 |
| 560 | 3300031548 | Ga0307408_100079291 | Ga0307408_1000792912 | 310 |
| 561 | 3300031592 | Ga0310117_100046 | Ga0310117_1000463 | 310 |
| 562 | 3300031616 | Ga0307508_10011061 | Ga0307508_100110616 | 310 |
| 563 | 3300031731 | Ga0307405_10071120 | Ga0307405_100711203 | 310 |
| 564 | 3300031824 | Ga0307413_10036731 | Ga0307413_100367313 | 310 |
| 565 | 3300031852 | Ga0307410_10029720 | Ga0307410_100297204 | 310 |
| 566 | 3300031903 | Ga0307407_10000978 | Ga0307407_1000097814 | 310 |
| 567 | 3300031995 | Ga0307409_100003924 | Ga0307409_1000039248 | 310 |
| 568 | 3300031995 | Ga0307409_100018892 | Ga0307409_1000188922 | 310 |
| 569 | 3300031995 | Ga0307409_100103712 | Ga0307409_1001037122 | 310 |
| 570 | 3300032002 | Ga0307416_100009781 | Ga0307416_1000097815 | 310 |
| 571 | 3300032004 | Ga0307414_10005150 | Ga0307414_100051503 | 310 |
| 572 | 3300032004 | Ga0307414_10011793 | Ga0307414_100117932 | 310 |
| 573 | 3300032126 | Ga0307415_100019187 | Ga0307415_1000191872 | 310 |
| 574 | 3300032126 | Ga0307415_100055788 | Ga0307415_1000557883 | 310 |
| 575 | 3300032126 | Ga0307415_100060812 | Ga0307415_1000608123 | 310 |
| 576 | 3300036401 | Ga0373937_0215536 | Ga0373937_0215536_820_1761 | 310 |
| 577 | 3300037068 | Ga0373925_0000041 | Ga0373925_0000041_31915_32853 | 310 |
| 578 | 3300037312 | Ga0395899_0057477 | Ga0395899_0057477_1230_2162 | 310 |
| 579 | 3300037418 | Ga0395900_0005888 | Ga0395900_0005888_9314_10246 | 310 |
| 580 | 3300037418 | Ga0395900_0017136 | Ga0395900_0017136_2049_2987 | 310 |
| 581 | 3300037466 | Ga0395898_0000481 | Ga0395898_0000481_31110_32042 | 310 |
| 582 | 3300037466 | Ga0395898_0020662 | Ga0395898_0020662_5084_6022 | 310 |
| 583 | 3300037466 | Ga0395898_0518419 | Ga0395898_0518419_55_987 | 310 |
| 584 | 3300037471 | Ga0395905_0103983 | Ga0395905_0103983_967_1905 | 310 |
| 585 | 3300038443 | Ga0395901_0019372 | Ga0395901_0019372_4363_5301 | 310 |
| 586 | 3300038443 | Ga0395901_0022357 | Ga0395901_0022357_5482_6426 | 310 |
| 587 | 3300044656 | Ga0466969_0004700 | Ga0466969_0004700_820_1752 | 310 |
| 588 | 3300044658 | Ga0466972_0155140 | Ga0466972_0155140_54_992 | 310 |
| 589 | 3300044684 | Ga0466966_0007054 | Ga0466966_0007054_3301_4233 | 310 |
| 590 | 3300044693 | Ga0466961_0082203 | Ga0466961_0082203_615_1547 | 310 |
| 591 | 3300044694 | Ga0466963_0034080 | Ga0466963_0034080_1251_2183 | 310 |
| 592 | 3300044694 | Ga0466963_0191427 | Ga0466963_0191427_274_1206 | 310 |
| 593 | 3300044719 | Ga0466971_0036722 | Ga0466971_0036722_844_1776 | 310 |
| 594 | 3300044765 | Ga0466970_0083405 | Ga0466970_0083405_739_1671 | 310 |
| 595 | 3300044842 | Ga0466957_0273791 | Ga0466957_0273791_19_957 | 310 |
| 596 | 3300044901 | Ga0466960_0010294 | Ga0466960_0010294_1695_2651 | 310 |
| 597 | 3300044901 | Ga0466960_0045165 | Ga0466960_0045165_1068_2000 | 310 |
| 598 | 3300045049 | Ga0466959_0091803 | Ga0466959_0091803_553_1485 | 310 |
