F477952

General Info

Members Datasets Scaffolds Average Seq Length
731 317 719 310

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100011641|Ga0070698_1000116416
Length 378
Sequence VAYRTGTFTVPCSARFSAHVSYKHAGNHWTGRHSWGDRSLHSCPPASQTAGLSRHGWQRQVLIRKVMIMRVFVAGGSGVLGRRLVPQLVARGHQVTATTTSAGKLDLLARLGADGVVMDGLDAVSVGEAVAKARPDTIVHEMTGISLTHAGKPDLKHFDRWAVPTIRLRTEGTDHLLAAAEATGVSHFVAQGYANWNGIRQGGWVKTEEDPLDLYEGTAAYTSMAAGRHVEDVVGKAGGAVMRYGGFYGPGATDDQVELVRKRQFPLVGSGAGYASWVHLDDAASATVLAVEQQATGVFNIVDDEPAPASEWLPYLAECAGAKRPMRVPKWLARLLAGEVAVVMMTEGRGFSNAKAKRELGWELRYPSWRQGFKEGMT

Samples

Sample ID Description Type Environment
1 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
2 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
3 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
4 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
5 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
6 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
7 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
8 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
9 2862574272 Streptomyces sp. AcE210 Isolate Nodule
10 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
11 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
12 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
190 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
191 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
202 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0.27
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0.14
Rhizoplane 7.25
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 4.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012270 3300001979 Bacteria 3235
2 JGI24739J22299_10014039 3300001989 Bacteria 2917
3 JGI24737J22298_10011157 3300001990 Bacteria 2948
4 JGI25406J46586_10044253 3300003203 Bacteria 1543
5 rootH1_10008338 3300003316 Bacteria 1562
6 rootH2_10010881 3300003320 Bacteria 3708
7 rootL2_10241102 3300003322 Bacteria 1787
8 JGI25407J50210_10008113 3300003373 Bacteria 2644
9 JGI25407J50210_10009481 3300003373 Bacteria 2467
10 JGI25407J50210_10009581 3300003373 Bacteria 2456
11 Ga0055527_1000005 3300003760 Bacteria 504776
12 Ga0055542_1000006 3300003762 Bacteria 504776
13 Ga0055529_1000013 3300003763 Bacteria 373267
14 Ga0070658_10006366 3300005327 Bacteria 9568
15 Ga0070658_10035358 3300005327 Bacteria 4024
16 Ga0070658_10047682 3300005327 Bacteria 3467
17 Ga0070676_10083492 3300005328 Bacteria 1943
18 Ga0070683_100000483 3300005329 Bacteria 28059
19 Ga0070683_100001497 3300005329 Bacteria 18032
20 Ga0070683_100045577 3300005329 Bacteria 4047
21 Ga0070683_100206948 3300005329 Bacteria 1864
22 Ga0070683_100248637 3300005329 Bacteria 1691
23 Ga0070680_100050335 3300005336 Bacteria 3398
24 Ga0070680_100230814 3300005336 Bacteria 1563
25 Ga0070682_100086291 3300005337 Bacteria 2044
26 Ga0070682_100092529 3300005337 Bacteria 1981
27 Ga0070660_100013235 3300005339 Bacteria 5912
28 Ga0070691_10034860 3300005341 Bacteria 2369
29 Ga0070687_100101115 3300005343 Bacteria 1614
30 Ga0070692_10009217 3300005345 Bacteria 4440
31 Ga0070668_100231051 3300005347 Bacteria 1529
32 Ga0070659_100018755 3300005366 Bacteria 5222
33 Ga0070659_100019569 3300005366 Bacteria 5133
34 Ga0070709_10231385 3300005434 Bacteria 1323
35 Ga0070714_100005972 3300005435 Bacteria 9351
36 Ga0070714_100055035 3300005435 Bacteria 3400
37 Ga0070714_100091827 3300005435 Bacteria 2660
38 Ga0070713_100075395 3300005436 Bacteria 2860
39 Ga0070713_100123406 3300005436 Bacteria 2275
40 Ga0070713_100139987 3300005436 Bacteria 2142
41 Ga0070713_100271189 3300005436 Bacteria 1554
42 Ga0070713_100365114 3300005436 Bacteria 1342
43 Ga0070710_10256032 3300005437 Bacteria 1127
44 Ga0070711_100232449 3300005439 Bacteria 1438
45 Ga0070700_100190595 3300005441 Bacteria 1433
46 Ga0070708_100106514 3300005445 Bacteria 2573
47 Ga0070708_100206136 3300005445 Bacteria 1842
48 Ga0070708_100226358 3300005445 Bacteria 1754
49 Ga0070663_100030931 3300005455 Bacteria 3673
50 Ga0070663_100072161 3300005455 Bacteria 2514
51 Ga0070663_100072486 3300005455 Bacteria 2509
52 Ga0070663_100350266 3300005455 Bacteria 1196
53 Ga0070678_100158562 3300005456 Bacteria 1831
54 Ga0070678_100176928 3300005456 Bacteria 1743
55 Ga0070662_100069452 3300005457 Bacteria 2593
56 Ga0070681_10187426 3300005458 Bacteria 1989
57 Ga0070706_100000176 3300005467 Bacteria 81107
58 Ga0070706_100007256 3300005467 Bacteria 10410
59 Ga0070706_100033263 3300005467 Bacteria 4758
60 Ga0070706_100033523 3300005467 Bacteria 4740
61 Ga0070706_100095491 3300005467 Bacteria 2759
62 Ga0070706_100110998 3300005467 Bacteria 2552
63 Ga0070707_100001211 3300005468 Bacteria 25388
64 Ga0070707_100030035 3300005468 Bacteria 5171
65 Ga0070707_100031127 3300005468 Bacteria 5081
66 Ga0070707_100070307 3300005468 Bacteria 3371
67 Ga0070698_100011641 3300005471 Bacteria 9333
68 Ga0070698_100012039 3300005471 Bacteria 9171
69 Ga0070698_100012398 3300005471 Bacteria 9029
70 Ga0070698_100013437 3300005471 Bacteria 8666
71 Ga0070699_100010740 3300005518 Bacteria 7924
72 Ga0070699_100186402 3300005518 Bacteria 1842
73 Ga0070679_100091501 3300005530 Bacteria 3030
74 Ga0070679_100105047 3300005530 Bacteria 2811
75 Ga0070679_100125024 3300005530 Bacteria 2554
76 Ga0070684_100002110 3300005535 Bacteria 14647
77 Ga0070684_100018621 3300005535 Bacteria 5726
78 Ga0070684_100085979 3300005535 Bacteria 2790
79 Ga0070684_100092191 3300005535 Bacteria 2696
80 Ga0070684_100092854 3300005535 Bacteria 2686
81 Ga0070697_100000837 3300005536 Bacteria 23106
82 Ga0070665_100000957 3300005548 Bacteria 36788
83 Ga0070665_100056718 3300005548 Bacteria 3927
84 Ga0070665_100120691 3300005548 Bacteria 2623
85 Ga0070665_100122462 3300005548 Bacteria 2603
86 Ga0068855_100045343 3300005563 Bacteria 5200
87 Ga0068855_100050902 3300005563 Bacteria 4880
88 Ga0068855_100172695 3300005563 Bacteria 2447
89 Ga0070664_100155883 3300005564 Bacteria 2018
90 Ga0068857_100007737 3300005577 Bacteria 9257
91 Ga0068857_100316238 3300005577 Bacteria 1441
92 Ga0068857_100388624 3300005577 Bacteria 1297
93 Ga0068854_100014763 3300005578 Bacteria 5156
94 Ga0068856_100017299 3300005614 Bacteria 6989
95 Ga0068856_100027547 3300005614 Bacteria 5542
96 Ga0070702_100036899 3300005615 Bacteria 2712
97 Ga0068852_100012963 3300005616 Bacteria 6359
98 Ga0068852_100068154 3300005616 Bacteria 3113
99 Ga0068852_100338677 3300005616 Bacteria 1465
100 Ga0068852_100763942 3300005616 Bacteria 979
101 Ga0068864_100025281 3300005618 Bacteria 5000
102 Ga0068864_100205781 3300005618 Bacteria 1810
103 Ga0068864_100434364 3300005618 Bacteria 1253
104 Ga0068861_100068442 3300005719 Bacteria 2744
105 Ga0068861_100154169 3300005719 Bacteria 1888
106 Ga0068863_100044588 3300005841 Bacteria 4208
107 Ga0068858_100000054 3300005842 Bacteria 119686
108 Ga0068858_100088463 3300005842 Bacteria 2882
109 Ga0068858_100232197 3300005842 Bacteria 1749
110 Ga0081455_10003970 3300005937 Bacteria 16776
111 Ga0081455_10007936 3300005937 Bacteria 11107
112 Ga0081455_10012717 3300005937 Bacteria 8375
113 Ga0081455_10014692 3300005937 Bacteria 7648
114 Ga0081455_10032172 3300005937 Bacteria 4731
115 Ga0081455_10032348 3300005937 Bacteria 4714
116 Ga0081455_10140333 3300005937 Bacteria 1877
117 Ga0081538_10000077 3300005981 Bacteria 93624
118 Ga0081538_10000164 3300005981 Bacteria 70649
119 Ga0081538_10000223 3300005981 Bacteria 63727
120 Ga0081538_10000327 3300005981 Bacteria 54457
121 Ga0081538_10000671 3300005981 Bacteria 37656
122 Ga0081538_10001086 3300005981 Bacteria 28963
123 Ga0081538_10001230 3300005981 Bacteria 26863
124 Ga0081538_10001334 3300005981 Bacteria 25379
125 Ga0081538_10004928 3300005981 Bacteria 12159
126 Ga0081538_10005814 3300005981 Bacteria 10994
127 Ga0081538_10008447 3300005981 Bacteria 8737
128 Ga0081538_10010361 3300005981 Bacteria 7648
129 Ga0081538_10011370 3300005981 Bacteria 7217
130 Ga0081538_10011964 3300005981 Bacteria 6995
131 Ga0081538_10014900 3300005981 Bacteria 6054
132 Ga0081538_10049706 3300005981 Bacteria 2541
133 Ga0081538_10065101 3300005981 Bacteria 2056
134 Ga0081540_1010943 3300005983 Bacteria 6093
135 Ga0081540_1015521 3300005983 Bacteria 4820
136 Ga0081540_1022919 3300005983 Bacteria 3671
137 Ga0081540_1027370 3300005983 Bacteria 3232
138 Ga0081539_10000312 3300005985 Bacteria 108472
139 Ga0081539_10000594 3300005985 Bacteria 73925
140 Ga0081539_10001504 3300005985 Bacteria 39371
141 Ga0081539_10002251 3300005985 Bacteria 28053
142 Ga0081539_10003229 3300005985 Bacteria 20547
143 Ga0081539_10003621 3300005985 Bacteria 18632
144 Ga0081539_10012129 3300005985 Bacteria 6694
145 Ga0081539_10077093 3300005985 Bacteria 1764
146 Ga0070717_10017924 3300006028 Bacteria 5522
147 Ga0070717_10024373 3300006028 Bacteria 4804
148 Ga0070717_10064090 3300006028 Bacteria 3052
149 Ga0070717_10125084 3300006028 Bacteria 2207
150 Ga0070717_10245051 3300006028 Bacteria 1582
151 Ga0070712_100135997 3300006175 Bacteria 1869
152 Ga0075428_100000663 3300006844 Bacteria 35387
153 Ga0075428_100002757 3300006844 Bacteria 19130
154 Ga0075428_100006856 3300006844 Bacteria 12656
155 Ga0075428_100009472 3300006844 Bacteria 10811
156 Ga0075428_100020214 3300006844 Bacteria 7374
157 Ga0075428_100020699 3300006844 Bacteria 7285
158 Ga0075428_100033909 3300006844 Bacteria 5632
159 Ga0075428_100045071 3300006844 Bacteria 4846
160 Ga0075428_100050378 3300006844 Bacteria 4567
161 Ga0075428_100202250 3300006844 Bacteria 2147
162 Ga0075428_100203230 3300006844 Bacteria 2141
163 Ga0075428_100410159 3300006844 Bacteria 1452
164 Ga0075430_100009975 3300006846 Bacteria 8035
165 Ga0075430_100019158 3300006846 Bacteria 5818
166 Ga0075431_100004704 3300006847 Bacteria 13407
167 Ga0075431_100010408 3300006847 Bacteria 9348
168 Ga0075431_100021090 3300006847 Bacteria 6659
169 Ga0075431_100037919 3300006847 Bacteria 4963
170 Ga0075431_100411300 3300006847 Bacteria 1353
171 Ga0075433_10060114 3300006852 Bacteria 3327
172 Ga0075434_100321175 3300006871 Bacteria 1569
173 Ga0075429_100000008 3300006880 Bacteria 86739
174 Ga0075429_100003483 3300006880 Bacteria 13430
175 Ga0075429_100013263 3300006880 Bacteria 7147
176 Ga0075429_100024155 3300006880 Bacteria 5272
177 Ga0075429_100073229 3300006880 Bacteria 2984
178 Ga0068865_100039073 3300006881 Bacteria 3217
179 Ga0068865_100164176 3300006881 Bacteria 1697
180 Ga0105240_10192816 3300009093 Bacteria 2395
181 Ga0111539_10094434 3300009094 Bacteria 3513
182 Ga0111539_10150710 3300009094 Bacteria 2722
183 Ga0111539_10205473 3300009094 Bacteria 2296
184 Ga0111539_10225926 3300009094 Bacteria 2180
185 Ga0111539_10413138 3300009094 Bacteria 1572
186 Ga0105245_10094256 3300009098 Bacteria 2759
187 Ga0105245_10128301 3300009098 Bacteria 2376
188 Ga0105247_10000892 3300009101 Bacteria 22478
189 Ga0105247_10059738 3300009101 Bacteria 2361
190 Ga0114129_10000657 3300009147 Bacteria 43267
191 Ga0114129_10001247 3300009147 Bacteria 33913
192 Ga0114129_10016283 3300009147 Bacteria 10583
193 Ga0114129_10147268 3300009147 Bacteria 3225
194 Ga0114129_10497000 3300009147 Bacteria 1594
195 Ga0105243_10057296 3300009148 Bacteria 3102
196 Ga0105243_10074560 3300009148 Bacteria 2752
197 Ga0105241_10047293 3300009174 Bacteria 3271
198 Ga0105242_10291961 3300009176 Bacteria 1485
199 Ga0105248_10130139 3300009177 Bacteria 2839
200 Ga0105248_10167557 3300009177 Bacteria 2476
201 Ga0105237_10170094 3300009545 Bacteria 2179
202 Ga0105238_10047945 3300009551 Bacteria 4306
203 Ga0105249_10256250 3300009553 Bacteria 1736
204 Ga0105239_10017343 3300010375 Bacteria 7965
205 Ga0105246_10194114 3300011119 Bacteria 1574
206 Ga0105246_10303339 3300011119 Bacteria 1290
207 Ga0157373_10171813 3300013100 Bacteria 1525
208 Ga0157371_10092779 3300013102 Bacteria 2139
209 Ga0157370_10012750 3300013104 Bacteria 8693
210 Ga0157369_10034217 3300013105 Bacteria 5578
211 Ga0157369_10484930 3300013105 Bacteria 1279
212 Ga0157374_10051781 3300013296 Bacteria 3821
213 Ga0157378_10031404 3300013297 Bacteria 4692
214 Ga0163162_10321744 3300013306 Bacteria 1679
215 Ga0157372_10017497 3300013307 Bacteria 7692
216 Ga0157372_10202844 3300013307 Bacteria 2298
217 Ga0157372_10256280 3300013307 Bacteria 2031
218 Ga0157372_10799249 3300013307 Bacteria 1096
219 Ga0157375_10265047 3300013308 Bacteria 1880
220 Ga0163163_10050496 3300014325 Bacteria 4096
221 Ga0157377_10253718 3300014745 Bacteria 1141
222 Ga0157379_10054667 3300014968 Bacteria 3567
223 Ga0163161_10080068 3300017792 Bacteria 2403
224 Ga0213875_10001296 3300021388 Bacteria 16625
225 Ga0224712_10063666 3300022467 Bacteria 1477
226 Ga0209672_100003 3300025228 Bacteria 1560476
227 Ga0209147_101200 3300025229 Bacteria 10460
228 Ga0209148_1000004 3300025254 Bacteria 1844481
229 Ga0209455_1000022 3300025272 Bacteria 688910
230 Ga0207692_10013344 3300025898 Bacteria 3562
231 Ga0207710_10000548 3300025900 Bacteria 22601
232 Ga0207710_10030240 3300025900 Bacteria 2361
233 Ga0207688_10061609 3300025901 Bacteria 2115
234 Ga0207688_10213150 3300025901 Bacteria 1161
235 Ga0207647_10009660 3300025904 Bacteria 6848
236 Ga0207647_10013593 3300025904 Bacteria 5637
237 Ga0207647_10017159 3300025904 Bacteria 4926
238 Ga0207647_10020533 3300025904 Bacteria 4427
239 Ga0207647_10025083 3300025904 Bacteria 3924
240 Ga0207647_10036923 3300025904 Bacteria 3101
241 Ga0207647_10047501 3300025904 Bacteria 2670
242 Ga0207699_10137141 3300025906 Bacteria 1604
243 Ga0207645_10165965 3300025907 Bacteria 1446
244 Ga0207705_10000001 3300025909 Bacteria 2061880
245 Ga0207705_10010070 3300025909 Bacteria 6881
246 Ga0207705_10013985 3300025909 Bacteria 5784
247 Ga0207705_10083798 3300025909 Bacteria 2327
248 Ga0207684_10000494 3300025910 Bacteria 50002
249 Ga0207684_10004954 3300025910 Bacteria 12422
250 Ga0207654_10010796 3300025911 Bacteria 4650
251 Ga0207707_10091731 3300025912 Bacteria 2655
252 Ga0207671_10001058 3300025914 Bacteria 33358
253 Ga0207693_10142821 3300025915 Bacteria 1882
254 Ga0207693_10199392 3300025915 Bacteria 1574
255 Ga0207693_10380138 3300025915 Bacteria 1104
256 Ga0207657_10030888 3300025919 Bacteria 4856
257 Ga0207657_10218357 3300025919 Bacteria 1528
258 Ga0207649_10101944 3300025920 Bacteria 1902
259 Ga0207652_10064266 3300025921 Bacteria 3175
260 Ga0207652_10341150 3300025921 Bacteria 1352
261 Ga0207652_10356150 3300025921 Bacteria 1321
262 Ga0207646_10003853 3300025922 Bacteria 16660
263 Ga0207646_10005806 3300025922 Bacteria 12920
264 Ga0207646_10062241 3300025922 Bacteria 3331
265 Ga0207646_10123758 3300025922 Bacteria 2324
266 Ga0207694_10105587 3300025924 Bacteria 2236
267 Ga0207687_10003716 3300025927 Bacteria 10271
268 Ga0207700_10078916 3300025928 Bacteria 2562
269 Ga0207700_10187479 3300025928 Bacteria 1736
270 Ga0207700_10316264 3300025928 Bacteria 1352
271 Ga0207664_10002832 3300025929 Bacteria 11519
272 Ga0207664_10071483 3300025929 Bacteria 2795
273 Ga0207664_10078846 3300025929 Bacteria 2672
274 Ga0207690_10132441 3300025932 Bacteria 1826
275 Ga0207690_10322715 3300025932 Bacteria 1214
276 Ga0207706_10049304 3300025933 Bacteria 3721
277 Ga0207686_10080137 3300025934 Bacteria 2128
278 Ga0207686_10270712 3300025934 Bacteria 1249
279 Ga0207709_10052281 3300025935 Bacteria 2508
280 Ga0207669_10266573 3300025937 Bacteria 1284
281 Ga0207691_10142536 3300025940 Bacteria 2111
282 Ga0207711_10088721 3300025941 Bacteria 2716
283 Ga0207661_10000475 3300025944 Bacteria 25973
284 Ga0207661_10023816 3300025944 Bacteria 4631
285 Ga0207661_10159304 3300025944 Bacteria 1957
286 Ga0207661_10353887 3300025944 Bacteria 1325
287 Ga0207679_10081933 3300025945 Bacteria 2469
288 Ga0207667_10015499 3300025949 Bacteria 8653
289 Ga0207667_10321241 3300025949 Bacteria 1581
290 Ga0207712_10172320 3300025961 Bacteria 1693
291 Ga0207712_10174263 3300025961 Bacteria 1684
292 Ga0207668_10231882 3300025972 Bacteria 1489
293 Ga0207703_10000002 3300026035 Bacteria 600711
294 Ga0207703_10262580 3300026035 Bacteria 1561
295 Ga0207639_10124702 3300026041 Bacteria 2122
296 Ga0207678_10011795 3300026067 Bacteria 7674
297 Ga0207678_10031474 3300026067 Bacteria 4628
298 Ga0207678_10062415 3300026067 Bacteria 3203
299 Ga0207708_10102651 3300026075 Bacteria 2214
300 Ga0207702_10093931 3300026078 Bacteria 2632
301 Ga0207702_10131341 3300026078 Bacteria 2254
302 Ga0207702_10313258 3300026078 Bacteria 1493
303 Ga0207702_10327051 3300026078 Bacteria 1461
304 Ga0207676_10010726 3300026095 Bacteria 6533
305 Ga0207676_10062133 3300026095 Bacteria 2961
306 Ga0207674_10013524 3300026116 Bacteria 9049
307 Ga0207674_10088825 3300026116 Bacteria 3083
308 Ga0207674_10270286 3300026116 Bacteria 1647
309 Ga0207674_10417324 3300026116 Bacteria 1297
310 Ga0207675_100030582 3300026118 Bacteria 5016
311 Ga0207675_100311650 3300026118 Bacteria 1535
312 Ga0207683_10279658 3300026121 Bacteria 1525
313 Ga0207698_10106707 3300026142 Bacteria 2336
314 Ga0207698_10484354 3300026142 Bacteria 1201
315 Ga0207428_10005790 3300027907 Bacteria 11470
316 Ga0268266_10009722 3300028379 Bacteria 8454
317 Ga0268264_10420731 3300028381 Unclassified 1288
318 Ga0307517_10083258 3300028786 Bacteria 2706
319 Ga0307517_10092861 3300028786 Bacteria 2452
320 Ga0307517_10175185 3300028786 Bacteria 1399
321 Ga0307515_10019662 3300028794 Bacteria 12128
322 Ga0307515_10116065 3300028794 Bacteria 3077
323 Ga0307512_10017852 3300030522 Bacteria 6495
324 Ga0307408_100002184 3300031548 Bacteria 13990
325 Ga0307408_100022366 3300031548 Bacteria 4295
326 Ga0307408_100027020 3300031548 Bacteria 3951
327 Ga0307408_100079291 3300031548 Bacteria 2450
328 Ga0307408_100234881 3300031548 Bacteria 1504
329 Ga0307408_100249427 3300031548 Bacteria 1463
330 Ga0307408_100381087 3300031548 Bacteria 1206
331 Ga0310117_100046 3300031592 Bacteria 5080
332 Ga0307508_10011061 3300031616 Bacteria 8251
333 Ga0307514_10010571 3300031649 Bacteria 7713
334 Ga0307516_10142314 3300031730 Bacteria 2166
335 Ga0307405_10000410 3300031731 Bacteria 16136
336 Ga0307405_10027949 3300031731 Bacteria 3278
337 Ga0307405_10032075 3300031731 Bacteria 3101
338 Ga0307405_10068998 3300031731 Bacteria 2265
339 Ga0307405_10071120 3300031731 Bacteria 2237
340 Ga0307405_10086361 3300031731 Bacteria 2065
341 Ga0307405_10091983 3300031731 Bacteria 2011
342 Ga0307405_10197733 3300031731 Bacteria 1457
343 Ga0307413_10036731 3300031824 Bacteria 2823
344 Ga0307413_10094623 3300031824 Bacteria 1956
345 Ga0307413_10208155 3300031824 Bacteria 1418
346 Ga0307518_10277984 3300031838 Bacteria 1039
347 Ga0307410_10000900 3300031852 Bacteria 12700
348 Ga0307410_10029720 3300031852 Bacteria 3483
349 Ga0307410_10196868 3300031852 Bacteria 1536
350 Ga0307410_10344409 3300031852 Bacteria 1189
351 Ga0326468_10000094 3300031889 Bacteria 7752
352 Ga0307406_10000850 3300031901 Bacteria 17184
353 Ga0307406_10006925 3300031901 Bacteria 6279
354 Ga0307406_10154755 3300031901 Bacteria 1640
355 Ga0307406_10470821 3300031901 Bacteria 1012
356 Ga0307407_10000978 3300031903 Bacteria 9776
357 Ga0307407_10024342 3300031903 Bacteria 3173
358 Ga0307407_10026227 3300031903 Bacteria 3082
359 Ga0307407_10151590 3300031903 Bacteria 1507
360 Ga0307407_10232069 3300031903 Bacteria 1254
361 Ga0307412_10005158 3300031911 Bacteria 7319
362 Ga0307412_10081110 3300031911 Bacteria 2243
363 Ga0307412_10093944 3300031911 Bacteria 2105
364 Ga0307412_10328172 3300031911 Bacteria 1220
365 Ga0307409_100003158 3300031995 Bacteria 8857
366 Ga0307409_100003924 3300031995 Bacteria 8233
367 Ga0307409_100018892 3300031995 Bacteria 4650
368 Ga0307409_100093825 3300031995 Bacteria 2467
369 Ga0307409_100097594 3300031995 Bacteria 2427
370 Ga0307409_100103712 3300031995 Bacteria 2366
371 Ga0307409_100139338 3300031995 Bacteria 2087
372 Ga0307409_100339340 3300031995 Bacteria 1413
373 Ga0307416_100000687 3300032002 Bacteria 17613
374 Ga0307416_100001992 3300032002 Bacteria 11456
375 Ga0307416_100009781 3300032002 Bacteria 6300
376 Ga0307416_100422656 3300032002 Bacteria 1377
377 Ga0307416_100532060 3300032002 Bacteria 1245
378 Ga0307414_10001230 3300032004 Bacteria 13197
379 Ga0307414_10005150 3300032004 Bacteria 7170
380 Ga0307414_10011793 3300032004 Bacteria 5143
381 Ga0307414_10266033 3300032004 Bacteria 1433
382 Ga0307414_10369661 3300032004 Bacteria 1236
383 Ga0307414_10513938 3300032004 Bacteria 1062
384 Ga0307411_10104095 3300032005 Bacteria 2015
385 Ga0307415_100001567 3300032126 Bacteria 11014
386 Ga0307415_100002406 3300032126 Bacteria 9330
387 Ga0307415_100005752 3300032126 Bacteria 6613
388 Ga0307415_100019187 3300032126 Bacteria 4146
389 Ga0307415_100040597 3300032126 Bacteria 3084
390 Ga0307415_100055788 3300032126 Bacteria 2705
391 Ga0307415_100060812 3300032126 Bacteria 2612
392 Ga0307415_100077660 3300032126 Bacteria 2358
393 Ga0307415_100112081 3300032126 Bacteria 2026