| 599 | 3300045836 | Ga0466958_0069820 | Ga0466958_0069820_1199_2131 | 310 |
| 600 | 3300045976 | Ga0466967_0005997 | Ga0466967_0005997_2269_3204 | 310 |
| 601 | 3300045976 | Ga0466967_0095501 | Ga0466967_0095501_365_1303 | 310 |
| 602 | 3300045976 | Ga0466967_0244389 | Ga0466967_0244389_744_1676 | 310 |
| 603 | 3300045976 | Ga0466967_0279188 | Ga0466967_0279188_581_1522 | 310 |
| 604 | 3300045976 | Ga0466967_0368728 | Ga0466967_0368728_260_1198 | 310 |
| 605 | 3300046452 | Ga0495617_012949 | Ga0495617_012949_1707_2639 | 310 |
| 606 | 3300046454 | Ga0495592_0011720 | Ga0495592_0011720_5551_6483 | 310 |
| 607 | 3300046455 | Ga0495603_0066074 | Ga0495603_0066074_962_1894 | 310 |
| 608 | 3300046459 | Ga0495629_0010003 | Ga0495629_0010003_5506_6438 | 310 |
| 609 | 3300046459 | Ga0495629_0019118 | Ga0495629_0019118_3470_4402 | 310 |
| 610 | 3300046459 | Ga0495629_0103496 | Ga0495629_0103496_553_1485 | 310 |
| 611 | 3300046462 | Ga0495651_0078500 | Ga0495651_0078500_1253_2185 | 310 |
| 612 | 3300046476 | Ga0495662_0000568 | Ga0495662_0000568_14833_15771 | 310 |
| 613 | 3300046476 | Ga0495662_0001073 | Ga0495662_0001073_564_1502 | 310 |
| 614 | 3300046499 | Ga0495594_0035998 | Ga0495594_0035998_1325_2257 | 310 |
| 615 | 3300046499 | Ga0495594_0058825 | Ga0495594_0058825_751_1683 | 310 |
| 616 | 3300046499 | Ga0495594_0071917 | Ga0495594_0071917_509_1447 | 310 |
| 617 | 3300046512 | Ga0495610_0034663 | Ga0495610_0034663_1462_2394 | 310 |
| 618 | 3300046514 | Ga0495618_0121259 | Ga0495618_0121259_189_1121 | 310 |
| 619 | 3300046516 | Ga0495628_0063601 | Ga0495628_0063601_1400_2332 | 310 |
| 620 | 3300046516 | Ga0495628_0345109 | Ga0495628_0345109_54_986 | 310 |
| 621 | 3300046517 | Ga0495630_0052990 | Ga0495630_0052990_1146_2078 | 310 |
| 622 | 3300046519 | Ga0495632_0023301 | Ga0495632_0023301_2274_3206 | 310 |
| 623 | 3300046529 | Ga0495652_0031272 | Ga0495652_0031272_163_1095 | 310 |
| 624 | 3300046529 | Ga0495652_0196865 | Ga0495652_0196865_448_1380 | 310 |
| 625 | 3300046533 | Ga0495640_0017011 | Ga0495640_0017011_4157_5089 | 310 |
| 626 | 3300046533 | Ga0495640_0032572 | Ga0495640_0032572_2576_3508 | 310 |
| 627 | 3300046533 | Ga0495640_0172068 | Ga0495640_0172068_108_1046 | 310 |
| 628 | 3300046538 | Ga0495609_0087478 | Ga0495609_0087478_218_1150 | 310 |
| 629 | 3300046557 | Ga0495622_0068081 | Ga0495622_0068081_314_1246 | 310 |
| 630 | 3300046559 | Ga0495667_0057926 | Ga0495667_0057926_1051_1983 | 310 |
| 631 | 3300046642 | Ga0495634_0047173 | Ga0495634_0047173_1340_2272 | 310 |
| 632 | 3300046675 | Ga0495657_0000588 | Ga0495657_0000588_18011_18949 | 310 |
| 633 | 3300046675 | Ga0495657_0022323 | Ga0495657_0022323_825_1763 | 310 |
| 634 | 3300046689 | Ga0495613_0010586 | Ga0495613_0010586_5263_6201 | 310 |
| 635 | 3300046689 | Ga0495613_0079441 | Ga0495613_0079441_912_1850 | 310 |
| 636 | 3300046689 | Ga0495613_0083380 | Ga0495613_0083380_687_1619 | 310 |
| 637 | 3300046689 | Ga0495613_0167846 | Ga0495613_0167846_193_1131 | 310 |
| 638 | 3300046690 | Ga0495624_0013797 | Ga0495624_0013797_4484_5422 | 310 |
| 639 | 3300046690 | Ga0495624_0074558 | Ga0495624_0074558_670_1602 | 310 |
| 640 | 3300046690 | Ga0495624_0109116 | Ga0495624_0109116_380_1312 | 310 |
| 641 | 3300046690 | Ga0495624_0137680 | Ga0495624_0137680_71_1003 | 310 |
| 642 | 3300046694 | Ga0495649_0031689 | Ga0495649_0031689_547_1485 | 310 |
| 643 | 3300047315 | Ga0495581_0071385 | Ga0495581_0071385_328_1266 | 310 |
| 644 | 3300047315 | Ga0495581_0092819 | Ga0495581_0092819_405_1343 | 310 |
| 645 | 3300047317 | Ga0495604_0012907 | Ga0495604_0012907_2552_3490 | 310 |
| 646 | 3300047317 | Ga0495604_0053457 | Ga0495604_0053457_969_1907 | 310 |
| 647 | 3300047318 | Ga0495636_0006927 | Ga0495636_0006927_204_1142 | 310 |
| 648 | 3300047319 | Ga0495674_0006056 | Ga0495674_0006056_5155_6087 | 310 |
| 649 | 3300047319 | Ga0495674_0193631 | Ga0495674_0193631_645_1577 | 310 |
| 650 | 3300047319 | Ga0495674_0292154 | Ga0495674_0292154_191_1129 | 310 |
| 651 | 3300047321 | Ga0495676_0051363 | Ga0495676_0051363_59_997 | 310 |
| 652 | 3300047321 | Ga0495676_0052583 | Ga0495676_0052583_1357_2289 | 310 |
| 653 | 3300047321 | Ga0495676_0180782 | Ga0495676_0180782_407_1345 | 310 |
| 654 | 3300047443 | Ga0495687_001586 | Ga0495687_001586_7558_8496 | 310 |
| 655 | 3300047443 | Ga0495687_005483 | Ga0495687_005483_2090_3028 | 310 |
| 656 | 3300047443 | Ga0495687_077493 | Ga0495687_077493_292_1230 | 310 |
| 657 | 3300047443 | Ga0495687_104949 | Ga0495687_104949_76_1008 | 310 |
| 658 | 3300047444 | Ga0495675_0010945 | Ga0495675_0010945_992_1930 | 310 |
| 659 | 3300047447 | Ga0495685_010796 | Ga0495685_010796_1378_2316 | 310 |
| 660 | 3300047673 | Ga0495593_0002108 | Ga0495593_0002108_4517_5455 | 310 |
| 661 | 3300047673 | Ga0495593_0044644 | Ga0495593_0044644_622_1560 | 310 |
| 662 | 3300048088 | Ga0495602_0121051 | Ga0495602_0121051_999_1967 | 310 |
| 663 | 3300048089 | Ga0495614_0008434 | Ga0495614_0008434_3289_4221 | 310 |
| 664 | 3300048089 | Ga0495614_0027613 | Ga0495614_0027613_1351_2289 | 310 |
| 665 | 3300048904 | Ga0496101_0039771 | Ga0496101_0039771_200_1132 | 310 |
| 666 | 3300048907 | Ga0496104_0071151 | Ga0496104_0071151_1499_2431 | 310 |
| 667 | 3300048908 | Ga0496105_0005310 | Ga0496105_0005310_859_1791 | 310 |
| 668 | 3300048917 | Ga0496114_0147469 | Ga0496114_0147469_955_1896 | 310 |
| 669 | 3300048918 | Ga0496115_0098511 | Ga0496115_0098511_817_1749 | 310 |
| 670 | 3300048918 | Ga0496115_0287239 | Ga0496115_0287239_359_1300 | 310 |
| 671 | 3300048929 | Ga0496126_0031840 | Ga0496126_0031840_3659_4600 | 310 |
| 672 | 3300048929 | Ga0496126_0200014 | Ga0496126_0200014_25_957 | 310 |
| 673 | 3300049568 | Ga0501031_0003764 | Ga0501031_0003764_5835_6767 | 310 |
| 674 | 3300049569 | Ga0501032_0004275 | Ga0501032_0004275_7807_8739 | 310 |
| 675 | 3300049570 | Ga0501033_0016260 | Ga0501033_0016260_2989_3921 | 310 |