394 Ga0307415_100269770 3300032126 Bacteria 1393
395 Ga0307510_10206310 3300033180 Bacteria 1493
396 Ga0373951_0000031 3300035091 Bacteria 55817
397 Ga0373951_0000049 3300035091 Bacteria 47611
398 Ga0373947_0209264 3300035725 Bacteria 1279
399 Ga0373937_0215536 3300036401 Bacteria 1807
400 Ga0373925_0000041 3300037068 Bacteria 137281
401 Ga0395899_0057477 3300037312 Bacteria 2872
402 Ga0395900_0005888 3300037418 Bacteria 12803
403 Ga0395900_0017136 3300037418 Bacteria 7395
404 Ga0395900_0303734 3300037418 Bacteria 1581
405 Ga0395898_0000481 3300037466 Bacteria 79375
406 Ga0395898_0020662 3300037466 Bacteria 6685
407 Ga0395898_0133973 3300037466 Bacteria 2372
408 Ga0395898_0271446 3300037466 Bacteria 1618
409 Ga0395898_0518419 3300037466 Bacteria 1133
410 Ga0395905_0067547 3300037471 Bacteria 3349
411 Ga0395905_0103983 3300037471 Bacteria 2666
412 Ga0436364_0553737 3300037853 Bacteria 30167
413 Ga0436364_1441645 3300037853 Bacteria 3651
414 Ga0395901_0019372 3300038443 Bacteria 6957
415 Ga0395901_0022357 3300038443 Bacteria 6480
416 Ga0395901_0077168 3300038443 Bacteria 3477
417 Ga0395901_0098727 3300038443 Bacteria 3062
418 Ga0395901_0327872 3300038443 Bacteria 1583
419 Ga0395901_0435419 3300038443 Bacteria 1343
420 Ga0436362_0515864 3300039453 Bacteria 1985
421 Ga0436362_1052748 3300039453 Bacteria 1171
422 Ga0451787_028479 3300041441 Bacteria 1411
423 Ga0451789_0062521 3300041443 Bacteria 2317
424 Ga0451789_0531975 3300041443 Bacteria 3075
425 Ga0451791_1784313 3300041451 Bacteria 8012
426 Ga0451793_0091432 3300041452 Bacteria 15713
427 Ga0451795_1242366 3300041456 Bacteria 3241
428 Ga0451800_0883887 3300041459 Bacteria 1411
429 Ga0451802_0281666 3300041460 Bacteria 3385
430 Ga0451841_0340205 3300041498 Bacteria 1368
431 Ga0451853_0826964 3300041512 Bacteria 12719
432 Ga0439448_0007026 3300042005 Bacteria 3251
433 Ga0439450_044169 3300042008 Bacteria 1043
434 Ga0439455_0061535 3300042012 Bacteria 996
435 Ga0439457_022707 3300042014 Bacteria 1389
436 Ga0439463_009684 3300042016 Bacteria 2369
437 Ga0439464_0013545 3300042439 Bacteria 2185
438 Ga0466969_0004700 3300044656 Bacteria 7274
439 Ga0466972_0155140 3300044658 Bacteria 1076
440 Ga0466965_0065953 3300044683 Bacteria 1814
441 Ga0466966_0007054 3300044684 Bacteria 7443
442 Ga0466961_0047081 3300044693 Bacteria 2758
443 Ga0466961_0082203 3300044693 Bacteria 2038
444 Ga0466963_0034080 3300044694 Bacteria 3312
445 Ga0466963_0039612 3300044694 Bacteria 3087
446 Ga0466963_0058918 3300044694 Bacteria 2562
447 Ga0466963_0102314 3300044694 Bacteria 1962
448 Ga0466963_0191427 3300044694 Bacteria 1429
449 Ga0466971_0036722 3300044719 Bacteria 2197
450 Ga0466970_0083405 3300044765 Bacteria 1729
451 Ga0466957_0168848 3300044842 Bacteria 1424
452 Ga0466957_0269968 3300044842 Bacteria 1136
453 Ga0466957_0273791 3300044842 Bacteria 1128
454 Ga0466960_0010294 3300044901 Bacteria 3881
455 Ga0466960_0028942 3300044901 Bacteria 2539
456 Ga0466960_0045165 3300044901 Bacteria 2103
457 Ga0466959_0091803 3300045049 Bacteria 2180
458 Ga0466958_0069820 3300045836 Bacteria 2149
459 Ga0466967_0005997 3300045976 Bacteria 8534
460 Ga0466967_0062754 3300045976 Bacteria 3299
461 Ga0466967_0095501 3300045976 Bacteria 2710
462 Ga0466967_0149766 3300045976 Bacteria 2180
463 Ga0466967_0208951 3300045976 Bacteria 1851
464 Ga0466967_0244389 3300045976 Bacteria 1713
465 Ga0466967_0278579 3300045976 Bacteria 1604
466 Ga0466967_0279188 3300045976 Bacteria 1602
467 Ga0466967_0293659 3300045976 Bacteria 1562
468 Ga0466967_0368728 3300045976 Bacteria 1392
469 Ga0466967_0558288 3300045976 Bacteria 1127
470 Ga0466967_0650416 3300045976 Bacteria 1042
471 Ga0495617_012949 3300046452 Bacteria 2842
472 Ga0495592_0011720 3300046454 Bacteria 6639
473 Ga0495603_0016363 3300046455 Bacteria 4486
474 Ga0495603_0041322 3300046455 Bacteria 2758
475 Ga0495603_0066074 3300046455 Bacteria 2130
476 Ga0495590_0045855 3300046457 Bacteria 1525
477 Ga0495629_0007601 3300046459 Bacteria 7984
478 Ga0495629_0010003 3300046459 Bacteria 6921
479 Ga0495629_0019118 3300046459 Bacteria 4898
480 Ga0495629_0074170 3300046459 Bacteria 2376
481 Ga0495629_0103496 3300046459 Bacteria 1986
482 Ga0495629_0213070 3300046459 Bacteria 1334
483 Ga0495641_0119509 3300046461 Bacteria 1176
484 Ga0495651_0078500 3300046462 Bacteria 2497
485 Ga0495651_0218541 3300046462 Bacteria 1321
486 Ga0495662_0000568 3300046476 Bacteria 16984
487 Ga0495662_0001073 3300046476 Bacteria 13436
488 Ga0495594_0035998 3300046499 Bacteria 2698
489 Ga0495594_0058825 3300046499 Bacteria 2124
490 Ga0495594_0071917 3300046499 Bacteria 1924
491 Ga0495594_0152077 3300046499 Bacteria 1314
492 Ga0495610_0034663 3300046512 Bacteria 2598
493 Ga0495618_0121259 3300046514 Bacteria 1675
494 Ga0495628_0063601 3300046516 Bacteria 2891
495 Ga0495628_0345109 3300046516 Bacteria 1095
496 Ga0495630_0052990 3300046517 Bacteria 3037
497 Ga0495632_0023301 3300046519 Bacteria 3308
498 Ga0495652_0031272 3300046529 Bacteria 4662
499 Ga0495652_0196865 3300046529 Bacteria 1533
500 Ga0495665_0172492 3300046531 Bacteria 1126
501 Ga0495640_0017011 3300046533 Bacteria 5427
502 Ga0495640_0032572 3300046533 Bacteria 3712
503 Ga0495640_0172068 3300046533 Bacteria 1383
504 Ga0495609_0087478 3300046538 Bacteria 1357
505 Ga0495597_0059807 3300046542 Bacteria 1663
506 Ga0495622_0068081 3300046557 Bacteria 1644
507 Ga0495667_0057926 3300046559 Bacteria 2546
508 Ga0495634_0047173 3300046642 Bacteria 2904
509 Ga0495657_0000588 3300046675 Bacteria 33293
510 Ga0495657_0022323 3300046675 Bacteria 4535
511 Ga0495613_0001976 3300046689 Bacteria 15561
512 Ga0495613_0010586 3300046689 Bacteria 6840
513 Ga0495613_0079441 3300046689 Bacteria 2385
514 Ga0495613_0083380 3300046689 Bacteria 2321
515 Ga0495613_0167846 3300046689 Bacteria 1559
516 Ga0495624_0013797 3300046690 Bacteria 5502
517 Ga0495624_0074558 3300046690 Bacteria 2108
518 Ga0495624_0109116 3300046690 Bacteria 1702
519 Ga0495624_0137680 3300046690 Bacteria 1496
520 Ga0495649_0031689 3300046694 Bacteria 2914
521 Ga0495660_0060276 3300046810 Bacteria 2039
522 Ga0495581_0071385 3300047315 Bacteria 2009
523 Ga0495581_0092819 3300047315 Bacteria 1752
524 Ga0495604_0012907 3300047317 Bacteria 6655
525 Ga0495604_0053457 3300047317 Bacteria 3121
526 Ga0495636_0006927 3300047318 Bacteria 4457
527 Ga0495674_0006056 3300047319 Bacteria 11606
528 Ga0495674_0193631 3300047319 Bacteria 1689
529 Ga0495674_0292154 3300047319 Bacteria 1333
530 Ga0495674_0440769 3300047319 Bacteria 1048
531 Ga0495676_0001890 3300047321 Bacteria 18373
532 Ga0495676_0023565 3300047321 Bacteria 5340
533 Ga0495676_0051363 3300047321 Bacteria 3299
534 Ga0495676_0052583 3300047321 Bacteria 3250
535 Ga0495676_0180782 3300047321 Bacteria 1478
536 Ga0495676_0364564 3300047321 Bacteria 964
537 Ga0495680_0160065 3300047322 Unclassified 1635
538 Ga0495687_001586 3300047443 Bacteria 20547
539 Ga0495687_005483 3300047443 Bacteria 8065
540 Ga0495687_020854 3300047443 Bacteria 3186
541 Ga0495687_077493 3300047443 Bacteria 1312
542 Ga0495687_104949 3300047443 Bacteria 1051
543 Ga0495675_0010945 3300047444 Bacteria 5684
544 Ga0495685_010796 3300047447 Bacteria 3069
545 Ga0495593_0002108 3300047673 Bacteria 11883
546 Ga0495593_0044644 3300047673 Bacteria 2369
547 Ga0495593_0191395 3300047673 Bacteria 1029
548 Ga0495602_0121051 3300048088 Bacteria 2106
549 Ga0495614_0008434 3300048089 Bacteria 4582
550 Ga0495614_0021167 3300048089 Bacteria 2810
551 Ga0495614_0027613 3300048089 Bacteria 2447
552 Ga0496100_0006953 3300048903 Bacteria 6202
553 Ga0496101_0039771 3300048904 Bacteria 3346
554 Ga0496101_0528235 3300048904 Bacteria 933
555 Ga0496102_0002512 3300048905 Bacteria 15653
556 Ga0496104_0000004 3300048907 Bacteria 641830
557 Ga0496104_0000441 3300048907 Bacteria 36043
558 Ga0496104_0009109 3300048907 Bacteria 8827
559 Ga0496104_0071151 3300048907 Bacteria 3307
560 Ga0496104_0303730 3300048907 Bacteria 1508
561 Ga0496105_0000001 3300048908 Bacteria 1328178
562 Ga0496105_0003381 3300048908 Bacteria 11797
563 Ga0496105_0005310 3300048908 Bacteria 9766
564 Ga0496105_0100261 3300048908 Bacteria 2392
565 Ga0496105_0466508 3300048908 Unclassified 995
566 Ga0496106_0037840 3300048909 Bacteria 3610
567 Ga0496107_0478287 3300048910 Bacteria 924
568 Ga0496108_0000748 3300048911 Bacteria 25330
569 Ga0496108_0384146 3300048911 Bacteria 1226
570 Ga0496109_0001743 3300048912 Bacteria 18151
571 Ga0496109_0119726 3300048912 Bacteria 2452
572 Ga0496109_0175198 3300048912 Bacteria 2013
573 Ga0496109_0180246 3300048912 Bacteria 1984
574 Ga0496109_0239644 3300048912 Bacteria 1707
575 Ga0496110_0003033 3300048913 Bacteria 12739
576 Ga0496111_0001177 3300048914 Bacteria 14549
577 Ga0496111_0013312 3300048914 Bacteria 5594
578 Ga0496112_0020363 3300048915 Bacteria 6287
579 Ga0496112_0025278 3300048915 Bacteria 5701
580 Ga0496112_0029713 3300048915 Bacteria 5288
581 Ga0496112_0059212 3300048915 Bacteria 3773
582 Ga0496112_0076561 3300048915 Bacteria 3309
583 Ga0496112_0078829 3300048915 Bacteria 3257
584 Ga0496112_0323332 3300048915 Bacteria 1487
585 Ga0496113_0039585 3300048916 Bacteria 3470
586 Ga0496113_0055968 3300048916 Bacteria 2959
587 Ga0496113_0106014 3300048916 Bacteria 2183
588 Ga0496113_0188040 3300048916 Bacteria 1639
589 Ga0496114_0101621 3300048917 Bacteria 2455
590 Ga0496114_0147469 3300048917 Bacteria 2040
591 Ga0496114_0232122 3300048917 Bacteria 1621
592 Ga0496114_0322141 3300048917 Bacteria 1366
593 Ga0496115_0098511 3300048918 Bacteria 2394
594 Ga0496115_0172439 3300048918 Bacteria 1789
595 Ga0496115_0210563 3300048918 Bacteria 1606
596 Ga0496115_0287239 3300048918 Bacteria 1350
597 Ga0496119_0006668 3300048922 Bacteria 10617
598 Ga0496121_0005940 3300048924 Bacteria 15443
599 Ga0496126_0031840 3300048929 Bacteria 4976
600 Ga0496126_0200014 3300048929 Bacteria 1688
601 Ga0501031_0003764 3300049568 Bacteria 9755
602 Ga0501032_0004275 3300049569 Bacteria 10782
603 Ga0501033_0016260 3300049570 Bacteria 5635
604 Ga0501034_0032491 3300049571 Bacteria 5298
605 Ga0501034_0291088 3300049571 Bacteria 1571
606 Ga0501036_0004014 3300049572 Bacteria 11838
607 Ga0501036_0178811 3300049572 Bacteria 1786
608 Ga0501037_0000877 3300049573 Bacteria 22482
609 Ga0501038_0006616 3300049574 Bacteria 10718
610 Ga0501039_0046069 3300049575 Bacteria 3369
611 Ga0501039_0084294 3300049575 Bacteria 2475
612 Ga0501039_0205060 3300049575 Bacteria 1550
613 Ga0501039_0279409 3300049575 Bacteria 1312
614 Ga0501040_0010811 3300049576 Bacteria 5965
615 Ga0501040_0031064 3300049576 Bacteria 3609
616 Ga0501041_0095430 3300049577 Bacteria 1838
617 Ga0501041_0181299 3300049577 Bacteria 1318
618 Ga0501043_0001649 3300049579 Bacteria 19380
619 Ga0501043_0226003 3300049579 Bacteria 1447
620 Ga0501046_0003745 3300049580 Bacteria 13920
621 Ga0501046_0030742 3300049580 Bacteria 4357
622 Ga0501047_0004742 3300049581 Bacteria 12787
623 Ga0501047_0017565 3300049581 Bacteria 6855
624 Ga0501047_0026531 3300049581 Bacteria 5575
625 Ga0501047_0030159 3300049581 Bacteria 5229
626 Ga0501047_0055403 3300049581 Bacteria 3835
627 Ga0501047_0062892 3300049581 Bacteria 3580
628 Ga0501047_0099811 3300049581 Bacteria 2782
629 Ga0501048_0002977 3300049582 Bacteria 12929
630 Ga0501048_0253126 3300049582 Bacteria 1251
631 Ga0501067_0001377 3300049583 Bacteria 13174
632 Ga0501067_0005852 3300049583 Bacteria 6818
633 Ga0501068_0204239 3300049584 Bacteria 1253
634 Ga0501069_0116644 3300049585 Bacteria 1523
635 Ga0501070_0004792 3300049586 Bacteria 11571
636 Ga0501070_0023946 3300049586 Bacteria 5117
637 Ga0501070_0041857 3300049586 Bacteria 3815
638 Ga0501070_0060774 3300049586 Bacteria 3132
639 Ga0501071_0005296 3300049587 Bacteria 8273
640 Ga0501071_0031462 3300049587 Bacteria 3762
641 Ga0501071_0260904 3300049587 Bacteria 1309
642 Ga0501072_0008248 3300049588 Bacteria 7913
643 Ga0501072_0015071 3300049588 Bacteria 5929
644 Ga0501072_0154762 3300049588 Bacteria 1828
645 Ga0501072_0281554 3300049588 Bacteria 1323
646 Ga0501073_0130822 3300049589 Bacteria 1739
647 Ga0501073_0144561 3300049589 Bacteria 1648
648 Ga0501074_0004185 3300049590 Bacteria 10311
649 Ga0501074_0015924 3300049590 Bacteria 5468
650 Ga0501074_0016792 3300049590 Bacteria 5311
651 Ga0501074_0056073 3300049590 Bacteria 2839
652 Ga0501075_0067090 3300049591 Bacteria 2709
653 Ga0501075_0181821 3300049591 Bacteria 1604
654 Ga0501076_0011933 3300049592 Bacteria 6489
655 Ga0501076_0148716 3300049592 Bacteria 1905
656 Ga0501076_0203831 3300049592 Bacteria 1616
657 Ga0501076_0335443 3300049592 Bacteria 1241
658 Ga0501076_0418397 3300049592 Bacteria 1102
659 Ga0501077_0005792 3300049593 Bacteria 7529
660 Ga0501077_0015350 3300049593 Bacteria 4822
661 Ga0501079_0011050 3300049741 Bacteria 6884
662 Ga0501079_0023680 3300049741 Bacteria 4711
663 Ga0501079_0059357 3300049741 Bacteria 2951
664 Ga0501079_0236770 3300049741 Bacteria 1426
665 Ga0501080_0000857 3300049742 Bacteria 24883
666 Ga0501080_0007636 3300049742 Bacteria 9779
667 Ga0501083_0010270 3300049744 Bacteria 6597
668 Ga0501083_0089782 3300049744 Bacteria 2030
669 Ga0501083_0097650 3300049744 Bacteria 1938
670 Ga0501083_0220825 3300049744 Bacteria 1235
671 Ga0501083_0221694 3300049744 Bacteria 1232
672 Ga0501035_0002421 3300049822 Bacteria 18251
673 Ga0501044_0001494 3300049823 Bacteria 27388
674 Ga0501044_0004920 3300049823 Bacteria 14935
675 Ga0501044_0027151 3300049823 Bacteria 6055
676 Ga0501044_0199338 3300049823 Bacteria 1961
677 Ga0501045_0025753 3300049824 Bacteria 4229
678 Ga0501045_0050324 3300049824 Bacteria 3040
679 Ga0501045_0217544 3300049824 Bacteria 1423
680 nmdc:mga05p37_109_c1 3300050507 Bacteria 74571
681 nmdc:mga05p37_22243_c1 3300050507 Bacteria 7687
682 nmdc:mga05p37_284166_c1 3300050507 Bacteria 1972
683 nmdc:mga05p37_3308_c1 3300050507 Bacteria 18807
684 nmdc:mga05p37_404903_c1 3300050507 Bacteria 1592
685 nmdc:mga09592_19572_c1 3300050508 Bacteria 5559
686 nmdc:mga09592_198255_c1 3300050508 Bacteria 1738
687 nmdc:mga09592_31_c1 3300050508 Bacteria 79922
688 nmdc:mga09592_32514_c1 3300050508 Bacteria 4349
689 nmdc:mga09592_56963_c1 3300050508 Bacteria 3303
690 nmdc:mga09592_74448_c1 3300050508 Bacteria 2885
691 nmdc:mga09592_754_c1 3300050508 Bacteria 24849
692 nmdc:mga09592_86710_c1 3300050508 Bacteria 2672
693 nmdc:mga0qj67_43_c1 3300050509 Bacteria 88150
694 nmdc:mga0qj67_49457_c1 3300050509 Bacteria 3323
695 nmdc:mga0qj67_52075_c1 3300050509 Bacteria 3239
696 nmdc:mga0qj67_8184_c1 3300050509 Bacteria 7750
697 nmdc:mga06r32_22005_c1 3300050510 Bacteria 5889
698 nmdc:mga06r32_3193_c1 3300050510 Bacteria 14680
699 nmdc:mga06r32_356103_c1 3300050510 Bacteria 1448
700 nmdc:mga06r32_430968_c1 3300050510 Bacteria 1299
701 nmdc:mga06r32_57_c2 3300050510 Bacteria 51506
702 nmdc:mga06r32_58976_c1 3300050510 Bacteria 3690
703 nmdc:mga06r32_8007_c1 3300050510 Bacteria 9502
704 nmdc:mga08y16_210584_c1 3300050511 Bacteria 2013
705 nmdc:mga08y16_394399_c1 3300050511 Bacteria 1417
706 nmdc:mga08y16_40272_c1 3300050511 Bacteria 4898
707 nmdc:mga0n895_324722_c1 3300050512 Bacteria 1559
708 nmdc:mga0a205_8359_c1 3300050515 Bacteria 7953
709 Ga0495601_0042765 3300053077 Bacteria 2844
710 Ga0495619_0087798 3300053085 Bacteria 2103
711 Ga0495619_0361105 3300053085 Bacteria 1004
712 Ga0500641_0053055 3300053096 Bacteria 1673
713 Ga0501084_0076125 3300054114 Bacteria 2812
714 Ga0501084_0110505 3300054114 Bacteria 2309
715 Ga0501082_0034173 3300060353 Bacteria 4386
716 Ga0501082_0200449 3300060353 Bacteria 1736
717 Ga0501082_0508298 3300060353 Bacteria 1053
718 Ga0530510_0110129 3300061734 Bacteria 2017
719 Ga0530510_0381888 3300061734 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0466508 Ga0496105_0466508_170_970 245
2 3300047319 Ga0495674_0440769 Ga0495674_0440769_12_758 248
3 3300047322 Ga0495680_0160065 Ga0495680_0160065_271_1074 253
4 3300031548 Ga0307408_100027020 Ga0307408_1000270202 255
5 3300031903 Ga0307407_10026227 Ga0307407_100262274 255
6 3300032004 Ga0307414_10369661 Ga0307414_103696611 255
7 3300039453 Ga0436362_1052748 Ga0436362_1052748_60_851 255
8 3300046457 Ga0495590_0045855 Ga0495590_0045855_732_1499 255
9 3300048910 Ga0496107_0478287 Ga0496107_0478287_28_798 255
10 3300049575 Ga0501039_0205060 Ga0501039_0205060_712_1539 257
11 3300047321 Ga0495676_0364564 Ga0495676_0364564_28_828 258
12 3300013307 Ga0157372_10017497 Ga0157372_100174976 260
13 3300005329 Ga0070683_100206948 Ga0070683_1002069481 265
14 3300009177 Ga0105248_10167557 Ga0105248_101675573 265
15 3300014325 Ga0163163_10050496 Ga0163163_100504962 265
16 3300025944 Ga0207661_10353887 Ga0207661_103538871 265
17 3300048915 Ga0496112_0078829 Ga0496112_0078829_1360_2280 265
18 3300048916 Ga0496113_0039585 Ga0496113_0039585_1540_2460 265
19 3300044901 Ga0466960_0028942 Ga0466960_0028942_1629_2441 267
20 3300045976 Ga0466967_0293659 Ga0466967_0293659_736_1542 268
21 3300009094 Ga0111539_10413138 Ga0111539_104131383 270
22 3300005985 Ga0081539_10003621 Ga0081539_100036216 272
23 3300048904 Ga0496101_0528235 Ga0496101_0528235_17_862 273
24 3300039453 Ga0436362_0515864 Ga0436362_0515864_719_1567 274
25 3300041498 Ga0451841_0340205 Ga0451841_0340205_464_1333 282
26 3300046459 Ga0495629_0074170 Ga0495629_0074170_165_1217 283
27 3300041441 Ga0451787_028479 Ga0451787_028479_505_1362 285
28 3300041443 Ga0451789_0062521 Ga0451789_0062521_1422_2279 285
29 3300003316 rootH1_10008338 rootH1_100083382 286
30 3300005455 Ga0070663_100350266 Ga0070663_1003502661 288
31 3300009176 Ga0105242_10291961 Ga0105242_102919612 288
32 3300046531 Ga0495665_0172492 Ga0495665_0172492_29_895 288
33 3300046542 Ga0495597_0059807 Ga0495597_0059807_34_900 288
34 3300042016 Ga0439463_009684 Ga0439463_009684_27_896 289
35 3300046462 Ga0495651_0218541 Ga0495651_0218541_162_1079 289
36 3300050509 nmdc:mga0qj67_49457_c1 nmdc:mga0qj67_49457_c1_369_1280 289
37 3300005985 Ga0081539_10003229 Ga0081539_1000322918 290
38 3300009094 Ga0111539_10225926 Ga0111539_102259262 290
39 3300037466 Ga0395898_0271446 Ga0395898_0271446_593_1492 291
40 3300046461 Ga0495641_0119509 Ga0495641_0119509_171_1085 291
41 3300047673 Ga0495593_0191395 Ga0495593_0191395_56_970 291
42 3300005456 Ga0070678_100176928 Ga0070678_1001769282 292
43 3300006028 Ga0070717_10064090 Ga0070717_100640902 292
44 3300026121 Ga0207683_10279658 Ga0207683_102796582 292
45 3300038443 Ga0395901_0327872 Ga0395901_0327872_127_1065 292
46 3300005981 Ga0081538_10001334 Ga0081538_1000133426 293
47 3300031911 Ga0307412_10093944 Ga0307412_100939442 293
48 3300005471 Ga0070698_100013437 Ga0070698_10001343711 294
49 3300009098 Ga0105245_10094256 Ga0105245_100942562 294
50 3300049572 Ga0501036_0178811 Ga0501036_0178811_556_1488 294
51 3300049576 Ga0501040_0031064 Ga0501040_0031064_1165_2097 294
52 3300049577 Ga0501041_0181299 Ga0501041_0181299_320_1252 294
53 3300049579 Ga0501043_0226003 Ga0501043_0226003_64_996 294
54 3300049591 Ga0501075_0067090 Ga0501075_0067090_913_1845 294
55 3300049592 Ga0501076_0011933 Ga0501076_0011933_5489_6421 294
56 3300049741 Ga0501079_0011050 Ga0501079_0011050_242_1174 294
57 3300049742 Ga0501080_0007636 Ga0501080_0007636_2578_3510 294
58 3300049744 Ga0501083_0097650 Ga0501083_0097650_344_1276 294
59 3300054114 Ga0501084_0076125 Ga0501084_0076125_1597_2529 294
60 3300060353 Ga0501082_0034173 Ga0501082_0034173_72_1004 294
61 3300005467 Ga0070706_100007256 Ga0070706_1000072562 295
62 3300006028 Ga0070717_10017924 Ga0070717_100179243 295
63 3300006844 Ga0075428_100009472 Ga0075428_10000947214 295
64 3300006844 Ga0075428_100203230 Ga0075428_1002032304 295
65 3300006847 Ga0075431_100037919 Ga0075431_1000379194 295
66 3300006880 Ga0075429_100000008 Ga0075429_10000000878 295
67 3300009147 Ga0114129_10001247 Ga0114129_1000124732 295
68 3300010375 Ga0105239_10017343 Ga0105239_100173439 295
69 3300013100 Ga0157373_10171813 Ga0157373_101718131 295
70 3300013307 Ga0157372_10799249 Ga0157372_107992491 295
71 3300014745 Ga0157377_10253718 Ga0157377_102537181 295
72 3300025910 Ga0207684_10004954 Ga0207684_100049542 295
73 3300025915 Ga0207693_10380138 Ga0207693_103801381 295
74 3300025940 Ga0207691_10142536 Ga0207691_101425361 295
75 3300046459 Ga0495629_0213070 Ga0495629_0213070_316_1245 295
76 3300049577 Ga0501041_0095430 Ga0501041_0095430_585_1532 295
77 3300049741 Ga0501079_0059357 Ga0501079_0059357_525_1472 295
78 3300050507 nmdc:mga05p37_109_c1 nmdc:mga05p37_109_c1_57074_58018 295
79 3300050508 nmdc:mga09592_754_c1 nmdc:mga09592_754_c1_7353_8297 295
80 3300050510 nmdc:mga06r32_8007_c1 nmdc:mga06r32_8007_c1_1787_2731 295
81 3300053085 Ga0495619_0087798 Ga0495619_0087798_581_1510 295
82 3300005548 Ga0070665_100056718 Ga0070665_1000567187 296
83 3300009177 Ga0105248_10130139 Ga0105248_101301392 296
84 3300026095 Ga0207676_10010726 Ga0207676_100107265 296
85 3300045976 Ga0466967_0062754 Ga0466967_0062754_1844_2851 296
86 3300048915 Ga0496112_0020363 Ga0496112_0020363_3661_4605 296
87 3300048915 Ga0496112_0025278 Ga0496112_0025278_4256_5200 296
88 3300048917 Ga0496114_0101621 Ga0496114_0101621_364_1320 296
89 3300049587 Ga0501071_0260904 Ga0501071_0260904_19_984 296
90 3300049592 Ga0501076_0203831 Ga0501076_0203831_315_1280 296
91 3300049824 Ga0501045_0217544 Ga0501045_0217544_19_963 296
92 3300003373 JGI25407J50210_10008113 JGI25407J50210_100081131 297
93 3300003373 JGI25407J50210_10009581 JGI25407J50210_100095813 297
94 3300005337 Ga0070682_100086291 Ga0070682_1000862912 297
95 3300005981 Ga0081538_10000223 Ga0081538_1000022323 297
96 3300005981 Ga0081538_10000671 Ga0081538_100006717 297
97 3300005981 Ga0081538_10049706 Ga0081538_100497062 297
98 3300031731 Ga0307405_10086361 Ga0307405_100863611 297
99 3300032126 Ga0307415_100077660 Ga0307415_1000776602 297
100 3300041443 Ga0451789_0531975 Ga0451789_0531975_1312_2226 297
101 3300041451 Ga0451791_1784313 Ga0451791_1784313_3817_4731 297
102 3300041452 Ga0451793_0091432 Ga0451793_0091432_1481_2395 297
103 3300041456 Ga0451795_1242366 Ga0451795_1242366_938_1852 297
104 3300041459 Ga0451800_0883887 Ga0451800_0883887_415_1329 297
105 3300048911 Ga0496108_0384146 Ga0496108_0384146_300_1214 297
106 3300005467 Ga0070706_100033523 Ga0070706_1000335235 299
107 3300005719 Ga0068861_100154169 Ga0068861_1001541692 299
108 3300028786 Ga0307517_10175185 Ga0307517_101751852 299
109 3300032005 Ga0307411_10104095 Ga0307411_101040952 299
110 3300006844 Ga0075428_100202250 Ga0075428_1002022503 300
111 3300009094 Ga0111539_10150710 Ga0111539_101507104 300
112 3300050507 nmdc:mga05p37_404903_c1 nmdc:mga05p37_404903_c1_525_1523 300
113 iso_pu_bacteria 2643221961 2645722251 300
114 iso_pu_bacteria 2643221962 2645725122 300
115 iso_pu_bacteria 2795385472 2795795565 300
116 3300026118 Ga0207675_100311650 Ga0207675_1003116502 301
117 3300005336 Ga0070680_100230814 Ga0070680_1002308141 302
118 3300005439 Ga0070711_100232449 Ga0070711_1002324492 302
119 3300005983 Ga0081540_1010943 Ga0081540_10109436 302
120 3300006175 Ga0070712_100135997 Ga0070712_1001359971 302
121 3300013307 Ga0157372_10202844 Ga0157372_102028443 302
122 3300025915 Ga0207693_10142821 Ga0207693_101428212 302
123 3300038443 Ga0395901_0435419 Ga0395901_0435419_142_1101 302
124 3300045976 Ga0466967_0149766 Ga0466967_0149766_1083_2015 302
125 3300046455 Ga0495603_0041322 Ga0495603_0041322_239_1171 302
126 3300048912 Ga0496109_0175198 Ga0496109_0175198_155_1087 302
127 3300048915 Ga0496112_0076561 Ga0496112_0076561_135_1067 302
128 3300048915 Ga0496112_0323332 Ga0496112_0323332_189_1121 302
129 3300048916 Ga0496113_0106014 Ga0496113_0106014_563_1495 302
130 3300048916 Ga0496113_0188040 Ga0496113_0188040_175_1107 302
131 3300003322 rootL2_10241102 rootL2_102411022 303
132 3300005435 Ga0070714_100005972 Ga0070714_10000597211 303
133 3300005435 Ga0070714_100091827 Ga0070714_1000918272 303
134 3300005436 Ga0070713_100365114 Ga0070713_1003651141 303
135 3300005445 Ga0070708_100226358 Ga0070708_1002263582 303
136 3300005467 Ga0070706_100095491 Ga0070706_1000954912 303
137 3300005467 Ga0070706_100110998 Ga0070706_1001109982 303
138 3300005468 Ga0070707_100030035 Ga0070707_1000300354 303
139 3300005471 Ga0070698_100012039 Ga0070698_1000120399 303
140 3300005471 Ga0070698_100012398 Ga0070698_1000123982 303
141 3300005518 Ga0070699_100186402 Ga0070699_1001864021 303
142 3300006028 Ga0070717_10245051 Ga0070717_102450512 303
143 3300025922 Ga0207646_10123758 Ga0207646_101237582 303
144 3300025928 Ga0207700_10316264 Ga0207700_103162642 303
145 3300025929 Ga0207664_10002832 Ga0207664_1000283210 303
146 3300037853 Ga0436364_1441645 Ga0436364_1441645_1879_2814 303
147 3300048918 Ga0496115_0210563 Ga0496115_0210563_539_1507 303
148 3300049585 Ga0501069_0116644 Ga0501069_0116644_288_1202 303
149 3300049586 Ga0501070_0060774 Ga0501070_0060774_637_1551 303
150 3300003203 JGI25406J46586_10044253 JGI25406J46586_100442532 304
151 3300005329 Ga0070683_100045577 Ga0070683_1000455773 304
152 3300005337 Ga0070682_100092529 Ga0070682_1000925292 304
153 3300005435 Ga0070714_100055035 Ga0070714_1000550354 304
154 3300005436 Ga0070713_100075395 Ga0070713_1000753953 304
155 3300005456 Ga0070678_100158562 Ga0070678_1001585622 304
156 3300005468 Ga0070707_100070307 Ga0070707_1000703071 304
157 3300005530 Ga0070679_100091501 Ga0070679_1000915013 304
158 3300005548 Ga0070665_100120691 Ga0070665_1001206912 304
159 3300005548 Ga0070665_100122462 Ga0070665_1001224623 304
160 3300005563 Ga0068855_100172695 Ga0068855_1001726953 304
161 3300005577 Ga0068857_100316238 Ga0068857_1003162382 304
162 3300005577 Ga0068857_100388624 Ga0068857_1003886242 304
163 3300005578 Ga0068854_100014763 Ga0068854_1000147637 304
164 3300005614 Ga0068856_100027547 Ga0068856_1000275472 304
165 3300005616 Ga0068852_100012963 Ga0068852_1000129636 304
166 3300005842 Ga0068858_100000054 Ga0068858_1000000542 304
167 3300005937 Ga0081455_10003970 Ga0081455_100039706 304
168 3300005937 Ga0081455_10014692 Ga0081455_100146923 304
169 3300005985 Ga0081539_10001504 Ga0081539_1000150431 304
170 3300005985 Ga0081539_10002251 Ga0081539_1000225120 304
171 3300006028 Ga0070717_10125084 Ga0070717_101250842 304
172 3300006844 Ga0075428_100000663 Ga0075428_10000066321 304
173 3300006844 Ga0075428_100006856 Ga0075428_1000068566 304
174 3300006844 Ga0075428_100020214 Ga0075428_1000202148 304
175 3300006844 Ga0075428_100033909 Ga0075428_1000339093 304
176 3300006844 Ga0075428_100045071 Ga0075428_1000450713 304
177 3300006844 Ga0075428_100050378 Ga0075428_1000503781 304
178 3300006846 Ga0075430_100009975 Ga0075430_1000099756 304
179 3300006847 Ga0075431_100004704 Ga0075431_1000047043 304
180 3300006847 Ga0075431_100021090 Ga0075431_1000210905 304
181 3300006847 Ga0075431_100411300 Ga0075431_1004113001 304
182 3300006880 Ga0075429_100003483 Ga0075429_1000034833 304
183 3300006880 Ga0075429_100013263 Ga0075429_1000132633 304
184 3300009098 Ga0105245_10128301 Ga0105245_101283012 304
185 3300009101 Ga0105247_10059738 Ga0105247_100597381 304
186 3300009147 Ga0114129_10016283 Ga0114129_100162836 304
187 3300009147 Ga0114129_10147268 Ga0114129_101472681 304
188 3300009174 Ga0105241_10047293 Ga0105241_100472935 304
189 3300009551 Ga0105238_10047945 Ga0105238_100479452 304
190 3300009553 Ga0105249_10256250 Ga0105249_102562502 304
191 3300011119 Ga0105246_10194114 Ga0105246_101941142 304
192 3300013105 Ga0157369_10484930 Ga0157369_104849301 304
193 3300013296 Ga0157374_10051781 Ga0157374_100517812 304
194 3300014968 Ga0157379_10054667 Ga0157379_100546672 304
195 3300021388 Ga0213875_10001296 Ga0213875_100012966 304
196 3300025900 Ga0207710_10030240 Ga0207710_100302402 304
197 3300025904 Ga0207647_10013593 Ga0207647_100135932 304
198 3300025904 Ga0207647_10025083 Ga0207647_100250835 304
199 3300025907 Ga0207645_10165965 Ga0207645_101659651 304
200 3300025911 Ga0207654_10010796 Ga0207654_100107962 304
201 3300025914 Ga0207671_10001058 Ga0207671_1000105823 304
202 3300025915 Ga0207693_10199392 Ga0207693_101993921 304
203 3300025921 Ga0207652_10064266 Ga0207652_100642662 304
204 3300025922 Ga0207646_10062241 Ga0207646_100622414 304
205 3300025924 Ga0207694_10105587 Ga0207694_101055871 304
206 3300025928 Ga0207700_10078916 Ga0207700_100789163 304
207 3300025929 Ga0207664_10078846 Ga0207664_100788462 304
208 3300026035 Ga0207703_10000002 Ga0207703_10000002571 304
209 3300026067 Ga0207678_10062415 Ga0207678_100624152 304
210 3300026078 Ga0207702_10093931 Ga0207702_100939312 304
211 3300026116 Ga0207674_10270286 Ga0207674_102702861 304
212 3300026116 Ga0207674_10417324 Ga0207674_104173242 304
213 3300028794 Ga0307515_10116065 Ga0307515_101160652 304
214 3300031548 Ga0307408_100381087 Ga0307408_1003810871 304
215 3300031731 Ga0307405_10197733 Ga0307405_101977331 304
216 3300031838 Ga0307518_10277984 Ga0307518_102779841 304
217 3300031852 Ga0307410_10196868 Ga0307410_101968681 304
218 3300031852 Ga0307410_10344409 Ga0307410_103444092 304
219 3300031889 Ga0326468_10000094 Ga0326468_100000943 304
220 3300031901 Ga0307406_10470821 Ga0307406_104708212 304
221 3300031903 Ga0307407_10151590 Ga0307407_101515902 304
222 3300031903 Ga0307407_10232069 Ga0307407_102320691 304
223 3300031995 Ga0307409_100093825 Ga0307409_1000938254 304
224 3300031995 Ga0307409_100339340 Ga0307409_1003393401 304
225 3300032002 Ga0307416_100422656 Ga0307416_1004226561 304
226 3300032004 Ga0307414_10513938 Ga0307414_105139381 304
227 3300032126 Ga0307415_100040597 Ga0307415_1000405972 304
228 3300032126 Ga0307415_100112081 Ga0307415_1001120811 304
229 3300032126 Ga0307415_100269770 Ga0307415_1002697702 304
230 3300037418 Ga0395900_0303734 Ga0395900_0303734_467_1384 304
231 3300037466 Ga0395898_0133973 Ga0395898_0133973_966_1883 304
232 3300037471 Ga0395905_0067547 Ga0395905_0067547_1459_2376 304
233 3300037853 Ga0436364_0553737 Ga0436364_0553737_13174_14094 304
234 3300038443 Ga0395901_0077168 Ga0395901_0077168_1899_2816 304
235 3300041460 Ga0451802_0281666 Ga0451802_0281666_1812_2726 304
236 3300042005 Ga0439448_0007026 Ga0439448_0007026_2135_3049 304
237 3300042012 Ga0439455_0061535 Ga0439455_0061535_36_950 304
238 3300042014 Ga0439457_022707 Ga0439457_022707_343_1257 304
239 3300042439 Ga0439464_0013545 Ga0439464_0013545_894_1808 304
240 3300045976 Ga0466967_0278579 Ga0466967_0278579_110_1030 304
241 3300046810 Ga0495660_0060276 Ga0495660_0060276_502_1425 304
242 3300048905 Ga0496102_0002512 Ga0496102_0002512_14305_15237 304
243 3300048907 Ga0496104_0000441 Ga0496104_0000441_24722_25654 304
244 3300048908 Ga0496105_0003381 Ga0496105_0003381_1343_2275 304
245 3300048908 Ga0496105_0100261 Ga0496105_0100261_825_1739 304
246 3300048909 Ga0496106_0037840 Ga0496106_0037840_1733_2650 304
247 3300048911 Ga0496108_0000748 Ga0496108_0000748_14452_15384 304
248 3300048912 Ga0496109_0001743 Ga0496109_0001743_6291_7223 304
249 3300048912 Ga0496109_0119726 Ga0496109_0119726_1351_2265 304
250 3300048913 Ga0496110_0003033 Ga0496110_0003033_4796_5728 304
251 3300048914 Ga0496111_0001177 Ga0496111_0001177_12851_13783 304
252 3300048917 Ga0496114_0232122 Ga0496114_0232122_171_1115 304
253 3300048917 Ga0496114_0322141 Ga0496114_0322141_202_1116 304
254 3300048924 Ga0496121_0005940 Ga0496121_0005940_7495_8412 304
255 3300049575 Ga0501039_0084294 Ga0501039_0084294_855_1778 304
256 3300049587 Ga0501071_0031462 Ga0501071_0031462_691_1614 304
257 3300049591 Ga0501075_0181821 Ga0501075_0181821_145_1068 304
258 3300049592 Ga0501076_0148716 Ga0501076_0148716_491_1414 304
259 3300050507 nmdc:mga05p37_22243_c1 nmdc:mga05p37_22243_c1_1404_2318 304
260 3300050508 nmdc:mga09592_19572_c1 nmdc:mga09592_19572_c1_4339_5295 304
261 3300050508 nmdc:mga09592_56963_c1 nmdc:mga09592_56963_c1_1969_2883 304
262 3300050508 nmdc:mga09592_74448_c1 nmdc:mga09592_74448_c1_740_1654 304
263 3300050509 nmdc:mga0qj67_52075_c1 nmdc:mga0qj67_52075_c1_890_1804 304
264 3300050510 nmdc:mga06r32_22005_c1 nmdc:mga06r32_22005_c1_3829_4743 304
265 3300050510 nmdc:mga06r32_430968_c1 nmdc:mga06r32_430968_c1_307_1221 304
266 3300050511 nmdc:mga08y16_394399_c1 nmdc:mga08y16_394399_c1_481_1401 304
267 3300060353 Ga0501082_0508298 Ga0501082_0508298_85_1008 304
268 3300061734 Ga0530510_0110129 Ga0530510_0110129_199_1119 304
269 iso_pu_bacteria 2862574272 2862580931 304
270 3300003373 JGI25407J50210_10009481 JGI25407J50210_100094812 305
271 3300005328 Ga0070676_10083492 Ga0070676_100834922 305
272 3300005336 Ga0070680_100050335 Ga0070680_1000503352 305
273 3300005341 Ga0070691_10034860 Ga0070691_100348602 305
274 3300005345 Ga0070692_10009217 Ga0070692_100092172 305
275 3300005366 Ga0070659_100018755 Ga0070659_1000187552 305
276 3300005441 Ga0070700_100190595 Ga0070700_1001905951 305
277 3300005458 Ga0070681_10187426 Ga0070681_101874262 305
278 3300005530 Ga0070679_100125024 Ga0070679_1001250242 305
279 3300005535 Ga0070684_100085979 Ga0070684_1000859791 305
280 3300005564 Ga0070664_100155883 Ga0070664_1001558832 305
281 3300005616 Ga0068852_100068154 Ga0068852_1000681542 305
282 3300005981 Ga0081538_10000077 Ga0081538_1000007737 305
283 3300006852 Ga0075433_10060114 Ga0075433_100601144 305
284 3300006871 Ga0075434_100321175 Ga0075434_1003211752 305
285 3300006880 Ga0075429_100073229 Ga0075429_1000732294 305
286 3300006881 Ga0068865_100164176 Ga0068865_1001641762 305
287 3300009147 Ga0114129_10000657 Ga0114129_1000065732 305
288 3300025898 Ga0207692_10013344 Ga0207692_100133442 305
289 3300025901 Ga0207688_10061609 Ga0207688_100616091 305
290 3300025919 Ga0207657_10218357 Ga0207657_102183572 305
291 3300025935 Ga0207709_10052281 Ga0207709_100522813 305
292 3300025945 Ga0207679_10081933 Ga0207679_100819332 305
293 3300026041 Ga0207639_10124702 Ga0207639_101247022 305
294 3300026075 Ga0207708_10102651 Ga0207708_101026512 305
295 3300026142 Ga0207698_10106707 Ga0207698_101067072 305
296 3300027907 Ga0207428_10005790 Ga0207428_100057901 305
297 3300035725 Ga0373947_0209264 Ga0373947_0209264_289_1254 305
298 3300044694 Ga0466963_0039612 Ga0466963_0039612_944_1870 305
299 3300049575 Ga0501039_0046069 Ga0501039_0046069_2391_3356 305
300 3300049582 Ga0501048_0253126 Ga0501048_0253126_35_1072 305
301 3300049824 Ga0501045_0025753 Ga0501045_0025753_46_1011 305
302 3300050507 nmdc:mga05p37_3308_c1 nmdc:mga05p37_3308_c1_7865_8950 305
303 3300050508 nmdc:mga09592_198255_c1 nmdc:mga09592_198255_c1_637_1635 305
304 3300050508 nmdc:mga09592_31_c1 nmdc:mga09592_31_c1_9507_10592 305
305 3300050508 nmdc:mga09592_32514_c1 nmdc:mga09592_32514_c1_2398_3363 305
306 3300050509 nmdc:mga0qj67_43_c1 nmdc:mga0qj67_43_c1_17615_18700 305
307 3300050510 nmdc:mga06r32_57_c2 nmdc:mga06r32_57_c2_32807_33892 305
308 3300050511 nmdc:mga08y16_40272_c1 nmdc:mga08y16_40272_c1_2339_3295 305
309 3300050512 nmdc:mga0n895_324722_c1 nmdc:mga0n895_324722_c1_421_1377 305
310 3300050515 nmdc:mga0a205_8359_c1 nmdc:mga0a205_8359_c1_816_1781 305
311 iso_pu_bacteria 2808606982 2811849211 305
312 iso_pu_bacteria 2868088558 2868090006 305
313 iso_pu_bacteria 3006321560 3006327512 305
314 3300005327 Ga0070658_10035358 Ga0070658_100353584 306
315 3300005329 Ga0070683_100248637 Ga0070683_1002486372 306
316 3300005347 Ga0070668_100231051 Ga0070668_1002310512 306
317 3300005436 Ga0070713_100271189 Ga0070713_1002711891 306
318 3300005437 Ga0070710_10256032 Ga0070710_102560321 306
319 3300005445 Ga0070708_100206136 Ga0070708_1002061362 306
320 3300005467 Ga0070706_100000176 Ga0070706_10000017668 306
321 3300005468 Ga0070707_100001211 Ga0070707_10000121119 306
322 3300005618 Ga0068864_100205781 Ga0068864_1002057812 306
323 3300005618 Ga0068864_100434364 Ga0068864_1004343642 306
324 3300005842 Ga0068858_100232197 Ga0068858_1002321972 306
325 3300005937 Ga0081455_10032348 Ga0081455_100323482 306
326 3300005981 Ga0081538_10000164 Ga0081538_1000016433 306
327 3300005981 Ga0081538_10001086 Ga0081538_1000108622 306
328 3300005981 Ga0081538_10011964 Ga0081538_100119645 306
329 3300005983 Ga0081540_1022919 Ga0081540_10229194 306
330 3300005985 Ga0081539_10012129 Ga0081539_100121295 306
331 3300005985 Ga0081539_10077093 Ga0081539_100770931 306
332 3300006844 Ga0075428_100002757 Ga0075428_10000275714 306
333 3300006844 Ga0075428_100020699 Ga0075428_1000206995 306
334 3300006844 Ga0075428_100410159 Ga0075428_1004101592 306
335 3300006846 Ga0075430_100019158 Ga0075430_1000191588 306
336 3300006880 Ga0075429_100024155 Ga0075429_1000241557 306
337 3300009094 Ga0111539_10094434 Ga0111539_100944344 306
338 3300009094 Ga0111539_10205473 Ga0111539_102054732 306
339 3300009101 Ga0105247_10000892 Ga0105247_1000089221 306
340 3300009147 Ga0114129_10497000 Ga0114129_104970001 306
341 3300009148 Ga0105243_10057296 Ga0105243_100572962 306
342 3300009148 Ga0105243_10074560 Ga0105243_100745602 306
343 3300011119 Ga0105246_10303339 Ga0105246_103033391 306
344 3300013297 Ga0157378_10031404 Ga0157378_100314045 306
345 3300013306 Ga0163162_10321744 Ga0163162_103217441 306
346 3300013308 Ga0157375_10265047 Ga0157375_102650472 306
347 3300025900 Ga0207710_10000548 Ga0207710_100005483 306
348 3300025906 Ga0207699_10137141 Ga0207699_101371411 306
349 3300025909 Ga0207705_10013985 Ga0207705_100139854 306
350 3300025910 Ga0207684_10000494 Ga0207684_1000049412 306
351 3300025922 Ga0207646_10003853 Ga0207646_100038534 306
352 3300025937 Ga0207669_10266573 Ga0207669_102665731 306
353 3300025949 Ga0207667_10015499 Ga0207667_100154995 306
354 3300025972 Ga0207668_10231882 Ga0207668_102318822 306
355 3300026078 Ga0207702_10313258 Ga0207702_103132582 306
356 3300026078 Ga0207702_10327051 Ga0207702_103270512 306
357 3300028381 Ga0268264_10420731 Ga0268264_104207311 306
358 3300031548 Ga0307408_100022366 Ga0307408_1000223664 306
359 3300031649 Ga0307514_10010571 Ga0307514_100105712 306
360 3300031730 Ga0307516_10142314 Ga0307516_101423142 306
361 3300031731 Ga0307405_10000410 Ga0307405_1000041015 306
362 3300031731 Ga0307405_10091983 Ga0307405_100919832 306
363 3300031852 Ga0307410_10000900 Ga0307410_100009004 306
364 3300031903 Ga0307407_10024342 Ga0307407_100243423 306
365 3300031911 Ga0307412_10005158 Ga0307412_100051587 306
366 3300031911 Ga0307412_10081110 Ga0307412_100811102 306
367 3300031995 Ga0307409_100139338 Ga0307409_1001393381 306
368 3300032002 Ga0307416_100001992 Ga0307416_10000199210 306
369 3300032004 Ga0307414_10266033 Ga0307414_102660331 306
370 3300032126 Ga0307415_100002406 Ga0307415_1000024061 306
371 3300033180 Ga0307510_10206310 Ga0307510_102063102 306
372 3300035091 Ga0373951_0000031 Ga0373951_0000031_5524_6450 306
373 3300038443 Ga0395901_0098727 Ga0395901_0098727_1608_2561 306
374 3300041512 Ga0451853_0826964 Ga0451853_0826964_7971_8891 306
375 3300042008 Ga0439450_044169 Ga0439450_044169_42_965 306
376 3300044683 Ga0466965_0065953 Ga0466965_0065953_438_1364 306
377 3300044694 Ga0466963_0058918 Ga0466963_0058918_66_1124 306
378 3300044842 Ga0466957_0269968 Ga0466957_0269968_138_1091 306
379 3300045976 Ga0466967_0208951 Ga0466967_0208951_514_1440 306
380 3300045976 Ga0466967_0558288 Ga0466967_0558288_42_1016 306
381 3300047321 Ga0495676_0023565 Ga0495676_0023565_933_1859 306
382 3300048903 Ga0496100_0006953 Ga0496100_0006953_3932_4858 306
383 3300048907 Ga0496104_0000004 Ga0496104_0000004_498874_499821 306
384 3300048907 Ga0496104_0009109 Ga0496104_0009109_2407_3396 306
385 3300048907 Ga0496104_0303730 Ga0496104_0303730_404_1387 306
386 3300048908 Ga0496105_0000001 Ga0496105_0000001_142010_142957 306
387 3300048912 Ga0496109_0180246 Ga0496109_0180246_117_1100 306
388 3300048912 Ga0496109_0239644 Ga0496109_0239644_384_1367 306
389 3300048914 Ga0496111_0013312 Ga0496111_0013312_2071_3060 306
390 3300048915 Ga0496112_0029713 Ga0496112_0029713_2091_3074 306
391 3300048915 Ga0496112_0059212 Ga0496112_0059212_476_1465 306
392 3300048916 Ga0496113_0055968 Ga0496113_0055968_1684_2667 306
393 3300048918 Ga0496115_0172439 Ga0496115_0172439_57_1031 306
394 3300048922 Ga0496119_0006668 Ga0496119_0006668_5397_6344 306
395 3300049581 Ga0501047_0026531 Ga0501047_0026531_3915_4874 306
396 3300050507 nmdc:mga05p37_284166_c1 nmdc:mga05p37_284166_c1_672_1634 306
397 3300050508 nmdc:mga09592_86710_c1 nmdc:mga09592_86710_c1_68_1021 306
398 3300050509 nmdc:mga0qj67_8184_c1 nmdc:mga0qj67_8184_c1_4286_5272 306
399 3300050510 nmdc:mga06r32_3193_c1 nmdc:mga06r32_3193_c1_4192_5178 306
400 3300050510 nmdc:mga06r32_356103_c1 nmdc:mga06r32_356103_c1_279_1220 306
401 3300050511 nmdc:mga08y16_210584_c1 nmdc:mga08y16_210584_c1_290_1231 306
402 iso_pu_bacteria 2795385470 2795787072 306
403 iso_pu_bacteria 2837268691 2837270897 306
404 3300005518 Ga0070699_100010740 Ga0070699_1000107404 307
405 3300035091 Ga0373951_0000049 Ga0373951_0000049_7222_8145 307
406 3300045976 Ga0466967_0650416 Ga0466967_0650416_88_1020 307
407 3300047443 Ga0495687_020854 Ga0495687_020854_1966_2895 307
408 3300005436 Ga0070713_100123406 Ga0070713_1001234062 308
409 3300005937 Ga0081455_10007936 Ga0081455_100079366 308
410 3300005937 Ga0081455_10032172 Ga0081455_100321724 308
411 3300031548 Ga0307408_100249427 Ga0307408_1002494271 308
412 3300031731 Ga0307405_10027949 Ga0307405_100279494 308
413 3300031731 Ga0307405_10068998 Ga0307405_100689981 308
414 3300031824 Ga0307413_10094623 Ga0307413_100946232 308
415 3300031901 Ga0307406_10006925 Ga0307406_100069256 308
416 3300031901 Ga0307406_10154755 Ga0307406_101547552 308
417 3300031911 Ga0307412_10328172 Ga0307412_103281721 308
418 3300031995 Ga0307409_100097594 Ga0307409_1000975942 308
419 3300032002 Ga0307416_100532060 Ga0307416_1005320602 308
420 3300032004 Ga0307414_10001230 Ga0307414_100012309 308
421 3300032126 Ga0307415_100005752 Ga0307415_1000057526 308
422 3300044694 Ga0466963_0102314 Ga0466963_0102314_353_1279 308
423 3300046455 Ga0495603_0016363 Ga0495603_0016363_2382_3317 308
424 3300046459 Ga0495629_0007601 Ga0495629_0007601_3905_4840 308
425 3300046499 Ga0495594_0152077 Ga0495594_0152077_245_1180 308
426 3300046689 Ga0495613_0001976 Ga0495613_0001976_8543_9478 308
427 3300048089 Ga0495614_0021167 Ga0495614_0021167_1812_2747 308
428 iso_pu_bacteria 2616644814 2616699399 308
429 iso_pu_bacteria 2996221748 2996221897 308
430 3300005985 Ga0081539_10000594 Ga0081539_1000059468 309
431 3300025904 Ga0207647_10047501 Ga0207647_100475011 309
432 3300025912 Ga0207707_10091731 Ga0207707_100917312 309
433 3300031548 Ga0307408_100002184 Ga0307408_10000218411 309
434 3300031548 Ga0307408_100234881 Ga0307408_1002348812 309
435 3300031731 Ga0307405_10032075 Ga0307405_100320753 309
436 3300031824 Ga0307413_10208155 Ga0307413_102081552 309
437 3300031901 Ga0307406_10000850 Ga0307406_1000085012 309
438 3300031995 Ga0307409_100003158 Ga0307409_1000031581 309
439 3300032002 Ga0307416_100000687 Ga0307416_10000068712 309
440 3300032126 Ga0307415_100001567 Ga0307415_10000156710 309
441 3300044693 Ga0466961_0047081 Ga0466961_0047081_951_1883 309
442 3300044842 Ga0466957_0168848 Ga0466957_0168848_288_1217 309
443 3300047321 Ga0495676_0001890 Ga0495676_0001890_15622_16560 309
444 3300049580 Ga0501046_0030742 Ga0501046_0030742_330_1259 309
445 3300049581 Ga0501047_0062892 Ga0501047_0062892_669_1601 309
446 iso_pu_bacteria 2808606375 2808917989 309
447 3300001979 JGI24740J21852_10012270 JGI24740J21852_100122703 310
448 3300001989 JGI24739J22299_10014039 JGI24739J22299_100140392 310
449 3300001990 JGI24737J22298_10011157 JGI24737J22298_100111572 310
450 3300003320 rootH2_10010881 rootH2_100108812 310
451 3300003760 Ga0055527_1000005 Ga0055527_1000005197 310
452 3300003762 Ga0055542_1000006 Ga0055542_1000006197 310
453 3300003763 Ga0055529_1000013 Ga0055529_1000013106 310
454 3300005327 Ga0070658_10006366 Ga0070658_100063665 310
455 3300005327 Ga0070658_10047682 Ga0070658_100476821 310
456 3300005329 Ga0070683_100000483 Ga0070683_1000004834 310
457 3300005329 Ga0070683_100001497 Ga0070683_10000149714 310
458 3300005339 Ga0070660_100013235 Ga0070660_1000132356 310
459 3300005343 Ga0070687_100101115 Ga0070687_1001011152 310
460 3300005366 Ga0070659_100019569 Ga0070659_1000195695 310
461 3300005434 Ga0070709_10231385 Ga0070709_102313852 310
462 3300005436 Ga0070713_100139987 Ga0070713_1001399873 310
463 3300005445 Ga0070708_100106514 Ga0070708_1001065142 310
464 3300005455 Ga0070663_100030931 Ga0070663_1000309313 310
465 3300005455 Ga0070663_100072161 Ga0070663_1000721612 310
466 3300005455 Ga0070663_100072486 Ga0070663_1000724863 310
467 3300005457 Ga0070662_100069452 Ga0070662_1000694521 310
468 3300005467 Ga0070706_100033263 Ga0070706_1000332632 310
469 3300005468 Ga0070707_100031127 Ga0070707_1000311273 310
470 3300005471 Ga0070698_100011641 Ga0070698_1000116416 310
471 3300005530 Ga0070679_100105047 Ga0070679_1001050472 310
472 3300005535 Ga0070684_100002110 Ga0070684_1000021109 310
473 3300005535 Ga0070684_100018621 Ga0070684_1000186212 310
474 3300005535 Ga0070684_100092191 Ga0070684_1000921912 310
475 3300005535 Ga0070684_100092854 Ga0070684_1000928544 310
476 3300005536 Ga0070697_100000837 Ga0070697_1000008378 310
477 3300005548 Ga0070665_100000957 Ga0070665_10000095735 310
478 3300005563 Ga0068855_100045343 Ga0068855_1000453434 310
479 3300005563 Ga0068855_100050902 Ga0068855_1000509023 310
480 3300005577 Ga0068857_100007737 Ga0068857_1000077371 310
481 3300005614 Ga0068856_100017299 Ga0068856_1000172993 310
482 3300005615 Ga0070702_100036899 Ga0070702_1000368992 310
483 3300005616 Ga0068852_100338677 Ga0068852_1003386772 310
484 3300005616 Ga0068852_100763942 Ga0068852_1007639421 310
485 3300005618 Ga0068864_100025281 Ga0068864_1000252814 310
486 3300005719 Ga0068861_100068442 Ga0068861_1000684421 310
487 3300005841 Ga0068863_100044588 Ga0068863_1000445884 310
488 3300005842 Ga0068858_100088463 Ga0068858_1000884631 310
489 3300005937 Ga0081455_10012717 Ga0081455_100127175 310
490 3300005937 Ga0081455_10140333 Ga0081455_101403333 310
491 3300005981 Ga0081538_10000327 Ga0081538_1000032744 310
492 3300005981 Ga0081538_10001230 Ga0081538_1000123027 310
493 3300005981 Ga0081538_10004928 Ga0081538_1000492815 310
494 3300005981 Ga0081538_10005814 Ga0081538_100058148 310
495 3300005981 Ga0081538_10008447 Ga0081538_1000844711 310
496 3300005981 Ga0081538_10010361 Ga0081538_100103612 310
497 3300005981 Ga0081538_10011370 Ga0081538_100113705 310
498 3300005981 Ga0081538_10014900 Ga0081538_100149004 310
499 3300005981 Ga0081538_10065101 Ga0081538_100651011 310
500 3300005983 Ga0081540_1015521 Ga0081540_10155213 310
501 3300005983 Ga0081540_1027370 Ga0081540_10273703 310
502 3300005985 Ga0081539_10000312 Ga0081539_1000031271 310
503 3300006028 Ga0070717_10024373 Ga0070717_100243734 310
504 3300006847 Ga0075431_100010408 Ga0075431_1000104087 310
505 3300006881 Ga0068865_100039073 Ga0068865_1000390734 310
506 3300009093 Ga0105240_10192816 Ga0105240_101928163 310
507 3300009545 Ga0105237_10170094 Ga0105237_101700943 310
508 3300013102 Ga0157371_10092779 Ga0157371_100927791 310
509 3300013104 Ga0157370_10012750 Ga0157370_100127506 310
510 3300013105 Ga0157369_10034217 Ga0157369_100342176 310
511 3300013307 Ga0157372_10256280 Ga0157372_102562801 310
512 3300017792 Ga0163161_10080068 Ga0163161_100800683 310
513 3300022467 Ga0224712_10063666 Ga0224712_100636662 310
514 3300025228 Ga0209672_100003 Ga0209672_100003541 310
515 3300025229 Ga0209147_101200 Ga0209147_1012008 310
516 3300025254 Ga0209148_1000004 Ga0209148_1000004836 310
517 3300025272 Ga0209455_1000022 Ga0209455_1000022147 310
518 3300025901 Ga0207688_10213150 Ga0207688_102131501 310
519 3300025904 Ga0207647_10009660 Ga0207647_100096602 310
520 3300025904 Ga0207647_10017159 Ga0207647_100171594 310
521 3300025904 Ga0207647_10020533 Ga0207647_100205333 310
522 3300025904 Ga0207647_10036923 Ga0207647_100369232 310
523 3300025909 Ga0207705_10000001 Ga0207705_10000001363 310
524 3300025909 Ga0207705_10010070 Ga0207705_100100702 310
525 3300025909 Ga0207705_10083798 Ga0207705_100837981 310
526 3300025919 Ga0207657_10030888 Ga0207657_100308882 310
527 3300025920 Ga0207649_10101944 Ga0207649_101019442 310
528 3300025921 Ga0207652_10341150 Ga0207652_103411501 310
529 3300025921 Ga0207652_10356150 Ga0207652_103561501 310
530 3300025922 Ga0207646_10005806 Ga0207646_100058068 310
531 3300025927 Ga0207687_10003716 Ga0207687_100037169 310
532 3300025928 Ga0207700_10187479 Ga0207700_101874792 310
533 3300025929 Ga0207664_10071483 Ga0207664_100714831 310
534 3300025932 Ga0207690_10132441 Ga0207690_101324412 310
535 3300025932 Ga0207690_10322715 Ga0207690_103227151 310
536 3300025933 Ga0207706_10049304 Ga0207706_100493043 310
537 3300025934 Ga0207686_10080137 Ga0207686_100801373 310
538 3300025934 Ga0207686_10270712 Ga0207686_102707122 310
539 3300025941 Ga0207711_10088721 Ga0207711_100887212 310
540 3300025944 Ga0207661_10000475 Ga0207661_100004754 310
541 3300025944 Ga0207661_10023816 Ga0207661_100238164 310
542 3300025944 Ga0207661_10159304 Ga0207661_101593041 310
543 3300025949 Ga0207667_10321241 Ga0207667_103212411 310
544 3300025961 Ga0207712_10172320 Ga0207712_101723202 310
545 3300025961 Ga0207712_10174263 Ga0207712_101742632 310
546 3300026035 Ga0207703_10262580 Ga0207703_102625802 310
547 3300026067 Ga0207678_10011795 Ga0207678_100117953 310
548 3300026067 Ga0207678_10031474 Ga0207678_100314744 310
549 3300026078 Ga0207702_10131341 Ga0207702_101313412 310
550 3300026095 Ga0207676_10062133 Ga0207676_100621332 310
551 3300026116 Ga0207674_10013524 Ga0207674_100135244 310
552 3300026116 Ga0207674_10088825 Ga0207674_100888253 310
553 3300026118 Ga0207675_100030582 Ga0207675_1000305824 310
554 3300026142 Ga0207698_10484354 Ga0207698_104843542 310
555 3300028379 Ga0268266_10009722 Ga0268266_100097227 310
556 3300028786 Ga0307517_10083258 Ga0307517_100832582 310
557 3300028786 Ga0307517_10092861 Ga0307517_100928612 310
558 3300028794 Ga0307515_10019662 Ga0307515_1001966211 310
559 3300030522 Ga0307512_10017852 Ga0307512_100178523 310
560 3300031548 Ga0307408_100079291 Ga0307408_1000792912 310
561 3300031592 Ga0310117_100046 Ga0310117_1000463 310
562 3300031616 Ga0307508_10011061 Ga0307508_100110616 310
563 3300031731 Ga0307405_10071120 Ga0307405_100711203 310
564 3300031824 Ga0307413_10036731 Ga0307413_100367313 310
565 3300031852 Ga0307410_10029720 Ga0307410_100297204 310
566 3300031903 Ga0307407_10000978 Ga0307407_1000097814 310
567 3300031995 Ga0307409_100003924 Ga0307409_1000039248 310
568 3300031995 Ga0307409_100018892 Ga0307409_1000188922 310
569 3300031995 Ga0307409_100103712 Ga0307409_1001037122 310
570 3300032002 Ga0307416_100009781 Ga0307416_1000097815 310
571 3300032004 Ga0307414_10005150 Ga0307414_100051503 310
572 3300032004 Ga0307414_10011793 Ga0307414_100117932 310
573 3300032126 Ga0307415_100019187 Ga0307415_1000191872 310
574 3300032126 Ga0307415_100055788 Ga0307415_1000557883 310
575 3300032126 Ga0307415_100060812 Ga0307415_1000608123 310
576 3300036401 Ga0373937_0215536 Ga0373937_0215536_820_1761 310
577 3300037068 Ga0373925_0000041 Ga0373925_0000041_31915_32853 310
578 3300037312 Ga0395899_0057477 Ga0395899_0057477_1230_2162 310
579 3300037418 Ga0395900_0005888 Ga0395900_0005888_9314_10246 310
580 3300037418 Ga0395900_0017136 Ga0395900_0017136_2049_2987 310
581 3300037466 Ga0395898_0000481 Ga0395898_0000481_31110_32042 310
582 3300037466 Ga0395898_0020662 Ga0395898_0020662_5084_6022 310
583 3300037466 Ga0395898_0518419 Ga0395898_0518419_55_987 310
584 3300037471 Ga0395905_0103983 Ga0395905_0103983_967_1905 310
585 3300038443 Ga0395901_0019372 Ga0395901_0019372_4363_5301 310
586 3300038443 Ga0395901_0022357 Ga0395901_0022357_5482_6426 310
587 3300044656 Ga0466969_0004700 Ga0466969_0004700_820_1752 310
588 3300044658 Ga0466972_0155140 Ga0466972_0155140_54_992 310
589 3300044684 Ga0466966_0007054 Ga0466966_0007054_3301_4233 310
590 3300044693 Ga0466961_0082203 Ga0466961_0082203_615_1547 310
591 3300044694 Ga0466963_0034080 Ga0466963_0034080_1251_2183 310
592 3300044694 Ga0466963_0191427 Ga0466963_0191427_274_1206 310
593 3300044719 Ga0466971_0036722 Ga0466971_0036722_844_1776 310
594 3300044765 Ga0466970_0083405 Ga0466970_0083405_739_1671 310
595 3300044842 Ga0466957_0273791 Ga0466957_0273791_19_957 310
596 3300044901 Ga0466960_0010294 Ga0466960_0010294_1695_2651 310
597 3300044901 Ga0466960_0045165 Ga0466960_0045165_1068_2000 310
598 3300045049 Ga0466959_0091803 Ga0466959_0091803_553_1485 310
599 3300045836 Ga0466958_0069820 Ga0466958_0069820_1199_2131 310
600 3300045976 Ga0466967_0005997 Ga0466967_0005997_2269_3204 310
601 3300045976 Ga0466967_0095501 Ga0466967_0095501_365_1303 310
602 3300045976 Ga0466967_0244389 Ga0466967_0244389_744_1676 310
603 3300045976 Ga0466967_0279188 Ga0466967_0279188_581_1522 310
604 3300045976 Ga0466967_0368728 Ga0466967_0368728_260_1198 310
605 3300046452 Ga0495617_012949 Ga0495617_012949_1707_2639 310
606 3300046454 Ga0495592_0011720 Ga0495592_0011720_5551_6483 310
607 3300046455 Ga0495603_0066074 Ga0495603_0066074_962_1894 310
608 3300046459 Ga0495629_0010003 Ga0495629_0010003_5506_6438 310
609 3300046459 Ga0495629_0019118 Ga0495629_0019118_3470_4402 310
610 3300046459 Ga0495629_0103496 Ga0495629_0103496_553_1485 310
611 3300046462 Ga0495651_0078500 Ga0495651_0078500_1253_2185 310
612 3300046476 Ga0495662_0000568 Ga0495662_0000568_14833_15771 310
613 3300046476 Ga0495662_0001073 Ga0495662_0001073_564_1502 310
614 3300046499 Ga0495594_0035998 Ga0495594_0035998_1325_2257 310
615 3300046499 Ga0495594_0058825 Ga0495594_0058825_751_1683 310
616 3300046499 Ga0495594_0071917 Ga0495594_0071917_509_1447 310
617 3300046512 Ga0495610_0034663 Ga0495610_0034663_1462_2394 310
618 3300046514 Ga0495618_0121259 Ga0495618_0121259_189_1121 310
619 3300046516 Ga0495628_0063601 Ga0495628_0063601_1400_2332 310
620 3300046516 Ga0495628_0345109 Ga0495628_0345109_54_986 310
621 3300046517 Ga0495630_0052990 Ga0495630_0052990_1146_2078 310
622 3300046519 Ga0495632_0023301 Ga0495632_0023301_2274_3206 310
623 3300046529 Ga0495652_0031272 Ga0495652_0031272_163_1095 310
624 3300046529 Ga0495652_0196865 Ga0495652_0196865_448_1380 310
625 3300046533 Ga0495640_0017011 Ga0495640_0017011_4157_5089 310
626 3300046533 Ga0495640_0032572 Ga0495640_0032572_2576_3508 310
627 3300046533 Ga0495640_0172068 Ga0495640_0172068_108_1046 310
628 3300046538 Ga0495609_0087478 Ga0495609_0087478_218_1150 310
629 3300046557 Ga0495622_0068081 Ga0495622_0068081_314_1246 310
630 3300046559 Ga0495667_0057926 Ga0495667_0057926_1051_1983 310
631 3300046642 Ga0495634_0047173 Ga0495634_0047173_1340_2272 310
632 3300046675 Ga0495657_0000588 Ga0495657_0000588_18011_18949 310
633 3300046675 Ga0495657_0022323 Ga0495657_0022323_825_1763 310
634 3300046689 Ga0495613_0010586 Ga0495613_0010586_5263_6201 310
635 3300046689 Ga0495613_0079441 Ga0495613_0079441_912_1850 310
636 3300046689 Ga0495613_0083380 Ga0495613_0083380_687_1619 310
637 3300046689 Ga0495613_0167846 Ga0495613_0167846_193_1131 310
638 3300046690 Ga0495624_0013797 Ga0495624_0013797_4484_5422 310
639 3300046690 Ga0495624_0074558 Ga0495624_0074558_670_1602 310
640 3300046690 Ga0495624_0109116 Ga0495624_0109116_380_1312 310
641 3300046690 Ga0495624_0137680 Ga0495624_0137680_71_1003 310
642 3300046694 Ga0495649_0031689 Ga0495649_0031689_547_1485 310
643 3300047315 Ga0495581_0071385 Ga0495581_0071385_328_1266 310
644 3300047315 Ga0495581_0092819 Ga0495581_0092819_405_1343 310
645 3300047317 Ga0495604_0012907 Ga0495604_0012907_2552_3490 310
646 3300047317 Ga0495604_0053457 Ga0495604_0053457_969_1907 310
647 3300047318 Ga0495636_0006927 Ga0495636_0006927_204_1142 310
648 3300047319 Ga0495674_0006056 Ga0495674_0006056_5155_6087 310
649 3300047319 Ga0495674_0193631 Ga0495674_0193631_645_1577 310
650 3300047319 Ga0495674_0292154 Ga0495674_0292154_191_1129 310
651 3300047321 Ga0495676_0051363 Ga0495676_0051363_59_997 310
652 3300047321 Ga0495676_0052583 Ga0495676_0052583_1357_2289 310
653 3300047321 Ga0495676_0180782 Ga0495676_0180782_407_1345 310
654 3300047443 Ga0495687_001586 Ga0495687_001586_7558_8496 310
655 3300047443 Ga0495687_005483 Ga0495687_005483_2090_3028 310
656 3300047443 Ga0495687_077493 Ga0495687_077493_292_1230 310
657 3300047443 Ga0495687_104949 Ga0495687_104949_76_1008 310
658 3300047444 Ga0495675_0010945 Ga0495675_0010945_992_1930 310
659 3300047447 Ga0495685_010796 Ga0495685_010796_1378_2316 310
660 3300047673 Ga0495593_0002108 Ga0495593_0002108_4517_5455 310
661 3300047673 Ga0495593_0044644 Ga0495593_0044644_622_1560 310
662 3300048088 Ga0495602_0121051 Ga0495602_0121051_999_1967 310
663 3300048089 Ga0495614_0008434 Ga0495614_0008434_3289_4221 310
664 3300048089 Ga0495614_0027613 Ga0495614_0027613_1351_2289 310
665 3300048904 Ga0496101_0039771 Ga0496101_0039771_200_1132 310
666 3300048907 Ga0496104_0071151 Ga0496104_0071151_1499_2431 310
667 3300048908 Ga0496105_0005310 Ga0496105_0005310_859_1791 310
668 3300048917 Ga0496114_0147469 Ga0496114_0147469_955_1896 310
669 3300048918 Ga0496115_0098511 Ga0496115_0098511_817_1749 310
670 3300048918 Ga0496115_0287239 Ga0496115_0287239_359_1300 310
671 3300048929 Ga0496126_0031840 Ga0496126_0031840_3659_4600 310
672 3300048929 Ga0496126_0200014 Ga0496126_0200014_25_957 310
673 3300049568 Ga0501031_0003764 Ga0501031_0003764_5835_6767 310
674 3300049569 Ga0501032_0004275 Ga0501032_0004275_7807_8739 310
675 3300049570 Ga0501033_0016260 Ga0501033_0016260_2989_3921 310
676 3300049571 Ga0501034_0032491 Ga0501034_0032491_2652_3584 310
677 3300049571 Ga0501034_0291088 Ga0501034_0291088_612_1544 310
678 3300049572 Ga0501036_0004014 Ga0501036_0004014_1703_2635 310
679 3300049573 Ga0501037_0000877 Ga0501037_0000877_5014_5946 310
680 3300049574 Ga0501038_0006616 Ga0501038_0006616_119_1051 310
681 3300049575 Ga0501039_0279409 Ga0501039_0279409_361_1293 310
682 3300049576 Ga0501040_0010811 Ga0501040_0010811_4318_5250 310
683 3300049579 Ga0501043_0001649 Ga0501043_0001649_2953_3885 310
684 3300049580 Ga0501046_0003745 Ga0501046_0003745_2989_3921 310
685 3300049581 Ga0501047_0004742 Ga0501047_0004742_8802_9734 310
686 3300049581 Ga0501047_0017565 Ga0501047_0017565_1902_2834 310
687 3300049581 Ga0501047_0030159 Ga0501047_0030159_29_961 310
688 3300049581 Ga0501047_0055403 Ga0501047_0055403_2629_3561 310
689 3300049581 Ga0501047_0099811 Ga0501047_0099811_1810_2748 310
690 3300049582 Ga0501048_0002977 Ga0501048_0002977_2989_3921 310
691 3300049583 Ga0501067_0001377 Ga0501067_0001377_8946_9878 310
692 3300049583 Ga0501067_0005852 Ga0501067_0005852_1886_2818 310
693 3300049584 Ga0501068_0204239 Ga0501068_0204239_95_1027 310
694 3300049586 Ga0501070_0004792 Ga0501070_0004792_5959_6912 310
695 3300049586 Ga0501070_0023946 Ga0501070_0023946_489_1421 310
696 3300049586 Ga0501070_0041857 Ga0501070_0041857_1968_2900 310
697 3300049587 Ga0501071_0005296 Ga0501071_0005296_3164_4096 310
698 3300049588 Ga0501072_0008248 Ga0501072_0008248_58_990 310
699 3300049588 Ga0501072_0015071 Ga0501072_0015071_631_1563 310
700 3300049588 Ga0501072_0154762 Ga0501072_0154762_36_968 310
701 3300049588 Ga0501072_0281554 Ga0501072_0281554_158_1096 310
702 3300049589 Ga0501073_0130822 Ga0501073_0130822_580_1512 310
703 3300049589 Ga0501073_0144561 Ga0501073_0144561_293_1246 310
704 3300049590 Ga0501074_0004185 Ga0501074_0004185_2727_3659 310
705 3300049590 Ga0501074_0015924 Ga0501074_0015924_2493_3425 310
706 3300049590 Ga0501074_0016792 Ga0501074_0016792_2503_3435 310
707 3300049590 Ga0501074_0056073 Ga0501074_0056073_1787_2740 310
708 3300049592 Ga0501076_0335443 Ga0501076_0335443_48_980 310
709 3300049592 Ga0501076_0418397 Ga0501076_0418397_48_980 310
710 3300049593 Ga0501077_0005792 Ga0501077_0005792_3395_4327 310
711 3300049593 Ga0501077_0015350 Ga0501077_0015350_3829_4761 310
712 3300049741 Ga0501079_0023680 Ga0501079_0023680_489_1421 310
713 3300049741 Ga0501079_0236770 Ga0501079_0236770_24_977 310
714 3300049742 Ga0501080_0000857 Ga0501080_0000857_5386_6318 310
715 3300049744 Ga0501083_0010270 Ga0501083_0010270_2082_3014 310
716 3300049744 Ga0501083_0089782 Ga0501083_0089782_922_1854 310
717 3300049744 Ga0501083_0220825 Ga0501083_0220825_57_989 310
718 3300049744 Ga0501083_0221694 Ga0501083_0221694_192_1145 310
719 3300049822 Ga0501035_0002421 Ga0501035_0002421_14266_15198 310
720 3300049823 Ga0501044_0001494 Ga0501044_0001494_23321_24253 310
721 3300049823 Ga0501044_0004920 Ga0501044_0004920_9705_10667 310
722 3300049823 Ga0501044_0027151 Ga0501044_0027151_3261_4217 310
723 3300049823 Ga0501044_0199338 Ga0501044_0199338_399_1337 310
724 3300049824 Ga0501045_0050324 Ga0501045_0050324_2044_2976 310
725 3300050510 nmdc:mga06r32_58976_c1 nmdc:mga06r32_58976_c1_1980_2918 310
726 3300053077 Ga0495601_0042765 Ga0495601_0042765_789_1757 310
727 3300053085 Ga0495619_0361105 Ga0495619_0361105_55_993 310
728 3300053096 Ga0500641_0053055 Ga0500641_0053055_20_952 310
729 3300054114 Ga0501084_0110505 Ga0501084_0110505_361_1293 310
730 3300060353 Ga0501082_0200449 Ga0501082_0200449_245_1177 310
731 3300061734 Ga0530510_0381888 Ga0530510_0381888_78_1010 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

75

232

0.79

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

71

302

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9042 1 34
3rbz-assembly1.cif.gz_A-2 mthk channel, ca2+-bound 0.835 2 125
3rbz-assembly1.cif.gz_C-2 mthk channel, ca2+-bound 0.8347 2 125
1l7d-assembly1.cif.gz_B crystal structure of r. rubrum transhydrogenase domain i without bound nad(h) 0.8317 2 75
6oly-assembly1.cif.gz_C full-length mthk channel at 3.1 angstrom resolution 0.8315 2 125
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9113 3 30 3.50.50.60
af_Q5AC33_13_266_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.8955 3 47 3.90.180.10
af_Q2FVH5_1_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.886 3 308 3.40.50.720
5xgvB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8804 3 34 3.50.50.60
af_Q2FVH5_1_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8712 3 308 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1C4XUD3-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9937 18 288 GO:0003677
GO:0006352
GO:0016987
AF-A0A7W5VBD1-F1-model_v4 Nucleoside-diphosphate-sugar epimerase 0.9922 1 122
AF-A0A497W7Y5-F1-model_v4 deleted 0.9893 1 183
AF-A0A539CWQ6-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9869 1 115
AF-A0A7W0NP32-F1-model_v4 NAD(P)H-binding protein 0.9847 1 125 GO:0004029
GO:0005737

Feature Viewer

pLDDT pTM Quality
92.9 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map