| 676 | 3300049571 | Ga0501034_0032491 | Ga0501034_0032491_2652_3584 | 310 |
| 677 | 3300049571 | Ga0501034_0291088 | Ga0501034_0291088_612_1544 | 310 |
| 678 | 3300049572 | Ga0501036_0004014 | Ga0501036_0004014_1703_2635 | 310 |
| 679 | 3300049573 | Ga0501037_0000877 | Ga0501037_0000877_5014_5946 | 310 |
| 680 | 3300049574 | Ga0501038_0006616 | Ga0501038_0006616_119_1051 | 310 |
| 681 | 3300049575 | Ga0501039_0279409 | Ga0501039_0279409_361_1293 | 310 |
| 682 | 3300049576 | Ga0501040_0010811 | Ga0501040_0010811_4318_5250 | 310 |
| 683 | 3300049579 | Ga0501043_0001649 | Ga0501043_0001649_2953_3885 | 310 |
| 684 | 3300049580 | Ga0501046_0003745 | Ga0501046_0003745_2989_3921 | 310 |
| 685 | 3300049581 | Ga0501047_0004742 | Ga0501047_0004742_8802_9734 | 310 |
| 686 | 3300049581 | Ga0501047_0017565 | Ga0501047_0017565_1902_2834 | 310 |
| 687 | 3300049581 | Ga0501047_0030159 | Ga0501047_0030159_29_961 | 310 |
| 688 | 3300049581 | Ga0501047_0055403 | Ga0501047_0055403_2629_3561 | 310 |
| 689 | 3300049581 | Ga0501047_0099811 | Ga0501047_0099811_1810_2748 | 310 |
| 690 | 3300049582 | Ga0501048_0002977 | Ga0501048_0002977_2989_3921 | 310 |
| 691 | 3300049583 | Ga0501067_0001377 | Ga0501067_0001377_8946_9878 | 310 |
| 692 | 3300049583 | Ga0501067_0005852 | Ga0501067_0005852_1886_2818 | 310 |
| 693 | 3300049584 | Ga0501068_0204239 | Ga0501068_0204239_95_1027 | 310 |
| 694 | 3300049586 | Ga0501070_0004792 | Ga0501070_0004792_5959_6912 | 310 |
| 695 | 3300049586 | Ga0501070_0023946 | Ga0501070_0023946_489_1421 | 310 |
| 696 | 3300049586 | Ga0501070_0041857 | Ga0501070_0041857_1968_2900 | 310 |
| 697 | 3300049587 | Ga0501071_0005296 | Ga0501071_0005296_3164_4096 | 310 |
| 698 | 3300049588 | Ga0501072_0008248 | Ga0501072_0008248_58_990 | 310 |
| 699 | 3300049588 | Ga0501072_0015071 | Ga0501072_0015071_631_1563 | 310 |
| 700 | 3300049588 | Ga0501072_0154762 | Ga0501072_0154762_36_968 | 310 |
| 701 | 3300049588 | Ga0501072_0281554 | Ga0501072_0281554_158_1096 | 310 |
| 702 | 3300049589 | Ga0501073_0130822 | Ga0501073_0130822_580_1512 | 310 |
| 703 | 3300049589 | Ga0501073_0144561 | Ga0501073_0144561_293_1246 | 310 |
| 704 | 3300049590 | Ga0501074_0004185 | Ga0501074_0004185_2727_3659 | 310 |
| 705 | 3300049590 | Ga0501074_0015924 | Ga0501074_0015924_2493_3425 | 310 |
| 706 | 3300049590 | Ga0501074_0016792 | Ga0501074_0016792_2503_3435 | 310 |
| 707 | 3300049590 | Ga0501074_0056073 | Ga0501074_0056073_1787_2740 | 310 |
| 708 | 3300049592 | Ga0501076_0335443 | Ga0501076_0335443_48_980 | 310 |
| 709 | 3300049592 | Ga0501076_0418397 | Ga0501076_0418397_48_980 | 310 |
| 710 | 3300049593 | Ga0501077_0005792 | Ga0501077_0005792_3395_4327 | 310 |
| 711 | 3300049593 | Ga0501077_0015350 | Ga0501077_0015350_3829_4761 | 310 |
| 712 | 3300049741 | Ga0501079_0023680 | Ga0501079_0023680_489_1421 | 310 |
| 713 | 3300049741 | Ga0501079_0236770 | Ga0501079_0236770_24_977 | 310 |
| 714 | 3300049742 | Ga0501080_0000857 | Ga0501080_0000857_5386_6318 | 310 |
| 715 | 3300049744 | Ga0501083_0010270 | Ga0501083_0010270_2082_3014 | 310 |
| 716 | 3300049744 | Ga0501083_0089782 | Ga0501083_0089782_922_1854 | 310 |
| 717 | 3300049744 | Ga0501083_0220825 | Ga0501083_0220825_57_989 | 310 |
| 718 | 3300049744 | Ga0501083_0221694 | Ga0501083_0221694_192_1145 | 310 |
| 719 | 3300049822 | Ga0501035_0002421 | Ga0501035_0002421_14266_15198 | 310 |
| 720 | 3300049823 | Ga0501044_0001494 | Ga0501044_0001494_23321_24253 | 310 |
| 721 | 3300049823 | Ga0501044_0004920 | Ga0501044_0004920_9705_10667 | 310 |
| 722 | 3300049823 | Ga0501044_0027151 | Ga0501044_0027151_3261_4217 | 310 |
| 723 | 3300049823 | Ga0501044_0199338 | Ga0501044_0199338_399_1337 | 310 |
| 724 | 3300049824 | Ga0501045_0050324 | Ga0501045_0050324_2044_2976 | 310 |
| 725 | 3300050510 | nmdc:mga06r32_58976_c1 | nmdc:mga06r32_58976_c1_1980_2918 | 310 |
| 726 | 3300053077 | Ga0495601_0042765 | Ga0495601_0042765_789_1757 | 310 |
| 727 | 3300053085 | Ga0495619_0361105 | Ga0495619_0361105_55_993 | 310 |
| 728 | 3300053096 | Ga0500641_0053055 | Ga0500641_0053055_20_952 | 310 |
| 729 | 3300054114 | Ga0501084_0110505 | Ga0501084_0110505_361_1293 | 310 |
| 730 | 3300060353 | Ga0501082_0200449 | Ga0501082_0200449_245_1177 | 310 |
| 731 | 3300061734 | Ga0530510_0381888 | Ga0530510_0381888_78_1010 | 310 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ka7-assembly1.cif.gz_A | crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 | 0.9042 | 1 | 34 |
| 3rbz-assembly1.cif.gz_A-2 | mthk channel, ca2+-bound | 0.835 | 2 | 125 |
| 3rbz-assembly1.cif.gz_C-2 | mthk channel, ca2+-bound | 0.8347 | 2 | 125 |
| 1l7d-assembly1.cif.gz_B | crystal structure of r. rubrum transhydrogenase domain i without bound nad(h) | 0.8317 | 2 | 75 |
| 6oly-assembly1.cif.gz_C | full-length mthk channel at 3.1 angstrom resolution | 0.8315 | 2 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9113 | 3 | 30 | 3.50.50.60 |
| af_Q5AC33_13_266_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.8955 | 3 | 47 | 3.90.180.10 |
| af_Q2FVH5_1_283_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.886 | 3 | 308 | 3.40.50.720 |
| 5xgvB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8804 | 3 | 34 | 3.50.50.60 |
| af_Q2FVH5_1_283_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8712 | 3 | 308 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1C4XUD3-F1-model_v4 | Nucleoside-diphosphate-sugar epimerase | 0.9937 | 18 | 288 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A7W5VBD1-F1-model_v4 | Nucleoside-diphosphate-sugar epimerase | 0.9922 | 1 | 122 |
|
| AF-A0A497W7Y5-F1-model_v4 | deleted | 0.9893 | 1 | 183 |
|
| AF-A0A539CWQ6-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9869 | 1 | 115 |
|
| AF-A0A7W0NP32-F1-model_v4 | NAD(P)H-binding protein | 0.9847 | 1 | 125 |
GO:0004029
GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar