F477927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 730 | 533 | 497 | 315 |
Family's Representative Sequence
| Representative Sequence | 3300041405|Ga0439438_000005|Ga0439438_000005_398438_399493 |
| Length | 351 |
| Sequence | MKKISPVSPLKMSRLPNLFTCFYVKANIMMTQTPVRSGLHASSAFKFNVRDAGTLIGLLIIIVTFSFLSPVFFTLPNLLNVLQQSSINALIALGMTLVIISGGIDLSVGPTAALSAVLGATLMVSGVPVPIAVLATLGVGAACGVFSGSLIAYAGLQPFIVTLGGLSLFRAIALIYTGGNPIFGIPMEFRSIINSTLFGVPTPIIIVAVIALVLWTVMNKTPLGEYILAIGGNEEAARVAGVPVKRTKVTVYVISGTLASLASLILIGRLGAAEPTIGNLWELDAIAAAAIGGASLMGGKGSVFGTIIGVIILGALRNGLTLLNIQAFYQLLATGLIIIIAMLIDRATRGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 3 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 4 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 5 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 6 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 7 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 8 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 9 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 10 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 11 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 12 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 13 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 14 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 15 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 16 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 17 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 18 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 19 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 20 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 21 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 22 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 23 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 24 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 25 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 26 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 27 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 28 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 29 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 30 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 31 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 32 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 33 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 34 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 35 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 36 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 37 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 38 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 39 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 40 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 41 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 42 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 43 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 44 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 45 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 46 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 47 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 48 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 49 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 50 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 51 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 52 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 53 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 54 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 55 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 56 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 57 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 58 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 59 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 60 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 61 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 62 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 63 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 64 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 65 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 66 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 67 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 68 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 69 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 70 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 71 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 72 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 73 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 74 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 75 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 76 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 77 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 78 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 79 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 80 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 81 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 82 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 83 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 84 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 85 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 86 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 87 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 88 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 89 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 90 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 91 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 92 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 93 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 94 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 95 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 96 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 97 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 98 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 99 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 100 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 101 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 102 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 103 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 104 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 105 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 106 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 107 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 108 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 109 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 110 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 111 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 112 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 113 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 114 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 115 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 116 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 117 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 118 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 119 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 120 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 121 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 122 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 123 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 124 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 125 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 126 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 127 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 128 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 129 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 130 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 131 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 132 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 133 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 134 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 135 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 136 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 137 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 138 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 139 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 140 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 141 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 142 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 143 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 144 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 145 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 146 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 147 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 148 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 149 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 150 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 151 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 152 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 153 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 154 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 155 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 156 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 157 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 158 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 159 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 160 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 161 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 162 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 163 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 164 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 165 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 166 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 167 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 168 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 169 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 170 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 171 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 172 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 173 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 174 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 175 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 176 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 177 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 178 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 179 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 180 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 181 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 182 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 183 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 184 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 185 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 186 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 187 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 188 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 189 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 190 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 191 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 192 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 193 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 194 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 195 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 196 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 197 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 198 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 199 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 200 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 201 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 202 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 203 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 204 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 205 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 206 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 207 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 208 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 209 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 210 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 211 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 212 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 213 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 214 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 215 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 216 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 217 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 218 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 219 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 220 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 221 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 222 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 223 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 224 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 225 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 226 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 227 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 228 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 229 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 230 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 231 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 232 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 233 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 234 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 235 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 236 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 237 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 238 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 240 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 246 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 250 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 251 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 252 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 253 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 255 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 257 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 259 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 260 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 261 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 262 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 263 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 264 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 265 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 266 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 267 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 268 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 269 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 270 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 272 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 273 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 274 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 275 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 277 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 278 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 279 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 280 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 282 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 284 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 290 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 291 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 292 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 299 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 301 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 303 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 304 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 305 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 306 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 307 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 309 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 311 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 312 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 313 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 314 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 315 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 316 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 317 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 318 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 345 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 347 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 349 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 350 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 351 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 352 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 353 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 354 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 355 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 356 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 357 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 358 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 359 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 360 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 361 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 362 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 363 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 364 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 365 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 366 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 367 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 368 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 369 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 370 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 371 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 372 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 373 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 374 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 375 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 376 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 377 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 378 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 379 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 380 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 381 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 382 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 383 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 384 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 385 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 441 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 468 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 469 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 470 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 471 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 479 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 480 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 481 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 483 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 484 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 485 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 486 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 487 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 488 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 490 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 491 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 492 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 493 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 495 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 500 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 501 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 503 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 504 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 505 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 508 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 509 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 510 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 511 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 512 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 513 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 515 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 516 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 517 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 518 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 519 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 520 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 521 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 522 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 523 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 524 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 525 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 526 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 527 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 528 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 529 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 530 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 531 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 532 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 533 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.08 |
| Metatranscriptomes | 0 |
| Isolates | 31.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0.14 |
| Endosphere | 14.11 |
| Nodule | 24.52 |
| Rhizoplane | 1.92 |
| Rhizosphere | 47.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_129826 | 2162886007 | Bacteria | 4123 |
| 2 | JGI24739J22299_10027864 | 3300001989 | Bacteria | 1972 |
| 3 | JGI25162J39368_1000002 | 3300002737 | Bacteria | 663004 |
| 4 | JGI25162J39368_1003920 | 3300002737 | Bacteria | 3829 |
| 5 | JGI25163J39215_1000043 | 3300002771 | Bacteria | 55468 |
| 6 | JGI25164J39214_1000066 | 3300002772 | Bacteria | 106367 |
| 7 | JGI25151J46595_10001615 | 3300003187 | Bacteria | 14941 |
| 8 | JGI25153J46596_10006108 | 3300003215 | Bacteria | 6177 |
| 9 | JGI25160J50197_1003728 | 3300003354 | Bacteria | 6720 |
| 10 | JGI25161J50226_1002073 | 3300003374 | Bacteria | 5434 |
| 11 | Ga0055538_1000003 | 3300003751 | Bacteria | 663004 |
| 12 | Ga0055539_1000003 | 3300003752 | Bacteria | 663004 |
| 13 | Ga0055533_1000005 | 3300003756 | Bacteria | 663004 |
| 14 | Ga0055525_1000005 | 3300003759 | Bacteria | 663004 |
| 15 | Ga0055526_1001395 | 3300003771 | Bacteria | 17166 |
| 16 | Ga0055524_1000327 | 3300003775 | Bacteria | 44413 |
| 17 | Ga0055528_1001431 | 3300003790 | Bacteria | 14595 |
| 18 | Ga0055541_1000003 | 3300003841 | Bacteria | 663004 |
| 19 | Ga0058692_1000052 | 3300003856 | Bacteria | 107855 |
| 20 | Ga0058692_1000055 | 3300003856 | Bacteria | 105550 |
| 21 | Ga0058692_1000066 | 3300003856 | Bacteria | 89302 |
| 22 | Ga0058692_1000960 | 3300003856 | Bacteria | 11354 |
| 23 | Ga0058692_1001591 | 3300003856 | Bacteria | 8184 |
| 24 | Ga0055543_1000272 | 3300004625 | Bacteria | 38422 |
| 25 | Ga0065165_1003076 | 3300005262 | Bacteria | 12458 |
| 26 | Ga0065704_10000911 | 3300005289 | Bacteria | 13505 |
| 27 | Ga0065715_10130877 | 3300005293 | Bacteria | 2018 |
| 28 | Ga0065707_10145681 | 3300005295 | Bacteria | 1717 |
| 29 | Ga0070670_100002435 | 3300005331 | Bacteria | 15345 |
| 30 | Ga0068868_100386146 | 3300005338 | Bacteria | 1206 |
| 31 | Ga0070668_100039963 | 3300005347 | Bacteria | 3588 |
| 32 | Ga0070668_100104238 | 3300005347 | Bacteria | 2251 |
| 33 | Ga0070675_100026142 | 3300005354 | Bacteria | 4682 |
| 34 | Ga0070675_100097626 | 3300005354 | Bacteria | 2470 |
| 35 | Ga0070674_100039543 | 3300005356 | Bacteria | 3186 |
| 36 | Ga0070674_100040034 | 3300005356 | Bacteria | 3168 |
| 37 | Ga0070673_100244833 | 3300005364 | Bacteria | 1560 |
| 38 | Ga0070659_100237175 | 3300005366 | Bacteria | 1508 |
| 39 | Ga0070659_100263277 | 3300005366 | Bacteria | 1431 |
| 40 | Ga0070659_100307990 | 3300005366 | Bacteria | 1322 |
| 41 | Ga0070701_10005828 | 3300005438 | Bacteria | 5131 |
| 42 | Ga0070708_100079193 | 3300005445 | Bacteria | 2972 |
| 43 | Ga0070663_100022264 | 3300005455 | Bacteria | 4234 |
| 44 | Ga0070662_100069133 | 3300005457 | Bacteria | 2598 |
| 45 | Ga0068867_100002314 | 3300005459 | Bacteria | 13408 |
| 46 | Ga0070685_10005378 | 3300005466 | Bacteria | 6485 |
| 47 | Ga0070698_100009329 | 3300005471 | Bacteria | 10522 |
| 48 | Ga0068853_100494613 | 3300005539 | Bacteria | 1154 |
| 49 | Ga0070672_100182204 | 3300005543 | Bacteria | 1751 |
| 50 | Ga0068855_100389481 | 3300005563 | Bacteria | 1529 |
| 51 | Ga0070664_100131425 | 3300005564 | Bacteria | 2199 |
| 52 | Ga0068857_100008811 | 3300005577 | Bacteria | 8736 |
| 53 | Ga0068857_100021708 | 3300005577 | Bacteria | 5648 |
| 54 | Ga0070702_100060783 | 3300005615 | Bacteria | 2198 |
| 55 | Ga0068859_100047448 | 3300005617 | Bacteria | 4315 |
| 56 | Ga0068866_10112126 | 3300005718 | Bacteria | 1524 |
| 57 | Ga0068863_100017887 | 3300005841 | Bacteria | 6783 |
| 58 | Ga0068858_100113438 | 3300005842 | Bacteria | 2531 |
| 59 | Ga0068860_100100376 | 3300005843 | Bacteria | 2761 |
| 60 | Ga0068862_100034929 | 3300005844 | Bacteria | 4255 |
| 61 | Ga0068862_100191104 | 3300005844 | Bacteria | 1842 |
| 62 | Ga0075368_10015172 | 3300006042 | Bacteria | 2854 |
| 63 | Ga0075368_10022163 | 3300006042 | Bacteria | 2416 |
| 64 | Ga0075364_10045310 | 3300006051 | Bacteria | 2862 |
| 65 | Ga0075362_10053612 | 3300006177 | Bacteria | 1810 |
| 66 | Ga0075367_10034886 | 3300006178 | Bacteria | 2909 |
| 67 | Ga0075367_10087247 | 3300006178 | Bacteria | 1895 |
| 68 | Ga0075367_10125731 | 3300006178 | Bacteria | 1582 |
| 69 | Ga0075369_10041177 | 3300006186 | Bacteria | 1977 |
| 70 | Ga0075366_10000078 | 3300006195 | Bacteria | 38200 |
| 71 | Ga0075366_10013872 | 3300006195 | Bacteria | 4593 |
| 72 | Ga0097621_100061949 | 3300006237 | Bacteria | 3070 |
| 73 | Ga0075370_10044307 | 3300006353 | Bacteria | 2515 |
| 74 | Ga0075428_100259882 | 3300006844 | Bacteria | 1870 |
| 75 | Ga0075430_100101975 | 3300006846 | Bacteria | 2396 |
| 76 | Ga0068865_100023513 | 3300006881 | Bacteria | 4036 |
| 77 | Ga0097620_100047456 | 3300006931 | Bacteria | 4315 |
| 78 | Ga0079104_1001122 | 3300006946 | Bacteria | 19638 |
| 79 | Ga0105251_10000911 | 3300009011 | Bacteria | 26509 |
| 80 | Ga0105251_10003991 | 3300009011 | Bacteria | 10440 |
| 81 | Ga0105251_10011259 | 3300009011 | Bacteria | 5119 |
| 82 | Ga0105244_10000407 | 3300009036 | Bacteria | 40132 |
| 83 | Ga0105244_10003474 | 3300009036 | Bacteria | 11214 |
| 84 | Ga0105244_10007661 | 3300009036 | Bacteria | 6841 |
| 85 | Ga0105250_10000046 | 3300009092 | Bacteria | 126280 |
| 86 | Ga0105250_10000167 | 3300009092 | Bacteria | 56932 |
| 87 | Ga0105250_10000456 | 3300009092 | Bacteria | 29378 |
| 88 | Ga0111539_10000234 | 3300009094 | Bacteria | 66163 |
| 89 | Ga0105245_10120681 | 3300009098 | Bacteria | 2448 |
| 90 | Ga0114129_10013211 | 3300009147 | Bacteria | 11762 |
| 91 | Ga0105243_10002962 | 3300009148 | Bacteria | 14034 |
| 92 | Ga0105243_10021905 | 3300009148 | Bacteria | 4853 |
| 93 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 94 | Ga0105248_10036940 | 3300009177 | Bacteria | 5463 |
| 95 | Ga0105237_10345119 | 3300009545 | Bacteria | 1493 |
| 96 | Ga0105249_10003680 | 3300009553 | Bacteria | 13214 |
| 97 | Ga0105239_10142952 | 3300010375 | Bacteria | 2667 |
| 98 | Ga0157373_10012370 | 3300013100 | Bacteria | 6274 |
| 99 | Ga0157371_10002928 | 3300013102 | Bacteria | 15937 |
| 100 | Ga0157371_10009049 | 3300013102 | Bacteria | 7873 |
| 101 | Ga0157371_10023141 | 3300013102 | Bacteria | 4544 |
| 102 | Ga0157370_10000336 | 3300013104 | Bacteria | 59121 |
| 103 | Ga0157369_10215448 | 3300013105 | Bacteria | 2011 |
| 104 | Ga0163162_10209293 | 3300013306 | Bacteria | 2080 |
| 105 | Ga0163162_10247408 | 3300013306 | Bacteria | 1914 |
| 106 | Ga0157372_10037777 | 3300013307 | Bacteria | 5327 |
| 107 | Ga0157375_10045052 | 3300013308 | Bacteria | 4291 |
| 108 | Ga0163163_10173406 | 3300014325 | Bacteria | 2203 |
| 109 | Ga0157380_10051769 | 3300014326 | Bacteria | 3249 |
| 110 | Ga0157380_10128892 | 3300014326 | Bacteria | 2155 |
| 111 | Ga0182008_10078705 | 3300014497 | Bacteria | 1622 |
| 112 | Ga0157379_10283453 | 3300014968 | Bacteria | 1508 |
| 113 | Ga0182005_1015464 | 3300015265 | Bacteria | 2128 |
| 114 | Ga0209760_100005 | 3300025207 | Bacteria | 238315 |
| 115 | Ga0209760_101871 | 3300025207 | Bacteria | 2079 |
| 116 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 117 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 118 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 119 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 120 | Ga0207427_100009 | 3300025231 | Bacteria | 663036 |
| 121 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 122 | Ga0209437_100073 | 3300025233 | Bacteria | 302948 |
| 123 | Ga0207425_1006579 | 3300025245 | Bacteria | 3161 |
| 124 | Ga0207425_1016274 | 3300025245 | Bacteria | 1653 |
| 125 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 126 | Ga0209129_1000560 | 3300025258 | Bacteria | 25649 |
| 127 | Ga0209233_1002354 | 3300025261 | Bacteria | 7031 |
| 128 | Ga0209673_1000162 | 3300025273 | Bacteria | 139078 |
| 129 | Ga0209673_1007772 | 3300025273 | Bacteria | 4872 |
| 130 | Ga0209675_1010450 | 3300025291 | Bacteria | 3166 |
| 131 | Ga0209025_1000530 | 3300025294 | Bacteria | 72703 |
| 132 | Ga0209025_1019461 | 3300025294 | Bacteria | 3774 |
| 133 | Ga0209564_1000234 | 3300025295 | Bacteria | 121532 |
| 134 | Ga0209758_1000195 | 3300025297 | Bacteria | 133982 |
| 135 | Ga0209758_1000514 | 3300025297 | Bacteria | 62177 |
| 136 | Ga0209758_1035342 | 3300025297 | Bacteria | 1971 |
| 137 | Ga0209256_1000992 | 3300025299 | Bacteria | 33792 |
| 138 | Ga0207426_1000299 | 3300025302 | Bacteria | 97846 |
| 139 | Ga0209051_1012619 | 3300025303 | Bacteria | 4076 |
| 140 | Ga0207696_1000030 | 3300025711 | Bacteria | 395961 |
| 141 | Ga0207696_1000037 | 3300025711 | Bacteria | 334893 |
| 142 | Ga0207696_1002602 | 3300025711 | Bacteria | 8756 |
| 143 | Ga0207696_1003306 | 3300025711 | Bacteria | 7428 |
| 144 | Ga0207655_1000673 | 3300025728 | Bacteria | 40069 |
| 145 | Ga0207655_1003170 | 3300025728 | Bacteria | 12416 |
| 146 | Ga0207655_1003696 | 3300025728 | Bacteria | 11271 |
| 147 | Ga0207655_1007562 | 3300025728 | Bacteria | 7034 |
| 148 | Ga0207655_1009180 | 3300025728 | Bacteria | 6177 |
| 149 | Ga0207655_1027280 | 3300025728 | Bacteria | 2723 |
| 150 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 151 | Ga0207713_1000015 | 3300025735 | Bacteria | 424741 |
| 152 | Ga0207642_10019392 | 3300025899 | Bacteria | 2632 |
| 153 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 154 | Ga0207662_10004749 | 3300025918 | Bacteria | 7180 |
| 155 | Ga0207650_10089943 | 3300025925 | Bacteria | 2344 |
| 156 | Ga0207659_10038480 | 3300025926 | Bacteria | 3327 |
| 157 | Ga0207644_10222461 | 3300025931 | Bacteria | 1497 |
| 158 | Ga0207706_10030049 | 3300025933 | Bacteria | 4849 |
| 159 | Ga0207709_10018995 | 3300025935 | Bacteria | 3857 |
| 160 | Ga0207709_10087386 | 3300025935 | Bacteria | 2026 |
| 161 | Ga0207670_10054550 | 3300025936 | Bacteria | 2697 |
| 162 | Ga0207669_10002812 | 3300025937 | Bacteria | 7457 |
| 163 | Ga0207704_10079779 | 3300025938 | Bacteria | 2110 |
| 164 | Ga0207691_10005888 | 3300025940 | Bacteria | 11842 |
| 165 | Ga0207711_10017547 | 3300025941 | Bacteria | 5946 |
| 166 | Ga0207689_10007009 | 3300025942 | Bacteria | 9908 |
| 167 | Ga0207667_10247139 | 3300025949 | Bacteria | 1825 |
| 168 | Ga0207668_10007866 | 3300025972 | Bacteria | 6337 |
| 169 | Ga0207639_10327034 | 3300026041 | Bacteria | 1363 |
| 170 | Ga0207639_10426223 | 3300026041 | Bacteria | 1200 |
| 171 | Ga0207678_10054040 | 3300026067 | Bacteria | 3460 |
| 172 | Ga0207708_10009068 | 3300026075 | Bacteria | 7360 |
| 173 | Ga0207648_10004526 | 3300026089 | Bacteria | 14249 |
| 174 | Ga0207674_10027567 | 3300026116 | Bacteria | 6006 |
| 175 | Ga0207674_10035089 | 3300026116 | Bacteria | 5236 |
| 176 | Ga0207674_10058113 | 3300026116 | Bacteria | 3920 |
| 177 | Ga0207674_10182102 | 3300026116 | Bacteria | 2052 |
| 178 | Ga0209281_1000765 | 3300027111 | Bacteria | 30782 |
| 179 | Ga0209371_1000017 | 3300027312 | Bacteria | 625776 |
| 180 | Ga0209371_1000033 | 3300027312 | Bacteria | 381084 |
| 181 | Ga0209371_1000075 | 3300027312 | Bacteria | 196676 |
| 182 | Ga0209371_1000183 | 3300027312 | Bacteria | 91570 |
| 183 | Ga0207428_10000079 | 3300027907 | Bacteria | 136472 |
| 184 | Ga0268265_10033652 | 3300028380 | Bacteria | 3728 |
| 185 | Ga0307515_10000154 | 3300028794 | Bacteria | 166582 |
| 186 | Ga0307515_10000252 | 3300028794 | Bacteria | 132500 |
| 187 | Ga0307515_10000506 | 3300028794 | Bacteria | 93172 |
| 188 | Ga0307515_10055581 | 3300028794 | Bacteria | 5779 |
| 189 | Ga0268256_1000036 | 3300030500 | Bacteria | 370250 |
| 190 | Ga0268256_1000068 | 3300030500 | Bacteria | 196676 |
| 191 | Ga0268256_1000155 | 3300030500 | Bacteria | 91570 |
| 192 | Ga0268256_1000652 | 3300030500 | Bacteria | 26448 |
| 193 | Ga0307512_10076183 | 3300030522 | Bacteria | 2448 |
| 194 | Ga0316181_1074575 | 3300030744 | Bacteria | 1620 |
| 195 | Ga0307513_10002254 | 3300031456 | Bacteria | 26926 |
| 196 | Ga0307513_10022796 | 3300031456 | Bacteria | 7348 |
| 197 | Ga0307513_10026198 | 3300031456 | Bacteria | 6729 |
| 198 | Ga0307513_10085649 | 3300031456 | Bacteria | 3233 |
| 199 | Ga0307509_10001872 | 3300031507 | Bacteria | 34763 |
| 200 | Ga0307509_10019418 | 3300031507 | Bacteria | 7752 |
| 201 | Ga0307509_10026683 | 3300031507 | Bacteria | 6437 |
| 202 | Ga0307408_100060235 | 3300031548 | Bacteria | 2766 |
| 203 | Ga0307508_10000856 | 3300031616 | Bacteria | 35350 |
| 204 | Ga0307508_10120579 | 3300031616 | Bacteria | 2225 |
| 205 | Ga0307514_10013902 | 3300031649 | Bacteria | 6669 |
| 206 | Ga0307410_10002601 | 3300031852 | Bacteria | 8772 |
| 207 | Ga0307410_10124064 | 3300031852 | Bacteria | 1888 |
| 208 | Ga0307410_10147044 | 3300031852 | Bacteria | 1750 |
| 209 | Ga0307406_10064097 | 3300031901 | Bacteria | 2383 |
| 210 | Ga0307407_10050867 | 3300031903 | Bacteria | 2372 |
| 211 | Ga0307407_10100885 | 3300031903 | Bacteria | 1791 |
| 212 | Ga0307412_10044851 | 3300031911 | Bacteria | 2886 |
| 213 | Ga0307409_100174815 | 3300031995 | Bacteria | 1894 |
| 214 | Ga0307409_100309381 | 3300031995 | Bacteria | 1474 |
| 215 | Ga0307416_100098360 | 3300032002 | Bacteria | 2537 |
| 216 | Ga0307416_100147574 | 3300032002 | Bacteria | 2151 |
| 217 | Ga0307414_10005843 | 3300032004 | Bacteria | 6805 |
| 218 | Ga0307411_10001057 | 3300032005 | Bacteria | 10666 |
| 219 | Ga0307411_10307278 | 3300032005 | Bacteria | 1275 |
| 220 | Ga0307415_100006784 | 3300032126 | Bacteria | 6212 |
| 221 | Ga0307415_100122037 | 3300032126 | Bacteria | 1956 |
| 222 | Ga0307415_100157818 | 3300032126 | Bacteria | 1754 |
| 223 | Ga0307510_10213443 | 3300033180 | Bacteria | 1450 |
| 224 | Ga0439438_000005 | 3300041405 | Bacteria | 408610 |
| 225 | Ga0439438_014750 | 3300041405 | Bacteria | 2318 |
| 226 | Ga0439439_0014485 | 3300041406 | Bacteria | 1921 |
| 227 | Ga0439447_003169 | 3300041407 | Bacteria | 5859 |
| 228 | Ga0439466_0000009 | 3300041411 | Bacteria | 232657 |
| 229 | Ga0439465_0006701 | 3300041413 | Bacteria | 3656 |
| 230 | Ga0451841_0122940 | 3300041498 | Bacteria | 1660 |
| 231 | Ga0439445_0013306 | 3300042004 | Bacteria | 1991 |
| 232 | Ga0439432_011630 | 3300042006 | Bacteria | 3031 |
| 233 | Ga0439449_0014106 | 3300042007 | Bacteria | 3006 |
| 234 | Ga0439449_0124386 | 3300042007 | Bacteria | 958 |
| 235 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 236 | Ga0450907_000466 | 3300042146 | Bacteria | 11488 |
| 237 | Ga0439446_0013487 | 3300042156 | Bacteria | 2243 |
| 238 | Ga0439464_0004430 | 3300042439 | Bacteria | 3593 |
| 239 | Ga0466963_0006148 | 3300044694 | Bacteria | 7086 |
| 240 | Ga0466970_0001082 | 3300044765 | Bacteria | 13195 |
| 241 | Ga0466957_0012786 | 3300044842 | Bacteria | 4864 |
| 242 | Ga0466958_0060735 | 3300045836 | Bacteria | 2301 |
| 243 | Ga0466967_0254382 | 3300045976 | Bacteria | 1679 |
| 244 | Ga0495617_004042 | 3300046452 | Bacteria | 5391 |
| 245 | Ga0495627_006782 | 3300046453 | Bacteria | 4455 |
| 246 | Ga0495592_0021281 | 3300046454 | Bacteria | 4932 |
| 247 | Ga0495590_0029175 | 3300046457 | Bacteria | 1934 |
| 248 | Ga0495591_000012 | 3300046458 | Bacteria | 274403 |
| 249 | Ga0495591_001060 | 3300046458 | Bacteria | 18495 |
| 250 | Ga0495629_0077213 | 3300046459 | Bacteria | 2325 |
| 251 | Ga0495638_0000077 | 3300046460 | Bacteria | 158724 |
| 252 | Ga0495638_0000218 | 3300046460 | Bacteria | 79814 |
| 253 | Ga0495638_0001437 | 3300046460 | Bacteria | 21570 |
| 254 | Ga0495638_0007842 | 3300046460 | Bacteria | 7619 |
| 255 | Ga0495638_0033069 | 3300046460 | Bacteria | 3308 |
| 256 | Ga0495638_0051254 | 3300046460 | Bacteria | 2574 |
| 257 | Ga0495650_0000026 | 3300046471 | Bacteria | 476029 |
| 258 | Ga0495650_0000106 | 3300046471 | Bacteria | 202178 |
| 259 | Ga0495650_0025078 | 3300046471 | Bacteria | 2803 |
| 260 | Ga0495650_0075839 | 3300046471 | Bacteria | 1308 |
| 261 | Ga0495605_0006656 | 3300046474 | Bacteria | 6619 |
| 262 | Ga0495605_0025655 | 3300046474 | Bacteria | 3070 |
| 263 | Ga0495605_0065456 | 3300046474 | Bacteria | 1728 |
| 264 | Ga0495662_0000315 | 3300046476 | Bacteria | 21018 |
| 265 | Ga0495584_0029796 | 3300046491 | Bacteria | 2765 |
| 266 | Ga0495585_0011922 | 3300046492 | Bacteria | 5133 |
| 267 | Ga0495607_0004379 | 3300046501 | Bacteria | 10406 |
| 268 | Ga0495607_0008326 | 3300046501 | Bacteria | 7092 |
| 269 | Ga0495607_0081114 | 3300046501 | Bacteria | 1782 |
| 270 | Ga0495583_0000749 | 3300046506 | Bacteria | 41285 |
| 271 | Ga0495583_0007423 | 3300046506 | Bacteria | 6891 |
| 272 | Ga0495583_0127185 | 3300046506 | Bacteria | 1068 |
| 273 | Ga0495606_0000816 | 3300046507 | Bacteria | 47367 |
| 274 | Ga0495606_0017410 | 3300046507 | Bacteria | 5434 |
| 275 | Ga0495606_0037044 | 3300046507 | Bacteria | 3315 |
| 276 | Ga0495606_0188145 | 3300046507 | Bacteria | 1185 |
| 277 | Ga0495610_0011178 | 3300046512 | Bacteria | 5506 |
| 278 | Ga0495610_0023063 | 3300046512 | Bacteria | 3391 |
| 279 | Ga0495610_0034364 | 3300046512 | Bacteria | 2612 |
| 280 | Ga0495610_0052858 | 3300046512 | Bacteria | 1970 |
| 281 | Ga0495610_0065604 | 3300046512 | Bacteria | 1712 |
| 282 | Ga0495610_0111951 | 3300046512 | Bacteria | 1208 |
| 283 | Ga0495616_0005102 | 3300046513 | Bacteria | 8161 |
| 284 | Ga0495616_0019065 | 3300046513 | Bacteria | 3750 |
| 285 | Ga0495616_0070571 | 3300046513 | Bacteria | 1691 |
| 286 | Ga0495620_0000045 | 3300046515 | Bacteria | 109595 |
| 287 | Ga0495620_0001359 | 3300046515 | Bacteria | 14800 |
| 288 | Ga0495631_0008932 | 3300046518 | Bacteria | 5026 |
| 289 | Ga0495631_0070413 | 3300046518 | Bacteria | 1512 |
| 290 | Ga0495631_0113138 | 3300046518 | Bacteria | 1167 |
| 291 | Ga0495632_0000437 | 3300046519 | Bacteria | 39744 |
| 292 | Ga0495632_0008974 | 3300046519 | Bacteria | 6067 |
| 293 | Ga0495637_0000938 | 3300046520 | Bacteria | 18622 |
| 294 | Ga0495643_0001301 | 3300046522 | Bacteria | 23726 |
| 295 | Ga0495643_0024303 | 3300046522 | Bacteria | 3439 |
| 296 | Ga0495643_0057033 | 3300046522 | Bacteria | 2082 |
| 297 | Ga0495643_0078855 | 3300046522 | Bacteria | 1718 |
| 298 | Ga0495644_0010649 | 3300046523 | Bacteria | 3542 |
| 299 | Ga0495648_0009401 | 3300046524 | Bacteria | 7586 |
| 300 | Ga0495648_0018761 | 3300046524 | Bacteria | 4882 |
| 301 | Ga0495648_0023176 | 3300046524 | Bacteria | 4258 |
| 302 | Ga0495648_0029018 | 3300046524 | Bacteria | 3677 |
| 303 | Ga0495648_0083485 | 3300046524 | Bacteria | 1810 |
| 304 | Ga0495648_0158451 | 3300046524 | Bacteria | 1173 |
| 305 | Ga0495663_0002152 | 3300046525 | Bacteria | 6007 |
| 306 | Ga0495654_0000021 | 3300046530 | Bacteria | 270163 |
| 307 | Ga0495654_0000497 | 3300046530 | Bacteria | 32203 |
| 308 | Ga0495654_0001498 | 3300046530 | Bacteria | 15974 |
| 309 | Ga0495654_0002119 | 3300046530 | Bacteria | 12962 |
| 310 | Ga0495654_0043991 | 3300046530 | Bacteria | 2211 |
| 311 | Ga0495654_0121012 | 3300046530 | Bacteria | 1185 |
| 312 | Ga0495609_0000419 | 3300046538 | Bacteria | 35536 |
| 313 | Ga0495609_0026801 | 3300046538 | Bacteria | 2637 |
| 314 | Ga0495597_0013560 | 3300046542 | Bacteria | 3899 |
| 315 | Ga0495622_0024464 | 3300046557 | Bacteria | 2820 |
| 316 | Ga0495633_0031969 | 3300046558 | Bacteria | 2545 |
| 317 | Ga0495668_0022364 | 3300046616 | Bacteria | 3615 |
| 318 | Ga0495668_0022886 | 3300046616 | Bacteria | 3569 |
| 319 | Ga0495668_0038827 | 3300046616 | Bacteria | 2659 |
| 320 | Ga0495611_0000804 | 3300046648 | Bacteria | 17407 |
| 321 | Ga0495611_0068421 | 3300046648 | Bacteria | 1621 |
| 322 | Ga0495611_0117122 | 3300046648 | Bacteria | 1242 |
| 323 | Ga0495625_0002481 | 3300046660 | Bacteria | 19883 |
| 324 | Ga0495625_0004783 | 3300046660 | Bacteria | 12660 |
| 325 | Ga0495625_0025179 | 3300046660 | Bacteria | 4515 |
| 326 | Ga0495625_0033428 | 3300046660 | Bacteria | 3803 |
| 327 | Ga0495625_0209364 | 3300046660 | Bacteria | 1282 |
| 328 | Ga0495635_0141076 | 3300046663 | Bacteria | 1641 |
| 329 | Ga0495661_0004792 | 3300046665 | Bacteria | 9703 |
| 330 | Ga0495661_0013097 | 3300046665 | Bacteria | 5581 |
| 331 | Ga0495588_0000521 | 3300046674 | Bacteria | 18591 |
| 332 | Ga0495588_0001026 | 3300046674 | Bacteria | 12146 |
| 333 | Ga0495588_0099306 | 3300046674 | Bacteria | 1529 |
| 334 | Ga0495613_0000804 | 3300046689 | Bacteria | 24340 |
| 335 | Ga0495624_0058562 | 3300046690 | Bacteria | 2419 |
| 336 | Ga0495670_0019954 | 3300046691 | Bacteria | 3303 |
| 337 | Ga0495671_0000079 | 3300046692 | Bacteria | 93288 |
| 338 | Ga0495671_0002261 | 3300046692 | Bacteria | 12245 |
| 339 | Ga0495649_0000237 | 3300046694 | Bacteria | 48559 |
| 340 | Ga0495649_0002547 | 3300046694 | Bacteria | 12774 |
| 341 | Ga0495649_0078984 | 3300046694 | Bacteria | 1760 |
| 342 | Ga0495649_0154135 | 3300046694 | Bacteria | 1206 |
| 343 | Ga0495660_0000004 | 3300046810 | Bacteria | 1003183 |
| 344 | Ga0495660_0000029 | 3300046810 | Bacteria | 228905 |
| 345 | Ga0495660_0012644 | 3300046810 | Bacteria | 4899 |
| 346 | Ga0495660_0027154 | 3300046810 | Bacteria | 3239 |
| 347 | Ga0495636_0008470 | 3300047318 | Bacteria | 4058 |
| 348 | Ga0495672_0000001 | 3300047320 | Bacteria | 1458820 |
| 349 | Ga0495672_0000053 | 3300047320 | Bacteria | 233823 |
| 350 | Ga0495683_0017012 | 3300047323 | Bacteria | 3771 |
| 351 | Ga0495687_000090 | 3300047443 | Bacteria | 141153 |
| 352 | Ga0495687_001665 | 3300047443 | Bacteria | 19940 |
| 353 | Ga0495687_023268 | 3300047443 | Bacteria | 2961 |
| 354 | Ga0495687_038849 | 3300047443 | Bacteria | 2109 |
| 355 | Ga0495679_007164 | 3300047446 | Bacteria | 4686 |
| 356 | Ga0495673_0000810 | 3300047469 | Bacteria | 29322 |
| 357 | Ga0495681_0001033 | 3300047470 | Bacteria | 21264 |
| 358 | Ga0495686_0000157 | 3300047472 | Bacteria | 130757 |
| 359 | Ga0496100_0077096 | 3300048903 | Bacteria | 2240 |
| 360 | Ga0496102_0010526 | 3300048905 | Bacteria | 7963 |
| 361 | Ga0496104_0000895 | 3300048907 | Bacteria | 25644 |
| 362 | Ga0496105_0001631 | 3300048908 | Bacteria | 15959 |
| 363 | Ga0496106_0162871 | 3300048909 | Bacteria | 1765 |
| 364 | Ga0496110_0366778 | 3300048913 | Bacteria | 1312 |
| 365 | Ga0496110_0405752 | 3300048913 | Bacteria | 1242 |
| 366 | Ga0496112_0019104 | 3300048915 | Bacteria | 6460 |
| 367 | Ga0496116_0000074 | 3300048919 | Bacteria | 231767 |
| 368 | Ga0496116_0000206 | 3300048919 | Bacteria | 112462 |
| 369 | Ga0496117_0000022 | 3300048920 | Bacteria | 439512 |
| 370 | Ga0496117_0000268 | 3300048920 | Bacteria | 98537 |
| 371 | Ga0496117_0000643 | 3300048920 | Bacteria | 56275 |
| 372 | Ga0496118_0000007 | 3300048921 | Bacteria | 650986 |
| 373 | Ga0496118_0000085 | 3300048921 | Bacteria | 179731 |
| 374 | Ga0496118_0000688 | 3300048921 | Bacteria | 54924 |
| 375 | Ga0496118_0063689 | 3300048921 | Bacteria | 2711 |
| 376 | Ga0496119_0000012 | 3300048922 | Bacteria | 411917 |
| 377 | Ga0496119_0000162 | 3300048922 | Bacteria | 92734 |
| 378 | Ga0496119_0006224 | 3300048922 | Bacteria | 11146 |
| 379 | Ga0496119_0084221 | 3300048922 | Bacteria | 1824 |
| 380 | Ga0496120_0000004 | 3300048923 | Bacteria | 534793 |
| 381 | Ga0496120_0000107 | 3300048923 | Bacteria | 139739 |
| 382 | Ga0496120_0107760 | 3300048923 | Bacteria | 1460 |
| 383 | Ga0496121_0000504 | 3300048924 | Bacteria | 74639 |
| 384 | Ga0496121_0015149 | 3300048924 | Bacteria | 8107 |
| 385 | Ga0496122_0000064 | 3300048925 | Bacteria | 239959 |
| 386 | Ga0496122_0006650 | 3300048925 | Bacteria | 13177 |
| 387 | Ga0496122_0008815 | 3300048925 | Bacteria | 10777 |
| 388 | Ga0496122_0163987 | 3300048925 | Bacteria | 1350 |
| 389 | Ga0496123_0000049 | 3300048926 | Bacteria | 239949 |
| 390 | Ga0496123_0000543 | 3300048926 | Bacteria | 64856 |
| 391 | Ga0496123_0003729 | 3300048926 | Bacteria | 16752 |
| 392 | Ga0496123_0033009 | 3300048926 | Bacteria | 3733 |
| 393 | Ga0496123_0058208 | 3300048926 | Bacteria | 2509 |
| 394 | Ga0496124_0000027 | 3300048927 | Bacteria | 376097 |
| 395 | Ga0496124_0000216 | 3300048927 | Bacteria | 112485 |
| 396 | Ga0496124_0012871 | 3300048927 | Bacteria | 8216 |
| 397 | Ga0496124_0017248 | 3300048927 | Bacteria | 6811 |
| 398 | Ga0496124_0025126 | 3300048927 | Bacteria | 5401 |
| 399 | Ga0496124_0026922 | 3300048927 | Bacteria | 5175 |
| 400 | Ga0496124_0032762 | 3300048927 | Bacteria | 4583 |
| 401 | Ga0496124_0128672 | 3300048927 | Bacteria | 2014 |
| 402 | Ga0496125_0000305 | 3300048928 | Bacteria | 96581 |
| 403 | Ga0496125_0027077 | 3300048928 | Bacteria | 5206 |
| 404 | Ga0496125_0094204 | 3300048928 | Bacteria | 2232 |
| 405 | Ga0496126_0008230 | 3300048929 | Bacteria | 11268 |
| 406 | Ga0496126_0021737 | 3300048929 | Bacteria | 6258 |
| 407 | Ga0496126_0199349 | 3300048929 | Bacteria | 1691 |
| 408 | Ga0495678_000059 | 3300049459 | Bacteria | 143694 |
| 409 | Ga0495678_000991 | 3300049459 | Bacteria | 24332 |
| 410 | Ga0495682_0000001 | 3300049460 | Bacteria | 1559116 |
| 411 | Ga0495682_0001980 | 3300049460 | Bacteria | 10125 |
| 412 | Ga0495682_0010492 | 3300049460 | Bacteria | 3586 |
| 413 | Ga0495682_0033576 | 3300049460 | Bacteria | 1894 |
| 414 | Ga0501036_0030409 | 3300049572 | Bacteria | 4562 |
| 415 | Ga0501036_0105188 | 3300049572 | Bacteria | 2387 |
| 416 | Ga0501038_0202208 | 3300049574 | Bacteria | 1594 |
| 417 | Ga0501039_0186981 | 3300049575 | Bacteria | 1629 |
| 418 | Ga0501040_0027447 | 3300049576 | Bacteria | 3834 |
| 419 | Ga0501040_0068022 | 3300049576 | Bacteria | 2456 |
| 420 | Ga0501042_0027489 | 3300049578 | Bacteria | 4001 |
| 421 | Ga0501071_0055094 | 3300049587 | Bacteria | 2870 |
| 422 | Ga0501072_0480418 | 3300049588 | Bacteria | 983 |
| 423 | Ga0501074_0014446 | 3300049590 | Bacteria | 5746 |
| 424 | Ga0501075_0057576 | 3300049591 | Bacteria | 2926 |
| 425 | Ga0501075_0117698 | 3300049591 | Bacteria | 2020 |
| 426 | Ga0501076_0079272 | 3300049592 | Bacteria | 2636 |
| 427 | Ga0501077_0150560 | 3300049593 | Bacteria | 1476 |
| 428 | Ga0501045_0216314 | 3300049824 | Bacteria | 1427 |
| 429 | nmdc:mga03683_3718_c1 | 3300050489 | Bacteria | 4971 |
| 430 | nmdc:mga03683_95944_c1 | 3300050489 | Bacteria | 1298 |
| 431 | nmdc:mga00v17_16235_c1 | 3300050491 | Bacteria | 4196 |
| 432 | nmdc:mga0k408_73_c1 | 3300050493 | Bacteria | 47723 |
| 433 | nmdc:mga06z11_20500_c1 | 3300050494 | Bacteria | 3056 |
| 434 | nmdc:mga05p37_286806_c1 | 3300050507 | Bacteria | 1961 |
| 435 | nmdc:mga05p37_298760_c1 | 3300050507 | Bacteria | 1914 |
| 436 | nmdc:mga05p37_62294_c1 | 3300050507 | Bacteria | 4590 |
| 437 | nmdc:mga09592_82989_c1 | 3300050508 | Bacteria | 2731 |
| 438 | nmdc:mga0qj67_44634_c1 | 3300050509 | Bacteria | 3494 |
| 439 | nmdc:mga06r32_12278_c1 | 3300050510 | Bacteria | 7725 |
| 440 | nmdc:mga08y16_66784_c1 | 3300050511 | Bacteria | 3754 |
| 441 | nmdc:mga0n895_397218_c1 | 3300050512 | Bacteria | 1394 |
| 442 | nmdc:mga0rr50_400404_c1 | 3300050513 | Bacteria | 1159 |
| 443 | nmdc:mga0a205_106656_c1 | 3300050515 | Bacteria | 2699 |
| 444 | nmdc:mga0a205_212761_c1 | 3300050515 | Bacteria | 1821 |
| 445 | nmdc:mga0sz30_9195_c1 | 3300050516 | Bacteria | 3751 |
| 446 | Ga0500578_0000148 | 3300053086 | Bacteria | 83724 |
| 447 | Ga0500578_0016498 | 3300053086 | Bacteria | 4743 |
| 448 | Ga0500644_0031855 | 3300053088 | Bacteria | 1680 |
| 449 | Ga0500583_0000571 | 3300053092 | Bacteria | 11169 |
| 450 | Ga0500557_006156 | 3300053105 | Bacteria | 2689 |
| 451 | Ga0500560_000070 | 3300053107 | Bacteria | 9820 |
| 452 | Ga0500562_043768 | 3300053108 | Bacteria | 1192 |
| 453 | Ga0500569_014409 | 3300053109 | Bacteria | 1956 |
| 454 | Ga0500572_001549 | 3300053111 | Bacteria | 6149 |
| 455 | Ga0500592_008570 | 3300053116 | Bacteria | 1623 |
| 456 | Ga0500594_0000906 | 3300053118 | Bacteria | 6358 |
| 457 | Ga0500595_010875 | 3300053119 | Bacteria | 3592 |
| 458 | Ga0500597_002155 | 3300053120 | Bacteria | 5359 |
| 459 | Ga0500608_000204 | 3300053122 | Bacteria | 23691 |
| 460 | Ga0500608_014178 | 3300053122 | Bacteria | 3553 |
| 461 | Ga0500618_000278 | 3300053125 | Bacteria | 39344 |
| 462 | Ga0500618_000814 | 3300053125 | Bacteria | 17169 |
| 463 | Ga0500618_011530 | 3300053125 | Bacteria | 2341 |
| 464 | Ga0500618_011690 | 3300053125 | Bacteria | 2320 |
| 465 | Ga0500618_013987 | 3300053125 | Bacteria | 2062 |
| 466 | Ga0500621_000003 | 3300053126 | Bacteria | 596975 |
| 467 | Ga0500658_0000169 | 3300053134 | Bacteria | 30993 |
| 468 | Ga0500559_0004388 | 3300053136 | Bacteria | 6709 |
| 469 | Ga0500564_004134 | 3300053138 | Bacteria | 5766 |
| 470 | Ga0500568_0000042 | 3300053139 | Bacteria | 127026 |
| 471 | Ga0500573_0011508 | 3300053140 | Bacteria | 4955 |
| 472 | Ga0500574_000020 | 3300053141 | Bacteria | 31411 |
| 473 | Ga0500616_0000222 | 3300053153 | Bacteria | 88791 |
| 474 | Ga0500616_0051491 | 3300053153 | Bacteria | 2169 |
| 475 | Ga0500619_003044 | 3300053154 | Bacteria | 3355 |
| 476 | Ga0500622_0000331 | 3300053156 | Bacteria | 46916 |
| 477 | Ga0500622_0001696 | 3300053156 | Bacteria | 17110 |
| 478 | Ga0500624_000030 | 3300053157 | Bacteria | 105085 |
| 479 | Ga0500627_0020049 | 3300053158 | Bacteria | 2676 |
| 480 | Ga0500636_0000007 | 3300053177 | Bacteria | 171404 |
| 481 | Ga0500636_0000392 | 3300053177 | Bacteria | 24127 |
| 482 | Ga0500636_0000852 | 3300053177 | Bacteria | 16393 |
| 483 | Ga0500636_0023168 | 3300053177 | Bacteria | 3670 |
| 484 | Ga0500636_0049767 | 3300053177 | Bacteria | 2464 |
| 485 | Ga0500636_0049999 | 3300053177 | Bacteria | 2458 |
| 486 | Ga0500567_059521 | 3300053723 | Bacteria | 1715 |
| 487 | Ga0500609_000493 | 3300053731 | Bacteria | 5879 |
| 488 | Ga0590071_000686 | 3300059421 | Bacteria | 9599 |
| 489 | Ga0590071_004845 | 3300059421 | Bacteria | 3248 |
| 490 | Ga0590074_003805 | 3300059423 | Bacteria | 2499 |
| 491 | Ga0590075_000356 | 3300059424 | Bacteria | 12686 |
| 492 | Ga0590075_001623 | 3300059424 | Bacteria | 5553 |
| 493 | Ga0590077_000237 | 3300059426 | Bacteria | 15719 |
| 494 | Ga0590077_000555 | 3300059426 | Bacteria | 10325 |
| 495 | Ga0590077_004966 | 3300059426 | Bacteria | 2721 |
| 496 | Ga0501082_0248393 | 3300060353 | Bacteria | 1548 |
| 497 | Ga0530510_0060597 | 3300061734 | Bacteria | 2739 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042007 | Ga0439449_0124386 | Ga0439449_0124386_11_886 | 267 |
| 2 | 3300050513 | nmdc:mga0rr50_400404_c1 | nmdc:mga0rr50_400404_c1_190_1149 | 268 |
| 3 | 3300049574 | Ga0501038_0202208 | Ga0501038_0202208_560_1531 | 275 |
| 4 | 3300049575 | Ga0501039_0186981 | Ga0501039_0186981_618_1589 | 275 |
| 5 | 3300049576 | Ga0501040_0068022 | Ga0501040_0068022_53_1024 | 275 |
| 6 | 3300049578 | Ga0501042_0027489 | Ga0501042_0027489_2963_3934 | 275 |
| 7 | 3300049587 | Ga0501071_0055094 | Ga0501071_0055094_1879_2850 | 275 |
| 8 | 3300049591 | Ga0501075_0057576 | Ga0501075_0057576_92_1063 | 275 |
| 9 | 3300049572 | Ga0501036_0030409 | Ga0501036_0030409_3557_4528 | 276 |
| 10 | 3300050512 | nmdc:mga0n895_397218_c1 | nmdc:mga0n895_397218_c1_249_1193 | 277 |
| 11 | 3300031649 | Ga0307514_10013902 | Ga0307514_100139024 | 278 |
| 12 | 3300059426 | Ga0590077_004966 | Ga0590077_004966_1499_2464 | 278 |
| 13 | 3300028794 | Ga0307515_10055581 | Ga0307515_100555814 | 280 |
| 14 | 3300031456 | Ga0307513_10002254 | Ga0307513_1000225413 | 280 |
| 15 | 3300031507 | Ga0307509_10026683 | Ga0307509_100266833 | 281 |
| 16 | 3300031616 | Ga0307508_10000856 | Ga0307508_1000085619 | 281 |
| 17 | iso_pu_bacteria | 2513237156 | 2513988288 | 282 |
| 18 | 3300005293 | Ga0065715_10130877 | Ga0065715_101308772 | 283 |
| 19 | 3300005331 | Ga0070670_100002435 | Ga0070670_1000024359 | 283 |
| 20 | 3300005564 | Ga0070664_100131425 | Ga0070664_1001314252 | 283 |
| 21 | 3300005577 | Ga0068857_100008811 | Ga0068857_1000088116 | 283 |
| 22 | 3300006051 | Ga0075364_10045310 | Ga0075364_100453103 | 283 |
| 23 | 3300006178 | Ga0075367_10034886 | Ga0075367_100348862 | 283 |
| 24 | 3300006195 | Ga0075366_10000078 | Ga0075366_100000788 | 283 |
| 25 | 3300009094 | Ga0111539_10000234 | Ga0111539_1000023439 | 283 |
| 26 | 3300026116 | Ga0207674_10027567 | Ga0207674_100275674 | 283 |
| 27 | 3300027907 | Ga0207428_10000079 | Ga0207428_1000007990 | 283 |
| 28 | 3300050491 | nmdc:mga00v17_16235_c1 | nmdc:mga00v17_16235_c1_2902_3846 | 283 |
| 29 | 3300050493 | nmdc:mga0k408_73_c1 | nmdc:mga0k408_73_c1_17140_18084 | 283 |
| 30 | 3300050494 | nmdc:mga06z11_20500_c1 | nmdc:mga06z11_20500_c1_1246_2190 | 283 |
| 31 | 3300050507 | nmdc:mga05p37_62294_c1 | nmdc:mga05p37_62294_c1_37_981 | 283 |
| 32 | 3300050508 | nmdc:mga09592_82989_c1 | nmdc:mga09592_82989_c1_924_1868 | 283 |
| 33 | 3300050510 | nmdc:mga06r32_12278_c1 | nmdc:mga06r32_12278_c1_308_1252 | 283 |
| 34 | 3300050511 | nmdc:mga08y16_66784_c1 | nmdc:mga08y16_66784_c1_2324_3268 | 283 |
| 35 | 3300009147 | Ga0114129_10013211 | Ga0114129_100132116 | 285 |
| 36 | 3300025931 | Ga0207644_10222461 | Ga0207644_102224612 | 285 |
| 37 | 3300031548 | Ga0307408_100060235 | Ga0307408_1000602352 | 285 |
| 38 | 3300031852 | Ga0307410_10002601 | Ga0307410_100026015 | 285 |
| 39 | 3300031901 | Ga0307406_10064097 | Ga0307406_100640972 | 285 |
| 40 | 3300031903 | Ga0307407_10050867 | Ga0307407_100508672 | 285 |
| 41 | 3300031911 | Ga0307412_10044851 | Ga0307412_100448513 | 285 |
| 42 | 3300032002 | Ga0307416_100098360 | Ga0307416_1000983602 | 285 |
| 43 | 3300032004 | Ga0307414_10005843 | Ga0307414_100058435 | 285 |
| 44 | 3300032005 | Ga0307411_10001057 | Ga0307411_100010575 | 285 |
| 45 | 3300032126 | Ga0307415_100006784 | Ga0307415_1000067842 | 285 |
| 46 | 3300050507 | nmdc:mga05p37_286806_c1 | nmdc:mga05p37_286806_c1_198_1139 | 285 |
| 47 | 3300050515 | nmdc:mga0a205_106656_c1 | nmdc:mga0a205_106656_c1_1380_2324 | 285 |
| 48 | 3300048913 | Ga0496110_0366778 | Ga0496110_0366778_168_1157 | 286 |
| 49 | 3300005445 | Ga0070708_100079193 | Ga0070708_1000791932 | 287 |
| 50 | 3300046460 | Ga0495638_0051254 | Ga0495638_0051254_1133_2005 | 287 |
| 51 | 3300005471 | Ga0070698_100009329 | Ga0070698_1000093298 | 288 |
| 52 | 3300053156 | Ga0500622_0001696 | Ga0500622_0001696_13299_14270 | 288 |
| 53 | 3300005295 | Ga0065707_10145681 | Ga0065707_101456812 | 289 |
| 54 | 3300005354 | Ga0070675_100097626 | Ga0070675_1000976262 | 289 |
| 55 | 3300005577 | Ga0068857_100021708 | Ga0068857_1000217082 | 289 |
| 56 | 3300006844 | Ga0075428_100259882 | Ga0075428_1002598822 | 289 |
| 57 | 3300009553 | Ga0105249_10003680 | Ga0105249_100036803 | 289 |
| 58 | 3300014325 | Ga0163163_10173406 | Ga0163163_101734062 | 289 |
| 59 | 3300014326 | Ga0157380_10128892 | Ga0157380_101288922 | 289 |
| 60 | 3300025925 | Ga0207650_10089943 | Ga0207650_100899432 | 289 |
| 61 | 3300026116 | Ga0207674_10035089 | Ga0207674_100350893 | 289 |
| 62 | 3300030522 | Ga0307512_10076183 | Ga0307512_100761832 | 289 |
| 63 | 3300046474 | Ga0495605_0065456 | Ga0495605_0065456_10_882 | 290 |
| 64 | 3300048922 | Ga0496119_0000012 | Ga0496119_0000012_44213_45181 | 290 |
| 65 | 3300048923 | Ga0496120_0000004 | Ga0496120_0000004_366737_367705 | 290 |
| 66 | 3300049460 | Ga0495682_0033576 | Ga0495682_0033576_10_885 | 290 |
| 67 | 3300053158 | Ga0500627_0020049 | Ga0500627_0020049_848_1825 | 290 |
| 68 | 3300042156 | Ga0439446_0013487 | Ga0439446_0013487_1051_1998 | 291 |
| 69 | 3300046460 | Ga0495638_0007842 | Ga0495638_0007842_3546_4496 | 291 |
| 70 | 3300050507 | nmdc:mga05p37_298760_c1 | nmdc:mga05p37_298760_c1_749_1687 | 291 |
| 71 | 3300009011 | Ga0105251_10003991 | Ga0105251_100039919 | 292 |
| 72 | 3300009148 | Ga0105243_10021905 | Ga0105243_100219053 | 292 |
| 73 | 3300025728 | Ga0207655_1007562 | Ga0207655_10075625 | 292 |
| 74 | 3300025735 | Ga0207713_1000015 | Ga0207713_1000015298 | 292 |
| 75 | 3300025935 | Ga0207709_10087386 | Ga0207709_100873862 | 292 |
| 76 | 3300048926 | Ga0496123_0058208 | Ga0496123_0058208_926_1897 | 292 |
| 77 | 3300048927 | Ga0496124_0025126 | Ga0496124_0025126_3432_4403 | 292 |
| 78 | 3300048929 | Ga0496126_0021737 | Ga0496126_0021737_1923_2894 | 292 |
| 79 | 3300006846 | Ga0075430_100101975 | Ga0075430_1001019752 | 293 |
| 80 | 3300050509 | nmdc:mga0qj67_44634_c1 | nmdc:mga0qj67_44634_c1_896_1882 | 293 |
| 81 | 3300005366 | Ga0070659_100307990 | Ga0070659_1003079901 | 294 |
| 82 | 3300053116 | Ga0500592_008570 | Ga0500592_008570_504_1454 | 294 |
| 83 | 3300005338 | Ga0068868_100386146 | Ga0068868_1003861461 | 295 |
| 84 | 3300005347 | Ga0070668_100104238 | Ga0070668_1001042382 | 295 |
| 85 | 3300005354 | Ga0070675_100026142 | Ga0070675_1000261423 | 295 |
| 86 | 3300005356 | Ga0070674_100040034 | Ga0070674_1000400343 | 295 |
| 87 | 3300005364 | Ga0070673_100244833 | Ga0070673_1002448332 | 295 |
| 88 | 3300005366 | Ga0070659_100263277 | Ga0070659_1002632772 | 295 |
| 89 | 3300005438 | Ga0070701_10005828 | Ga0070701_100058283 | 295 |
| 90 | 3300005455 | Ga0070663_100022264 | Ga0070663_1000222644 | 295 |
| 91 | 3300005457 | Ga0070662_100069133 | Ga0070662_1000691332 | 295 |
| 92 | 3300005459 | Ga0068867_100002314 | Ga0068867_1000023143 | 295 |
| 93 | 3300005466 | Ga0070685_10005378 | Ga0070685_100053782 | 295 |
| 94 | 3300005539 | Ga0068853_100494613 | Ga0068853_1004946131 | 295 |
| 95 | 3300005543 | Ga0070672_100182204 | Ga0070672_1001822042 | 295 |
| 96 | 3300005615 | Ga0070702_100060783 | Ga0070702_1000607832 | 295 |
| 97 | 3300005617 | Ga0068859_100047448 | Ga0068859_1000474483 | 295 |
| 98 | 3300005718 | Ga0068866_10112126 | Ga0068866_101121262 | 295 |
| 99 | 3300005841 | Ga0068863_100017887 | Ga0068863_1000178875 | 295 |
| 100 | 3300005842 | Ga0068858_100113438 | Ga0068858_1001134382 | 295 |
| 101 | 3300005843 | Ga0068860_100100376 | Ga0068860_1001003762 | 295 |
| 102 | 3300005844 | Ga0068862_100191104 | Ga0068862_1001911042 | 295 |
| 103 | 3300006178 | Ga0075367_10087247 | Ga0075367_100872472 | 295 |
| 104 | 3300006237 | Ga0097621_100061949 | Ga0097621_1000619492 | 295 |
| 105 | 3300006881 | Ga0068865_100023513 | Ga0068865_1000235133 | 295 |
| 106 | 3300006931 | Ga0097620_100047456 | Ga0097620_1000474562 | 295 |
| 107 | 3300009098 | Ga0105245_10120681 | Ga0105245_101206812 | 295 |
| 108 | 3300009148 | Ga0105243_10002962 | Ga0105243_100029628 | 295 |
| 109 | 3300009177 | Ga0105248_10036940 | Ga0105248_100369403 | 295 |
| 110 | 3300013306 | Ga0163162_10247408 | Ga0163162_102474082 | 295 |
| 111 | 3300013308 | Ga0157375_10045052 | Ga0157375_100450522 | 295 |
| 112 | 3300014326 | Ga0157380_10051769 | Ga0157380_100517693 | 295 |
| 113 | 3300014968 | Ga0157379_10283453 | Ga0157379_102834532 | 295 |
| 114 | 3300025899 | Ga0207642_10019392 | Ga0207642_100193923 | 295 |
| 115 | 3300025918 | Ga0207662_10004749 | Ga0207662_100047493 | 295 |
| 116 | 3300025926 | Ga0207659_10038480 | Ga0207659_100384803 | 295 |
| 117 | 3300025933 | Ga0207706_10030049 | Ga0207706_100300493 | 295 |
| 118 | 3300025935 | Ga0207709_10018995 | Ga0207709_100189954 | 295 |
| 119 | 3300025936 | Ga0207670_10054550 | Ga0207670_100545502 | 295 |
| 120 | 3300025938 | Ga0207704_10079779 | Ga0207704_100797792 | 295 |
| 121 | 3300025940 | Ga0207691_10005888 | Ga0207691_100058888 | 295 |
| 122 | 3300025941 | Ga0207711_10017547 | Ga0207711_100175474 | 295 |
| 123 | 3300025942 | Ga0207689_10007009 | Ga0207689_100070098 | 295 |
| 124 | 3300026067 | Ga0207678_10054040 | Ga0207678_100540402 | 295 |
| 125 | 3300026075 | Ga0207708_10009068 | Ga0207708_100090686 | 295 |
| 126 | 3300026089 | Ga0207648_10004526 | Ga0207648_1000452612 | 295 |
| 127 | 3300026116 | Ga0207674_10058113 | Ga0207674_100581134 | 295 |
| 128 | 3300028380 | Ga0268265_10033652 | Ga0268265_100336522 | 295 |
| 129 | 3300005563 | Ga0068855_100389481 | Ga0068855_1003894812 | 296 |
| 130 | 3300006042 | Ga0075368_10022163 | Ga0075368_100221632 | 296 |
| 131 | 3300006178 | Ga0075367_10125731 | Ga0075367_101257311 | 296 |
| 132 | 3300009545 | Ga0105237_10345119 | Ga0105237_103451192 | 296 |
| 133 | 3300010375 | Ga0105239_10142952 | Ga0105239_101429522 | 296 |
| 134 | 3300025949 | Ga0207667_10247139 | Ga0207667_102471392 | 296 |
| 135 | 3300031507 | Ga0307509_10019418 | Ga0307509_100194187 | 296 |
| 136 | 3300033180 | Ga0307510_10213443 | Ga0307510_102134432 | 296 |
| 137 | 3300046507 | Ga0495606_0037044 | Ga0495606_0037044_797_1777 | 296 |
| 138 | 3300046524 | Ga0495648_0029018 | Ga0495648_0029018_603_1583 | 296 |
| 139 | 3300046616 | Ga0495668_0022886 | Ga0495668_0022886_399_1379 | 296 |
| 140 | 3300048915 | Ga0496112_0019104 | Ga0496112_0019104_3609_4586 | 296 |
| 141 | 3300049460 | Ga0495682_0010492 | Ga0495682_0010492_2268_3248 | 296 |
| 142 | 3300050489 | nmdc:mga03683_95944_c1 | nmdc:mga03683_95944_c1_117_1058 | 296 |
| 143 | iso_pu_bacteria | 2965032056 | 2965038786 | 296 |
| 144 | 3300027312 | Ga0209371_1000033 | Ga0209371_1000033237 | 297 |
| 145 | 3300030500 | Ga0268256_1000652 | Ga0268256_100065228 | 297 |
| 146 | 3300031507 | Ga0307509_10001872 | Ga0307509_1000187230 | 297 |
| 147 | 3300053177 | Ga0500636_0023168 | Ga0500636_0023168_1127_2107 | 297 |
| 148 | 3300001989 | JGI24739J22299_10027864 | JGI24739J22299_100278642 | 298 |
| 149 | 3300009036 | Ga0105244_10007661 | Ga0105244_100076614 | 298 |
| 150 | 3300013102 | Ga0157371_10002928 | Ga0157371_100029289 | 298 |
| 151 | 3300013104 | Ga0157370_10000336 | Ga0157370_1000033635 | 298 |
| 152 | 3300025728 | Ga0207655_1027280 | Ga0207655_10272802 | 298 |
| 153 | 3300042010 | Ga0439452_000001 | Ga0439452_000001_825929_826900 | 298 |
| 154 | 3300046454 | Ga0495592_0021281 | Ga0495592_0021281_3578_4558 | 298 |
| 155 | 3300046459 | Ga0495629_0077213 | Ga0495629_0077213_238_1218 | 298 |
| 156 | 3300046476 | Ga0495662_0000315 | Ga0495662_0000315_6243_7223 | 298 |
| 157 | 3300046524 | Ga0495648_0083485 | Ga0495648_0083485_734_1714 | 298 |
| 158 | 3300046663 | Ga0495635_0141076 | Ga0495635_0141076_190_1170 | 298 |
| 159 | 3300046690 | Ga0495624_0058562 | Ga0495624_0058562_765_1745 | 298 |
| 160 | 3300048919 | Ga0496116_0000206 | Ga0496116_0000206_91001_91972 | 298 |
| 161 | 3300048920 | Ga0496117_0000643 | Ga0496117_0000643_53442_54413 | 298 |
| 162 | 3300048921 | Ga0496118_0000688 | Ga0496118_0000688_1890_2861 | 298 |
| 163 | 3300048922 | Ga0496119_0084221 | Ga0496119_0084221_733_1713 | 298 |
| 164 | 3300048927 | Ga0496124_0017248 | Ga0496124_0017248_1313_2284 | 298 |
| 165 | 3300013102 | Ga0157371_10009049 | Ga0157371_100090494 | 299 |
| 166 | 3300031456 | Ga0307513_10026198 | Ga0307513_100261988 | 299 |
| 167 | 3300032126 | Ga0307415_100122037 | Ga0307415_1001220372 | 299 |
| 168 | 3300046507 | Ga0495606_0000816 | Ga0495606_0000816_8288_9259 | 299 |
| 169 | 3300047320 | Ga0495672_0000001 | Ga0495672_0000001_76816_77787 | 299 |
| 170 | iso_pu_bacteria | 2882632389 | 2882633789 | 299 |
| 171 | 3300005366 | Ga0070659_100237175 | Ga0070659_1002371751 | 300 |
| 172 | 3300009174 | Ga0105241_10000002 | Ga0105241_10000002732 | 300 |
| 173 | 3300013100 | Ga0157373_10012370 | Ga0157373_100123703 | 300 |
| 174 | 3300025911 | Ga0207654_10000005 | Ga0207654_10000005730 | 300 |
| 175 | 3300005844 | Ga0068862_100034929 | Ga0068862_1000349291 | 302 |
| 176 | 3300046460 | Ga0495638_0033069 | Ga0495638_0033069_612_1586 | 302 |
| 177 | 3300053125 | Ga0500618_000278 | Ga0500618_000278_2249_3226 | 303 |
| 178 | 3300053731 | Ga0500609_000493 | Ga0500609_000493_3271_4248 | 304 |
| 179 | iso_pu_bacteria | 2874604998 | 2874605718 | 304 |
| 180 | 3300005356 | Ga0070674_100039543 | Ga0070674_1000395433 | 305 |
| 181 | 3300025937 | Ga0207669_10002812 | Ga0207669_100028122 | 305 |
| 182 | 3300031995 | Ga0307409_100309381 | Ga0307409_1003093812 | 305 |
| 183 | 3300026116 | Ga0207674_10182102 | Ga0207674_101821022 | 306 |
| 184 | 3300042004 | Ga0439445_0013306 | Ga0439445_0013306_186_1133 | 307 |
| 185 | 3300061734 | Ga0530510_0060597 | Ga0530510_0060597_1211_2140 | 307 |
| 186 | 3300026041 | Ga0207639_10327034 | Ga0207639_103270342 | 308 |
| 187 | 3300045836 | Ga0466958_0060735 | Ga0466958_0060735_928_1902 | 308 |
| 188 | 3300015265 | Ga0182005_1015464 | Ga0182005_10154642 | 309 |
| 189 | 3300044694 | Ga0466963_0006148 | Ga0466963_0006148_4958_5932 | 309 |
| 190 | 3300044765 | Ga0466970_0001082 | Ga0466970_0001082_8974_9948 | 309 |
| 191 | 3300044842 | Ga0466957_0012786 | Ga0466957_0012786_2041_3015 | 309 |
| 192 | 3300045976 | Ga0466967_0254382 | Ga0466967_0254382_282_1256 | 309 |
| 193 | 3300046512 | Ga0495610_0111951 | Ga0495610_0111951_36_1010 | 309 |
| 194 | 3300050515 | nmdc:mga0a205_212761_c1 | nmdc:mga0a205_212761_c1_790_1731 | 309 |
| 195 | 3300053125 | Ga0500618_000814 | Ga0500618_000814_9369_10343 | 309 |
| 196 | 3300005262 | Ga0065165_1003076 | Ga0065165_10030763 | 310 |
| 197 | 3300014497 | Ga0182008_10078705 | Ga0182008_100787052 | 310 |
| 198 | 3300026041 | Ga0207639_10426223 | Ga0207639_104262232 | 310 |
| 199 | 3300048923 | Ga0496120_0107760 | Ga0496120_0107760_269_1246 | 310 |
| 200 | 3300048926 | Ga0496123_0033009 | Ga0496123_0033009_342_1313 | 310 |
| 201 | 3300031903 | Ga0307407_10100885 | Ga0307407_101008852 | 311 |
| 202 | 3300031995 | Ga0307409_100174815 | Ga0307409_1001748152 | 311 |
| 203 | 3300032126 | Ga0307415_100157818 | Ga0307415_1001578182 | 311 |
| 204 | 3300049572 | Ga0501036_0105188 | Ga0501036_0105188_716_1657 | 311 |
| 205 | 3300049576 | Ga0501040_0027447 | Ga0501040_0027447_197_1138 | 311 |
| 206 | 3300049588 | Ga0501072_0480418 | Ga0501072_0480418_18_959 | 311 |
| 207 | 3300049590 | Ga0501074_0014446 | Ga0501074_0014446_41_982 | 311 |
| 208 | 3300049591 | Ga0501075_0117698 | Ga0501075_0117698_1059_2000 | 311 |
| 209 | 3300049592 | Ga0501076_0079272 | Ga0501076_0079272_478_1419 | 311 |
| 210 | 3300049593 | Ga0501077_0150560 | Ga0501077_0150560_20_961 | 311 |
| 211 | 3300049824 | Ga0501045_0216314 | Ga0501045_0216314_325_1266 | 311 |
| 212 | 3300053177 | Ga0500636_0000852 | Ga0500636_0000852_2504_3481 | 311 |
| 213 | 3300059421 | Ga0590071_000686 | Ga0590071_000686_7684_8625 | 311 |
| 214 | 3300059423 | Ga0590074_003805 | Ga0590074_003805_471_1412 | 311 |
| 215 | 3300059424 | Ga0590075_000356 | Ga0590075_000356_7336_8277 | 311 |
| 216 | 3300059426 | Ga0590077_000555 | Ga0590077_000555_7125_8066 | 311 |
| 217 | 3300060353 | Ga0501082_0248393 | Ga0501082_0248393_594_1535 | 311 |
| 218 | 3300006353 | Ga0075370_10044307 | Ga0075370_100443073 | 312 |
| 219 | iso_pu_bacteria | 2904504865 | 2904506044 | 312 |
| 220 | 3300031852 | Ga0307410_10124064 | Ga0307410_101240642 | 313 |
| 221 | 3300032002 | Ga0307416_100147574 | Ga0307416_1001475742 | 313 |
| 222 | 3300046512 | Ga0495610_0023063 | Ga0495610_0023063_179_1150 | 313 |
| 223 | 3300003856 | Ga0058692_1000066 | Ga0058692_100006656 | 315 |
| 224 | 3300027312 | Ga0209371_1000183 | Ga0209371_100018338 | 315 |
| 225 | 3300028794 | Ga0307515_10000154 | Ga0307515_10000154143 | 315 |
| 226 | 3300030500 | Ga0268256_1000155 | Ga0268256_100015558 | 315 |
| 227 | 3300031456 | Ga0307513_10022796 | Ga0307513_100227967 | 315 |
| 228 | 3300053088 | Ga0500644_0031855 | Ga0500644_0031855_660_1634 | 315 |
| 229 | 3300053156 | Ga0500622_0000331 | Ga0500622_0000331_17020_17994 | 315 |
| 230 | 3300048928 | Ga0496125_0027077 | Ga0496125_0027077_3806_4774 | 316 |
| 231 | iso_pu_bacteria | 2937126314 | 2937131984 | 316 |
| 232 | iso_pu_bacteria | 2970627176 | 2970632311 | 316 |
| 233 | 3300003856 | Ga0058692_1000052 | Ga0058692_100005222 | 317 |
| 234 | 3300009092 | Ga0105250_10000456 | Ga0105250_100004564 | 317 |
| 235 | 3300025711 | Ga0207696_1000030 | Ga0207696_100003073 | 317 |
| 236 | 3300046471 | Ga0495650_0075839 | Ga0495650_0075839_301_1272 | 317 |
| 237 | 3300048929 | Ga0496126_0199349 | Ga0496126_0199349_23_994 | 317 |
| 238 | iso_pu_bacteria | 2512875024 | 2512961319 | 317 |
| 239 | iso_pu_bacteria | 2513237164 | 2514035333 | 317 |
| 240 | iso_pu_bacteria | 2597489875 | 2597813060 | 317 |
| 241 | iso_pu_bacteria | 2687453392 | 2688596672 | 317 |
| 242 | iso_pu_bacteria | 2844009547 | 2844011915 | 317 |
| 243 | iso_pu_bacteria | 2856328259 | 2856329544 | 317 |
| 244 | iso_pu_bacteria | 2856334872 | 2856338174 | 317 |
| 245 | iso_pu_bacteria | 2857367948 | 2857370015 | 317 |
| 246 | iso_pu_bacteria | 2869169390 | 2869175278 | 317 |
| 247 | iso_pu_bacteria | 2869234852 | 2869240360 | 317 |
| 248 | iso_pu_bacteria | 2869242130 | 2869244343 | 317 |
| 249 | iso_pu_bacteria | 2869249662 | 2869253540 | 317 |
| 250 | iso_pu_bacteria | 2869256925 | 2869263297 | 317 |
| 251 | iso_pu_bacteria | 2869264136 | 2869270248 | 317 |
| 252 | iso_pu_bacteria | 2869271264 | 2869272313 | 317 |
| 253 | iso_pu_bacteria | 2871435913 | 2871441101 | 317 |
| 254 | iso_pu_bacteria | 2871451962 | 2871455469 | 317 |
| 255 | iso_pu_bacteria | 2871459585 | 2871464164 | 317 |
| 256 | iso_pu_bacteria | 2874109183 | 2874116044 | 317 |
| 257 | iso_pu_bacteria | 2874116593 | 2874118736 | 317 |
| 258 | iso_pu_bacteria | 2874131515 | 2874133756 | 317 |
| 259 | iso_pu_bacteria | 2874162495 | 2874166756 | 317 |
| 260 | iso_pu_bacteria | 2874168670 | 2874175944 | 317 |
| 261 | iso_pu_bacteria | 2876386047 | 2876389185 | 317 |
| 262 | iso_pu_bacteria | 2876399893 | 2876405820 | 317 |
| 263 | iso_pu_bacteria | 2876406927 | 2876411646 | 317 |
| 264 | iso_pu_bacteria | 2876420981 | 2876421773 | 317 |
| 265 | iso_pu_bacteria | 2878730984 | 2878738309 | 317 |
| 266 | iso_pu_bacteria | 2878774303 | 2878776244 | 317 |
| 267 | iso_pu_bacteria | 2878781027 | 2878782564 | 317 |
| 268 | iso_pu_bacteria | 2903513507 | 2903518774 | 317 |
| 269 | iso_pu_bacteria | 2906363423 | 2906368157 | 317 |
| 270 | iso_pu_bacteria | 2906370794 | 2906374527 | 317 |
| 271 | iso_pu_bacteria | 2906393657 | 2906399483 | 317 |
| 272 | iso_pu_bacteria | 2906401398 | 2906406248 | 317 |
| 273 | iso_pu_bacteria | 2906408224 | 2906411647 | 317 |
| 274 | iso_pu_bacteria | 2906427513 | 2906433376 | 317 |
| 275 | iso_pu_bacteria | 2922151315 | 2922151653 | 317 |
| 276 | iso_pu_bacteria | 2922172374 | 2922172480 | 317 |
| 277 | iso_pu_bacteria | 2924710171 | 2924718477 | 317 |
| 278 | iso_pu_bacteria | 2924733363 | 2924738420 | 317 |
| 279 | iso_pu_bacteria | 2924741084 | 2924745054 | 317 |
| 280 | iso_pu_bacteria | 2924748358 | 2924748689 | 317 |
| 281 | iso_pu_bacteria | 2937861824 | 2937863804 | 317 |
| 282 | iso_pu_bacteria | 2958108152 | 2958111985 | 317 |
| 283 | iso_pu_bacteria | 2958122699 | 2958124098 | 317 |
| 284 | iso_pu_bacteria | 2958137437 | 2958143320 | 317 |
| 285 | iso_pu_bacteria | 2961183825 | 2961188390 | 317 |
| 286 | iso_pu_bacteria | 2965025482 | 2965025497 | 317 |
| 287 | iso_pu_bacteria | 2965040258 | 2965044427 | 317 |
| 288 | iso_pu_bacteria | 2965089291 | 2965093480 | 317 |
| 289 | iso_pu_bacteria | 2965102966 | 2965108899 | 317 |
| 290 | iso_pu_bacteria | 2965110997 | 2965112110 | 317 |
| 291 | iso_pu_bacteria | 2968138860 | 2968144810 | 317 |
| 292 | iso_pu_bacteria | 2970489779 | 2970491206 | 317 |
| 293 | iso_pu_bacteria | 2970510686 | 2970517588 | 317 |
| 294 | iso_pu_bacteria | 2970532167 | 2970536679 | 317 |
| 295 | iso_pu_bacteria | 2970547951 | 2970551301 | 317 |
| 296 | iso_pu_bacteria | 2970619444 | 2970624292 | 317 |
| 297 | iso_pu_bacteria | 2977851361 | 2977852169 | 317 |
| 298 | iso_pu_bacteria | 2977872689 | 2977879749 | 317 |
| 299 | iso_pu_bacteria | 2977898635 | 2977898759 | 317 |
| 300 | iso_pu_bacteria | 2977907340 | 2977909450 | 317 |
| 301 | iso_pu_bacteria | 2977915119 | 2977921850 | 317 |
| 302 | iso_pu_bacteria | 2977950692 | 2977951131 | 317 |
| 303 | iso_pu_bacteria | 2977957713 | 2977961578 | 317 |
| 304 | iso_pu_bacteria | 2979772303 | 2979774088 | 317 |
| 305 | iso_pu_bacteria | 2979793036 | 2979797449 | 317 |
| 306 | iso_pu_bacteria | 2987673487 | 2987676082 | 317 |
| 307 | iso_pu_bacteria | 2996386984 | 2996391362 | 317 |
| 308 | iso_pu_bacteria | 3004195979 | 3004200649 | 317 |
| 309 | iso_pu_bacteria | 3004232784 | 3004233311 | 317 |
| 310 | iso_pu_bacteria | 3004248173 | 3004253033 | 317 |
| 311 | iso_pu_bacteria | 3004268573 | 3004274360 | 317 |
| 312 | iso_pu_bacteria | 649633066 | 649871226 | 317 |
| 313 | iso_pu_bacteria | 8004312739 | 8004315260 | 317 |
| 314 | iso_pu_bacteria | 8004361976 | 8004367775 | 317 |
| 315 | iso_pu_bacteria | 8004695233 | 8004696713 | 317 |
| 316 | iso_pu_bacteria | 8004727605 | 8004731460 | 317 |
| 317 | 3300059421 | Ga0590071_004845 | Ga0590071_004845_551_1564 | 318 |
| 318 | 3300059424 | Ga0590075_001623 | Ga0590075_001623_3995_5008 | 318 |
| 319 | 3300059426 | Ga0590077_000237 | Ga0590077_000237_2301_3314 | 318 |
| 320 | 3300046507 | Ga0495606_0188145 | Ga0495606_0188145_99_1070 | 319 |
| 321 | 3300046512 | Ga0495610_0011178 | Ga0495610_0011178_2533_3507 | 319 |
| 322 | 3300053125 | Ga0500618_013987 | Ga0500618_013987_1012_1983 | 319 |
| 323 | iso_pu_bacteria | 2511231035 | 2511435772 | 319 |
| 324 | iso_pu_bacteria | 2513237093 | 2513635209 | 319 |
| 325 | iso_pu_bacteria | 2516653046 | 2516898319 | 319 |
| 326 | iso_pu_bacteria | 2582581299 | 2585233758 | 319 |
| 327 | iso_pu_bacteria | 2585427528 | 2585539015 | 319 |
| 328 | iso_pu_bacteria | 2585427593 | 2585836965 | 319 |
| 329 | iso_pu_bacteria | 2585427633 | 2585992702 | 319 |
| 330 | iso_pu_bacteria | 2585427634 | 2586003434 | 319 |
| 331 | iso_pu_bacteria | 2599185236 | 2599720781 | 319 |
| 332 | iso_pu_bacteria | 2599185299 | 2599925636 | 319 |
| 333 | iso_pu_bacteria | 2608642108 | 2608669456 | 319 |
| 334 | iso_pu_bacteria | 2615840698 | 2616550962 | 319 |
| 335 | iso_pu_bacteria | 2648501693 | 2650898969 | 319 |
| 336 | iso_pu_bacteria | 2667528173 | 2671107379 | 319 |
| 337 | iso_pu_bacteria | 2684622997 | 2686353353 | 319 |
| 338 | iso_pu_bacteria | 2718218232 | 2720610408 | 319 |
| 339 | iso_pu_bacteria | 2718218235 | 2720628958 | 319 |
| 340 | iso_pu_bacteria | 2718218269 | 2720772906 | 319 |
| 341 | iso_pu_bacteria | 2721755556 | 2723030363 | 319 |
| 342 | iso_pu_bacteria | 2721755684 | 2723564725 | 319 |
| 343 | iso_pu_bacteria | 2721755819 | 2724092935 | 319 |
| 344 | iso_pu_bacteria | 2721755823 | 2724113324 | 319 |
| 345 | iso_pu_bacteria | 2728369352 | 2730110896 | 319 |
| 346 | iso_pu_bacteria | 2738541333 | 2739034560 | 319 |
| 347 | iso_pu_bacteria | 2791355261 | 2793329155 | 319 |
| 348 | iso_pu_bacteria | 2791355263 | 2793340876 | 319 |
| 349 | iso_pu_bacteria | 2791355265 | 2793352403 | 319 |
| 350 | iso_pu_bacteria | 2802429605 | 2805927659 | 319 |
| 351 | iso_pu_bacteria | 2802429606 | 2805936134 | 319 |
| 352 | iso_pu_bacteria | 2802429633 | 2806049083 | 319 |
| 353 | iso_pu_bacteria | 2802429634 | 2806055588 | 319 |
| 354 | iso_pu_bacteria | 2802429635 | 2806061386 | 319 |
| 355 | iso_pu_bacteria | 2802429636 | 2806069910 | 319 |
| 356 | iso_pu_bacteria | 2802429637 | 2806077697 | 319 |
| 357 | iso_pu_bacteria | 2808606414 | 2809123573 | 319 |
| 358 | iso_pu_bacteria | 2818991461 | 2819682691 | 319 |
| 359 | iso_pu_bacteria | 2821123053 | 2821129510 | 319 |
| 360 | iso_pu_bacteria | 2838042994 | 2838048862 | 319 |
| 361 | iso_pu_bacteria | 2838061910 | 2838062403 | 319 |
| 362 | iso_pu_bacteria | 2838661181 | 2838662518 | 319 |
| 363 | iso_pu_bacteria | 2838668709 | 2838670104 | 319 |
| 364 | iso_pu_bacteria | 2838701080 | 2838702475 | 319 |
| 365 | iso_pu_bacteria | 2842146304 | 2842146980 | 319 |
| 366 | iso_pu_bacteria | 2842192696 | 2842196961 | 319 |
| 367 | iso_pu_bacteria | 2842250916 | 2842252045 | 319 |
| 368 | iso_pu_bacteria | 2842264693 | 2842268472 | 319 |
| 369 | iso_pu_bacteria | 2842285085 | 2842287471 | 319 |
| 370 | iso_pu_bacteria | 2842317721 | 2842318229 | 319 |
| 371 | iso_pu_bacteria | 2842402390 | 2842405000 | 319 |
| 372 | iso_pu_bacteria | 2842409023 | 2842411582 | 319 |
| 373 | iso_pu_bacteria | 2842415677 | 2842417967 | 319 |
| 374 | iso_pu_bacteria | 2842428310 | 2842432444 | 319 |
| 375 | iso_pu_bacteria | 2842434925 | 2842438748 | 319 |
| 376 | iso_pu_bacteria | 2842441272 | 2842445415 | 319 |
| 377 | iso_pu_bacteria | 2842469257 | 2842473363 | 319 |
| 378 | iso_pu_bacteria | 2842489311 | 2842492808 | 319 |
| 379 | iso_pu_bacteria | 2842495871 | 2842496497 | 319 |
| 380 | iso_pu_bacteria | 2844528606 | 2844530914 | 319 |
| 381 | iso_pu_bacteria | 2847085930 | 2847086828 | 319 |
| 382 | iso_pu_bacteria | 2847797336 | 2847799868 | 319 |
| 383 | iso_pu_bacteria | 2852103415 | 2852105333 | 319 |
| 384 | iso_pu_bacteria | 2857531043 | 2857535857 | 319 |
| 385 | iso_pu_bacteria | 2865014394 | 2865015286 | 319 |
| 386 | iso_pu_bacteria | 2881609920 | 2881612296 | 319 |
| 387 | iso_pu_bacteria | 2904474040 | 2904476325 | 319 |
| 388 | iso_pu_bacteria | 2917832318 | 2917832770 | 319 |
| 389 | iso_pu_bacteria | 2919150387 | 2919152494 | 319 |
| 390 | iso_pu_bacteria | 2921257292 | 2921262553 | 319 |
| 391 | iso_pu_bacteria | 2927143783 | 2927145163 | 319 |
| 392 | iso_pu_bacteria | 2936381700 | 2936384342 | 319 |
| 393 | iso_pu_bacteria | 2937023124 | 2937027783 | 319 |
| 394 | iso_pu_bacteria | 2945951305 | 2945952963 | 319 |
| 395 | iso_pu_bacteria | 2957382221 | 2957383872 | 319 |
| 396 | iso_pu_bacteria | 2957395598 | 2957400551 | 319 |
| 397 | iso_pu_bacteria | 2957402308 | 2957405213 | 319 |
| 398 | iso_pu_bacteria | 2960674078 | 2960674972 | 319 |
| 399 | iso_pu_bacteria | 2964615318 | 2964620605 | 319 |
| 400 | iso_pu_bacteria | 2964705432 | 2964708287 | 319 |
| 401 | iso_pu_bacteria | 2967755722 | 2967760650 | 319 |
| 402 | iso_pu_bacteria | 2970102677 | 2970107171 | 319 |
| 403 | iso_pu_bacteria | 2984494565 | 2984496640 | 319 |
| 404 | iso_pu_bacteria | 2990261002 | 2990262058 | 319 |
| 405 | iso_pu_bacteria | 8005282627 | 8005285982 | 319 |
| 406 | iso_pu_bacteria | 8005430974 | 8005436070 | 319 |
| 407 | iso_pu_bacteria | 8005563573 | 8005567029 | 319 |
| 408 | iso_pu_bacteria | 8005570704 | 8005576103 | 319 |
| 409 | iso_pu_bacteria | 8005619151 | 8005624415 | 319 |
| 410 | iso_pu_bacteria | 8005626139 | 8005629676 | 319 |
| 411 | iso_pu_bacteria | 8018163183 | 8018166006 | 319 |
| 412 | iso_pu_bacteria | 8024479707 | 8024483811 | 319 |
| 413 | iso_pu_bacteria | 8024501048 | 8024505269 | 319 |
| 414 | iso_pu_bacteria | 8056382006 | 8056388317 | 319 |
| 415 | 3300003187 | JGI25151J46595_10001615 | JGI25151J46595_100016155 | 320 |
| 416 | 3300003354 | JGI25160J50197_1003728 | JGI25160J50197_10037282 | 320 |
| 417 | 3300003374 | JGI25161J50226_1002073 | JGI25161J50226_10020732 | 320 |
| 418 | 3300003771 | Ga0055526_1001395 | Ga0055526_10013954 | 320 |
| 419 | 3300003775 | Ga0055524_1000327 | Ga0055524_100032734 | 320 |
| 420 | 3300003790 | Ga0055528_1001431 | Ga0055528_10014314 | 320 |
| 421 | 3300004625 | Ga0055543_1000272 | Ga0055543_100027212 | 320 |
| 422 | 3300006042 | Ga0075368_10015172 | Ga0075368_100151722 | 320 |
| 423 | 3300006177 | Ga0075362_10053612 | Ga0075362_100536122 | 320 |
| 424 | 3300006186 | Ga0075369_10041177 | Ga0075369_100411772 | 320 |
| 425 | 3300006195 | Ga0075366_10013872 | Ga0075366_100138723 | 320 |
| 426 | 3300006946 | Ga0079104_1001122 | Ga0079104_10011228 | 320 |
| 427 | 3300025245 | Ga0207425_1006579 | Ga0207425_10065791 | 320 |
| 428 | 3300025258 | Ga0209129_1000560 | Ga0209129_10005602 | 320 |
| 429 | 3300025273 | Ga0209673_1000162 | Ga0209673_1000162114 | 320 |
| 430 | 3300025291 | Ga0209675_1010450 | Ga0209675_10104503 | 320 |
| 431 | 3300025294 | Ga0209025_1000530 | Ga0209025_100053066 | 320 |
| 432 | 3300025294 | Ga0209025_1019461 | Ga0209025_10194613 | 320 |
| 433 | 3300025295 | Ga0209564_1000234 | Ga0209564_100023491 | 320 |
| 434 | 3300025297 | Ga0209758_1000195 | Ga0209758_100019516 | 320 |
| 435 | 3300025297 | Ga0209758_1000514 | Ga0209758_100051447 | 320 |
| 436 | 3300025299 | Ga0209256_1000992 | Ga0209256_10009924 | 320 |
| 437 | 3300025302 | Ga0207426_1000299 | Ga0207426_100029957 | 320 |
| 438 | 3300025303 | Ga0209051_1012619 | Ga0209051_10126192 | 320 |
| 439 | 3300027111 | Ga0209281_1000765 | Ga0209281_10007657 | 320 |
| 440 | 3300028794 | Ga0307515_10000252 | Ga0307515_10000252126 | 320 |
| 441 | 3300028794 | Ga0307515_10000506 | Ga0307515_1000050613 | 320 |
| 442 | 3300031456 | Ga0307513_10085649 | Ga0307513_100856492 | 320 |
| 443 | 3300041406 | Ga0439439_0014485 | Ga0439439_0014485_294_1289 | 320 |
| 444 | 3300041413 | Ga0439465_0006701 | Ga0439465_0006701_2326_3300 | 320 |
| 445 | 3300042007 | Ga0439449_0014106 | Ga0439449_0014106_1874_2848 | 320 |
| 446 | 3300046460 | Ga0495638_0000077 | Ga0495638_0000077_132139_133113 | 320 |
| 447 | 3300046519 | Ga0495632_0000437 | Ga0495632_0000437_18601_19575 | 320 |
| 448 | 3300046524 | Ga0495648_0158451 | Ga0495648_0158451_146_1141 | 320 |
| 449 | 3300046530 | Ga0495654_0000497 | Ga0495654_0000497_27060_28034 | 320 |
| 450 | 3300046530 | Ga0495654_0121012 | Ga0495654_0121012_67_1041 | 320 |
| 451 | 3300046558 | Ga0495633_0031969 | Ga0495633_0031969_1267_2241 | 320 |
| 452 | 3300048924 | Ga0496121_0015149 | Ga0496121_0015149_1461_2435 | 320 |
| 453 | 3300048925 | Ga0496122_0008815 | Ga0496122_0008815_2657_3631 | 320 |
| 454 | 3300048926 | Ga0496123_0003729 | Ga0496123_0003729_7635_8609 | 320 |
| 455 | 3300048927 | Ga0496124_0012871 | Ga0496124_0012871_3982_4956 | 320 |
| 456 | 3300050489 | nmdc:mga03683_3718_c1 | nmdc:mga03683_3718_c1_2296_3270 | 320 |
| 457 | 3300050516 | nmdc:mga0sz30_9195_c1 | nmdc:mga0sz30_9195_c1_361_1335 | 320 |
| 458 | 3300053107 | Ga0500560_000070 | Ga0500560_000070_1627_2601 | 320 |
| 459 | 3300053125 | Ga0500618_011690 | Ga0500618_011690_845_1819 | 320 |
| 460 | 3300053153 | Ga0500616_0051491 | Ga0500616_0051491_320_1294 | 320 |
| 461 | iso_pu_bacteria | 2513237085 | 2513579761 | 320 |
| 462 | iso_pu_bacteria | 2515154134 | 2515738298 | 320 |
| 463 | iso_pu_bacteria | 2516653085 | 2517080339 | 320 |
| 464 | iso_pu_bacteria | 2585427526 | 2585526669 | 320 |
| 465 | iso_pu_bacteria | 2721755686 | 2723577054 | 320 |
| 466 | iso_pu_bacteria | 2838686498 | 2838690646 | 320 |
| 467 | iso_pu_bacteria | 2838729681 | 2838735940 | 320 |
| 468 | iso_pu_bacteria | 2838742623 | 2838748812 | 320 |
| 469 | iso_pu_bacteria | 2841734538 | 2841738917 | 320 |
| 470 | iso_pu_bacteria | 2841851746 | 2841855567 | 320 |
| 471 | iso_pu_bacteria | 2842156927 | 2842160727 | 320 |
| 472 | iso_pu_bacteria | 2842163707 | 2842164247 | 320 |
| 473 | iso_pu_bacteria | 2842180545 | 2842184343 | 320 |
| 474 | iso_pu_bacteria | 2842229732 | 2842231926 | 320 |
| 475 | iso_pu_bacteria | 2842243621 | 2842249747 | 320 |
| 476 | iso_pu_bacteria | 2842257432 | 2842263722 | 320 |
| 477 | iso_pu_bacteria | 2842271015 | 2842275040 | 320 |
| 478 | iso_pu_bacteria | 2842304105 | 2842307524 | 320 |
| 479 | iso_pu_bacteria | 2844454524 | 2844460302 | 320 |
| 480 | iso_pu_bacteria | 2856342000 | 2856343238 | 320 |
| 481 | iso_pu_bacteria | 2871474448 | 2871481127 | 320 |
| 482 | iso_pu_bacteria | 2874123672 | 2874129841 | 320 |
| 483 | iso_pu_bacteria | 2894232714 | 2894234539 | 320 |
| 484 | iso_pu_bacteria | 2919114240 | 2919119073 | 320 |
| 485 | iso_pu_bacteria | 2933570622 | 2933573820 | 320 |
| 486 | iso_pu_bacteria | 2935901341 | 2935903349 | 320 |
| 487 | iso_pu_bacteria | 2937836603 | 2937842978 | 320 |
| 488 | iso_pu_bacteria | 2958071322 | 2958072204 | 320 |
| 489 | iso_pu_bacteria | 2970524798 | 2970528360 | 320 |
| 490 | iso_pu_bacteria | 2977864932 | 2977867198 | 320 |
| 491 | iso_pu_bacteria | 3003665799 | 3003670725 | 320 |
| 492 | iso_pu_bacteria | 8004633249 | 8004634377 | 320 |
| 493 | iso_pu_bacteria | 8005307578 | 8005308118 | 320 |
| 494 | iso_pu_bacteria | 8054460903 | 8054465103 | 320 |
| 495 | iso_pu_bacteria | 8055617313 | 8055620529 | 320 |
| 496 | 3300053136 | Ga0500559_0004388 | Ga0500559_0004388_76_1062 | 321 |
| 497 | iso_pu_bacteria | 2510917026 | 2511173795 | 321 |
| 498 | iso_pu_bacteria | 2515154113 | 2515635635 | 321 |
| 499 | iso_pu_bacteria | 2565956521 | 2566038383 | 321 |
| 500 | iso_pu_bacteria | 2582581306 | 2585268446 | 321 |
| 501 | iso_pu_bacteria | 2582581307 | 2585275980 | 321 |
| 502 | iso_pu_bacteria | 2582581308 | 2585282199 | 321 |
| 503 | iso_pu_bacteria | 2582581316 | 2585334698 | 321 |
| 504 | iso_pu_bacteria | 2582581865 | 2585390335 | 321 |
| 505 | iso_pu_bacteria | 2582581867 | 2585399227 | 321 |
| 506 | iso_pu_bacteria | 2585427527 | 2585534272 | 321 |
| 507 | iso_pu_bacteria | 2585427530 | 2585557761 | 321 |
| 508 | iso_pu_bacteria | 2585427531 | 2585563541 | 321 |
| 509 | iso_pu_bacteria | 2585427608 | 2585900952 | 321 |
| 510 | iso_pu_bacteria | 2599185156 | 2599336076 | 321 |
| 511 | iso_pu_bacteria | 2724679232 | 2725946051 | 321 |
| 512 | iso_pu_bacteria | 2775506902 | 2776267235 | 321 |
| 513 | iso_pu_bacteria | 2775506904 | 2776282746 | 321 |
| 514 | iso_pu_bacteria | 2842922631 | 2842927511 | 321 |
| 515 | iso_pu_bacteria | 2936367885 | 2936371351 | 321 |
| 516 | iso_pu_bacteria | 2936375103 | 2936375447 | 321 |
| 517 | 3300003215 | JGI25153J46596_10006108 | JGI25153J46596_100061083 | 322 |
| 518 | 3300025245 | Ga0207425_1016274 | Ga0207425_10162742 | 322 |
| 519 | 3300025273 | Ga0209673_1007772 | Ga0209673_10077722 | 322 |
| 520 | 3300025297 | Ga0209758_1035342 | Ga0209758_10353422 | 322 |
| 521 | 3300030744 | Ga0316181_1074575 | Ga0316181_10745752 | 322 |
| 522 | 3300031852 | Ga0307410_10147044 | Ga0307410_101470442 | 322 |
| 523 | 3300032005 | Ga0307411_10307278 | Ga0307411_103072782 | 322 |
| 524 | 3300041498 | Ga0451841_0122940 | Ga0451841_0122940_271_1248 | 322 |
| 525 | 3300046452 | Ga0495617_004042 | Ga0495617_004042_200_1180 | 322 |
| 526 | 3300046453 | Ga0495627_006782 | Ga0495627_006782_736_1716 | 322 |
| 527 | 3300046457 | Ga0495590_0029175 | Ga0495590_0029175_641_1621 | 322 |
| 528 | 3300046460 | Ga0495638_0000218 | Ga0495638_0000218_64277_65257 | 322 |
| 529 | 3300046460 | Ga0495638_0001437 | Ga0495638_0001437_2336_3316 | 322 |
| 530 | 3300046471 | Ga0495650_0025078 | Ga0495650_0025078_43_1023 | 322 |
| 531 | 3300046474 | Ga0495605_0006656 | Ga0495605_0006656_3015_3995 | 322 |
| 532 | 3300046474 | Ga0495605_0025655 | Ga0495605_0025655_1637_2614 | 322 |
| 533 | 3300046492 | Ga0495585_0011922 | Ga0495585_0011922_1432_2412 | 322 |
| 534 | 3300046501 | Ga0495607_0004379 | Ga0495607_0004379_6959_7939 | 322 |
| 535 | 3300046501 | Ga0495607_0081114 | Ga0495607_0081114_493_1470 | 322 |
| 536 | 3300046506 | Ga0495583_0000749 | Ga0495583_0000749_37301_38281 | 322 |
| 537 | 3300046506 | Ga0495583_0007423 | Ga0495583_0007423_4020_5000 | 322 |
| 538 | 3300046506 | Ga0495583_0127185 | Ga0495583_0127185_32_1009 | 322 |
| 539 | 3300046507 | Ga0495606_0017410 | Ga0495606_0017410_4071_5048 | 322 |
| 540 | 3300046512 | Ga0495610_0034364 | Ga0495610_0034364_89_1069 | 322 |
| 541 | 3300046512 | Ga0495610_0052858 | Ga0495610_0052858_89_1069 | 322 |
| 542 | 3300046512 | Ga0495610_0065604 | Ga0495610_0065604_33_1010 | 322 |
| 543 | 3300046513 | Ga0495616_0005102 | Ga0495616_0005102_2549_3529 | 322 |
| 544 | 3300046513 | Ga0495616_0019065 | Ga0495616_0019065_915_1895 | 322 |
| 545 | 3300046515 | Ga0495620_0000045 | Ga0495620_0000045_773_1753 | 322 |
| 546 | 3300046515 | Ga0495620_0001359 | Ga0495620_0001359_233_1213 | 322 |
| 547 | 3300046518 | Ga0495631_0008932 | Ga0495631_0008932_2418_3398 | 322 |
| 548 | 3300046518 | Ga0495631_0113138 | Ga0495631_0113138_36_1016 | 322 |
| 549 | 3300046519 | Ga0495632_0008974 | Ga0495632_0008974_2529_3509 | 322 |
| 550 | 3300046520 | Ga0495637_0000938 | Ga0495637_0000938_17163_18143 | 322 |
| 551 | 3300046522 | Ga0495643_0001301 | Ga0495643_0001301_11195_12175 | 322 |
| 552 | 3300046522 | Ga0495643_0057033 | Ga0495643_0057033_33_1010 | 322 |
| 553 | 3300046524 | Ga0495648_0023176 | Ga0495648_0023176_1680_2657 | 322 |
| 554 | 3300046525 | Ga0495663_0002152 | Ga0495663_0002152_428_1408 | 322 |
| 555 | 3300046530 | Ga0495654_0002119 | Ga0495654_0002119_6310_7290 | 322 |
| 556 | 3300046530 | Ga0495654_0043991 | Ga0495654_0043991_145_1125 | 322 |
| 557 | 3300046538 | Ga0495609_0000419 | Ga0495609_0000419_4294_5274 | 322 |
| 558 | 3300046538 | Ga0495609_0026801 | Ga0495609_0026801_1003_1980 | 322 |
| 559 | 3300046542 | Ga0495597_0013560 | Ga0495597_0013560_1620_2597 | 322 |
| 560 | 3300046557 | Ga0495622_0024464 | Ga0495622_0024464_30_1010 | 322 |
| 561 | 3300046616 | Ga0495668_0022364 | Ga0495668_0022364_2074_3054 | 322 |
| 562 | 3300046616 | Ga0495668_0038827 | Ga0495668_0038827_1055_2032 | 322 |
| 563 | 3300046648 | Ga0495611_0000804 | Ga0495611_0000804_14274_15254 | 322 |
| 564 | 3300046648 | Ga0495611_0068421 | Ga0495611_0068421_77_1057 | 322 |
| 565 | 3300046660 | Ga0495625_0002481 | Ga0495625_0002481_1956_2936 | 322 |
| 566 | 3300046660 | Ga0495625_0004783 | Ga0495625_0004783_3697_4677 | 322 |
| 567 | 3300046660 | Ga0495625_0025179 | Ga0495625_0025179_3167_4147 | 322 |
| 568 | 3300046660 | Ga0495625_0033428 | Ga0495625_0033428_2543_3523 | 322 |
| 569 | 3300046660 | Ga0495625_0209364 | Ga0495625_0209364_22_1002 | 322 |
| 570 | 3300046665 | Ga0495661_0004792 | Ga0495661_0004792_6098_7078 | 322 |
| 571 | 3300046665 | Ga0495661_0013097 | Ga0495661_0013097_27_1007 | 322 |
| 572 | 3300046674 | Ga0495588_0000521 | Ga0495588_0000521_2830_3810 | 322 |
| 573 | 3300046674 | Ga0495588_0001026 | Ga0495588_0001026_8083_9063 | 322 |
| 574 | 3300046674 | Ga0495588_0099306 | Ga0495588_0099306_361_1341 | 322 |
| 575 | 3300046689 | Ga0495613_0000804 | Ga0495613_0000804_14740_15720 | 322 |
| 576 | 3300046691 | Ga0495670_0019954 | Ga0495670_0019954_656_1636 | 322 |
| 577 | 3300046692 | Ga0495671_0000079 | Ga0495671_0000079_2075_3055 | 322 |
| 578 | 3300046694 | Ga0495649_0000237 | Ga0495649_0000237_21381_22361 | 322 |
| 579 | 3300046694 | Ga0495649_0002547 | Ga0495649_0002547_9983_10963 | 322 |
| 580 | 3300046694 | Ga0495649_0078984 | Ga0495649_0078984_752_1729 | 322 |
| 581 | 3300046810 | Ga0495660_0027154 | Ga0495660_0027154_305_1282 | 322 |
| 582 | 3300047318 | Ga0495636_0008470 | Ga0495636_0008470_2505_3485 | 322 |
| 583 | 3300047443 | Ga0495687_000090 | Ga0495687_000090_112386_113366 | 322 |
| 584 | 3300047443 | Ga0495687_001665 | Ga0495687_001665_13850_14830 | 322 |
| 585 | 3300047443 | Ga0495687_023268 | Ga0495687_023268_1893_2873 | 322 |
| 586 | 3300047443 | Ga0495687_038849 | Ga0495687_038849_764_1741 | 322 |
| 587 | 3300047470 | Ga0495681_0001033 | Ga0495681_0001033_17747_18727 | 322 |
| 588 | 3300047472 | Ga0495686_0000157 | Ga0495686_0000157_76046_77026 | 322 |
| 589 | 3300048921 | Ga0496118_0063689 | Ga0496118_0063689_542_1519 | 322 |
| 590 | 3300048925 | Ga0496122_0006650 | Ga0496122_0006650_10173_11150 | 322 |
| 591 | 3300048927 | Ga0496124_0032762 | Ga0496124_0032762_1660_2637 | 322 |
| 592 | 3300049459 | Ga0495678_000059 | Ga0495678_000059_114933_115913 | 322 |
| 593 | 3300049460 | Ga0495682_0001980 | Ga0495682_0001980_3371_4351 | 322 |
| 594 | 3300053086 | Ga0500578_0000148 | Ga0500578_0000148_16335_17315 | 322 |
| 595 | 3300053086 | Ga0500578_0016498 | Ga0500578_0016498_1298_2275 | 322 |
| 596 | 3300053092 | Ga0500583_0000571 | Ga0500583_0000571_6193_7173 | 322 |
| 597 | 3300053105 | Ga0500557_006156 | Ga0500557_006156_1131_2111 | 322 |
| 598 | 3300053108 | Ga0500562_043768 | Ga0500562_043768_59_1039 | 322 |
| 599 | 3300053109 | Ga0500569_014409 | Ga0500569_014409_144_1121 | 322 |
| 600 | 3300053111 | Ga0500572_001549 | Ga0500572_001549_2784_3761 | 322 |
| 601 | 3300053118 | Ga0500594_0000906 | Ga0500594_0000906_4119_5099 | 322 |
| 602 | 3300053119 | Ga0500595_010875 | Ga0500595_010875_386_1366 | 322 |
| 603 | 3300053120 | Ga0500597_002155 | Ga0500597_002155_1562_2542 | 322 |
| 604 | 3300053122 | Ga0500608_000204 | Ga0500608_000204_20538_21518 | 322 |
| 605 | 3300053122 | Ga0500608_014178 | Ga0500608_014178_972_1952 | 322 |
| 606 | 3300053125 | Ga0500618_011530 | Ga0500618_011530_229_1209 | 322 |
| 607 | 3300053134 | Ga0500658_0000169 | Ga0500658_0000169_5036_6013 | 322 |
| 608 | 3300053138 | Ga0500564_004134 | Ga0500564_004134_504_1484 | 322 |
| 609 | 3300053139 | Ga0500568_0000042 | Ga0500568_0000042_24055_25035 | 322 |
| 610 | 3300053140 | Ga0500573_0011508 | Ga0500573_0011508_3365_4345 | 322 |
| 611 | 3300053141 | Ga0500574_000020 | Ga0500574_000020_9274_10254 | 322 |
| 612 | 3300053153 | Ga0500616_0000222 | Ga0500616_0000222_72457_73437 | 322 |
| 613 | 3300053154 | Ga0500619_003044 | Ga0500619_003044_966_1946 | 322 |
| 614 | 3300053157 | Ga0500624_000030 | Ga0500624_000030_72493_73473 | 322 |
| 615 | 3300053177 | Ga0500636_0000007 | Ga0500636_0000007_49642_50619 | 322 |
| 616 | 3300053177 | Ga0500636_0000392 | Ga0500636_0000392_3835_4812 | 322 |
| 617 | 3300053177 | Ga0500636_0049767 | Ga0500636_0049767_1163_2143 | 322 |
| 618 | 3300053177 | Ga0500636_0049999 | Ga0500636_0049999_322_1302 | 322 |
| 619 | 3300053723 | Ga0500567_059521 | Ga0500567_059521_662_1642 | 322 |
| 620 | 2162886007 | SwRhRL2b_contig_129826 | SwRhRL2b_0620.00007010 | 323 |
| 621 | 3300002737 | JGI25162J39368_1000002 | JGI25162J39368_1000002109 | 323 |
| 622 | 3300002737 | JGI25162J39368_1003920 | JGI25162J39368_10039204 | 323 |
| 623 | 3300002771 | JGI25163J39215_1000043 | JGI25163J39215_100004351 | 323 |
| 624 | 3300002772 | JGI25164J39214_1000066 | JGI25164J39214_10000667 | 323 |
| 625 | 3300003751 | Ga0055538_1000003 | Ga0055538_1000003109 | 323 |
| 626 | 3300003752 | Ga0055539_1000003 | Ga0055539_1000003508 | 323 |
| 627 | 3300003756 | Ga0055533_1000005 | Ga0055533_1000005508 | 323 |
| 628 | 3300003759 | Ga0055525_1000005 | Ga0055525_1000005109 | 323 |
| 629 | 3300003841 | Ga0055541_1000003 | Ga0055541_1000003109 | 323 |
| 630 | 3300003856 | Ga0058692_1000055 | Ga0058692_10000559 | 323 |
| 631 | 3300003856 | Ga0058692_1000960 | Ga0058692_10009605 | 323 |
| 632 | 3300003856 | Ga0058692_1001591 | Ga0058692_10015915 | 323 |
| 633 | 3300005289 | Ga0065704_10000911 | Ga0065704_1000091114 | 323 |
| 634 | 3300005347 | Ga0070668_100039963 | Ga0070668_1000399632 | 323 |
| 635 | 3300009011 | Ga0105251_10000911 | Ga0105251_100009112 | 323 |
| 636 | 3300009011 | Ga0105251_10011259 | Ga0105251_100112592 | 323 |
| 637 | 3300009036 | Ga0105244_10000407 | Ga0105244_1000040724 | 323 |
| 638 | 3300009036 | Ga0105244_10003474 | Ga0105244_100034746 | 323 |
| 639 | 3300009092 | Ga0105250_10000046 | Ga0105250_1000004668 | 323 |
| 640 | 3300009092 | Ga0105250_10000167 | Ga0105250_100001675 | 323 |
| 641 | 3300013102 | Ga0157371_10023141 | Ga0157371_100231411 | 323 |
| 642 | 3300013105 | Ga0157369_10215448 | Ga0157369_102154481 | 323 |
| 643 | 3300013306 | Ga0163162_10209293 | Ga0163162_102092932 | 323 |
| 644 | 3300013307 | Ga0157372_10037777 | Ga0157372_100377775 | 323 |
| 645 | 3300025207 | Ga0209760_100005 | Ga0209760_100005108 | 323 |
| 646 | 3300025207 | Ga0209760_101871 | Ga0209760_1018712 | 323 |
| 647 | 3300025224 | Ga0209784_100001 | Ga0209784_1000013265 | 323 |
| 648 | 3300025225 | Ga0209566_100001 | Ga0209566_1000013265 | 323 |
| 649 | 3300025226 | Ga0209674_100002 | Ga0209674_1000023265 | 323 |
| 650 | 3300025230 | Ga0209563_100002 | Ga0209563_1000021800 | 323 |
| 651 | 3300025231 | Ga0207427_100009 | Ga0207427_100009108 | 323 |
| 652 | 3300025233 | Ga0209437_100001 | Ga0209437_1000011800 | 323 |
| 653 | 3300025233 | Ga0209437_100073 | Ga0209437_100073211 | 323 |
| 654 | 3300025253 | Ga0209677_100002 | Ga0209677_1000021800 | 323 |
| 655 | 3300025261 | Ga0209233_1002354 | Ga0209233_10023545 | 323 |
| 656 | 3300025711 | Ga0207696_1000037 | Ga0207696_100003751 | 323 |
| 657 | 3300025711 | Ga0207696_1002602 | Ga0207696_10026026 | 323 |
| 658 | 3300025711 | Ga0207696_1003306 | Ga0207696_10033065 | 323 |
| 659 | 3300025728 | Ga0207655_1000673 | Ga0207655_100067323 | 323 |
| 660 | 3300025728 | Ga0207655_1003170 | Ga0207655_10031706 | 323 |
| 661 | 3300025728 | Ga0207655_1003696 | Ga0207655_10036966 | 323 |
| 662 | 3300025728 | Ga0207655_1009180 | Ga0207655_10091802 | 323 |
| 663 | 3300025735 | Ga0207713_1000001 | Ga0207713_10000011097 | 323 |
| 664 | 3300025972 | Ga0207668_10007866 | Ga0207668_100078663 | 323 |
| 665 | 3300027312 | Ga0209371_1000017 | Ga0209371_100001722 | 323 |
| 666 | 3300027312 | Ga0209371_1000075 | Ga0209371_1000075130 | 323 |
| 667 | 3300030500 | Ga0268256_1000036 | Ga0268256_100003686 | 323 |
| 668 | 3300030500 | Ga0268256_1000068 | Ga0268256_100006867 | 323 |
| 669 | 3300031616 | Ga0307508_10120579 | Ga0307508_101205792 | 323 |
| 670 | 3300041405 | Ga0439438_000005 | Ga0439438_000005_398438_399493 | 323 |
| 671 | 3300041405 | Ga0439438_014750 | Ga0439438_014750_17_988 | 323 |
| 672 | 3300041407 | Ga0439447_003169 | Ga0439447_003169_2359_3330 | 323 |
| 673 | 3300041411 | Ga0439466_0000009 | Ga0439466_0000009_137917_138888 | 323 |
| 674 | 3300042006 | Ga0439432_011630 | Ga0439432_011630_1849_2820 | 323 |
| 675 | 3300042146 | Ga0450907_000466 | Ga0450907_000466_3020_3991 | 323 |
| 676 | 3300042439 | Ga0439464_0004430 | Ga0439464_0004430_148_1119 | 323 |
| 677 | 3300046458 | Ga0495591_000012 | Ga0495591_000012_172929_173900 | 323 |
| 678 | 3300046458 | Ga0495591_001060 | Ga0495591_001060_11119_12090 | 323 |
| 679 | 3300046471 | Ga0495650_0000026 | Ga0495650_0000026_55271_56242 | 323 |
| 680 | 3300046471 | Ga0495650_0000106 | Ga0495650_0000106_12455_13426 | 323 |
| 681 | 3300046491 | Ga0495584_0029796 | Ga0495584_0029796_1748_2719 | 323 |
| 682 | 3300046501 | Ga0495607_0008326 | Ga0495607_0008326_5670_6641 | 323 |
| 683 | 3300046513 | Ga0495616_0070571 | Ga0495616_0070571_225_1196 | 323 |
| 684 | 3300046518 | Ga0495631_0070413 | Ga0495631_0070413_237_1208 | 323 |
| 685 | 3300046522 | Ga0495643_0024303 | Ga0495643_0024303_347_1318 | 323 |
| 686 | 3300046522 | Ga0495643_0078855 | Ga0495643_0078855_468_1439 | 323 |
| 687 | 3300046523 | Ga0495644_0010649 | Ga0495644_0010649_1000_1971 | 323 |
| 688 | 3300046524 | Ga0495648_0009401 | Ga0495648_0009401_3239_4210 | 323 |
| 689 | 3300046524 | Ga0495648_0018761 | Ga0495648_0018761_3567_4538 | 323 |
| 690 | 3300046530 | Ga0495654_0000021 | Ga0495654_0000021_177980_178951 | 323 |
| 691 | 3300046530 | Ga0495654_0001498 | Ga0495654_0001498_8893_9864 | 323 |
| 692 | 3300046648 | Ga0495611_0117122 | Ga0495611_0117122_141_1112 | 323 |
| 693 | 3300046692 | Ga0495671_0002261 | Ga0495671_0002261_4071_5042 | 323 |
| 694 | 3300046694 | Ga0495649_0154135 | Ga0495649_0154135_209_1180 | 323 |
| 695 | 3300046810 | Ga0495660_0000004 | Ga0495660_0000004_10821_11792 | 323 |
| 696 | 3300046810 | Ga0495660_0000029 | Ga0495660_0000029_174763_175734 | 323 |
| 697 | 3300046810 | Ga0495660_0012644 | Ga0495660_0012644_3750_4721 | 323 |
| 698 | 3300047320 | Ga0495672_0000053 | Ga0495672_0000053_71748_72719 | 323 |
| 699 | 3300047323 | Ga0495683_0017012 | Ga0495683_0017012_2788_3759 | 323 |
| 700 | 3300047446 | Ga0495679_007164 | Ga0495679_007164_1207_2178 | 323 |
| 701 | 3300047469 | Ga0495673_0000810 | Ga0495673_0000810_24662_25633 | 323 |
| 702 | 3300048903 | Ga0496100_0077096 | Ga0496100_0077096_295_1266 | 323 |
| 703 | 3300048905 | Ga0496102_0010526 | Ga0496102_0010526_6388_7359 | 323 |
| 704 | 3300048907 | Ga0496104_0000895 | Ga0496104_0000895_42_1013 | 323 |
| 705 | 3300048908 | Ga0496105_0001631 | Ga0496105_0001631_12807_13778 | 323 |
| 706 | 3300048909 | Ga0496106_0162871 | Ga0496106_0162871_718_1689 | 323 |
| 707 | 3300048913 | Ga0496110_0405752 | Ga0496110_0405752_164_1135 | 323 |
| 708 | 3300048919 | Ga0496116_0000074 | Ga0496116_0000074_218351_219322 | 323 |
| 709 | 3300048920 | Ga0496117_0000022 | Ga0496117_0000022_295780_296751 | 323 |
| 710 | 3300048920 | Ga0496117_0000268 | Ga0496117_0000268_83381_84352 | 323 |
| 711 | 3300048921 | Ga0496118_0000007 | Ga0496118_0000007_279647_280618 | 323 |
| 712 | 3300048921 | Ga0496118_0000085 | Ga0496118_0000085_174256_175227 | 323 |
| 713 | 3300048922 | Ga0496119_0000162 | Ga0496119_0000162_31792_32763 | 323 |
| 714 | 3300048922 | Ga0496119_0006224 | Ga0496119_0006224_2070_3041 | 323 |
| 715 | 3300048923 | Ga0496120_0000107 | Ga0496120_0000107_57802_58773 | 323 |
| 716 | 3300048924 | Ga0496121_0000504 | Ga0496121_0000504_4051_5022 | 323 |
| 717 | 3300048925 | Ga0496122_0000064 | Ga0496122_0000064_228238_229209 | 323 |
| 718 | 3300048925 | Ga0496122_0163987 | Ga0496122_0163987_30_1001 | 323 |
| 719 | 3300048926 | Ga0496123_0000049 | Ga0496123_0000049_10743_11714 | 323 |
| 720 | 3300048926 | Ga0496123_0000543 | Ga0496123_0000543_63048_64019 | 323 |
| 721 | 3300048927 | Ga0496124_0000027 | Ga0496124_0000027_8442_9413 | 323 |
| 722 | 3300048927 | Ga0496124_0000216 | Ga0496124_0000216_56616_57587 | 323 |
| 723 | 3300048927 | Ga0496124_0026922 | Ga0496124_0026922_3552_4523 | 323 |
| 724 | 3300048927 | Ga0496124_0128672 | Ga0496124_0128672_334_1305 | 323 |
| 725 | 3300048928 | Ga0496125_0000305 | Ga0496125_0000305_10332_11303 | 323 |
| 726 | 3300048928 | Ga0496125_0094204 | Ga0496125_0094204_235_1206 | 323 |
| 727 | 3300048929 | Ga0496126_0008230 | Ga0496126_0008230_8228_9199 | 323 |
| 728 | 3300049459 | Ga0495678_000991 | Ga0495678_000991_9237_10208 | 323 |
| 729 | 3300049460 | Ga0495682_0000001 | Ga0495682_0000001_1005830_1006801 | 323 |
| 730 | 3300053126 | Ga0500621_000003 | Ga0500621_000003_426410_427381 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.5867 | 52 | 313 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5749 | 52 | 314 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5558 | 52 | 314 |
| 2nq2-assembly1.cif.gz_B | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5554 | 23 | 290 |
| 4dbl-assembly2.cif.gz_F | crystal structure of e159q mutant of btucdf | 0.5399 | 22 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P39328_55_321_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9773 | 50 | 313 | 1.10.3470.10 |
| af_P0AGI1_45_314_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9764 | 49 | 313 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9757 | 49 | 313 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.972 | 53 | 313 | 1.10.3470.10 |
| af_P0AE26_50_315_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.9685 | 49 | 313 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4G7W6-F1-model_v4 | deleted | 0.9838 | 22 | 323 |
|
| AF-A0A2V8DE02-F1-model_v4 | Ribose ABC transporter permease | 0.983 | 22 | 322 |
GO:0005886
GO:0022857 |
| AF-A0A2S4JJN0-F1-model_v4 | Ribose ABC transporter permease | 0.9793 | 22 | 323 |
GO:0005886
GO:0022857 |
| AF-A0A6I3CFM3-F1-model_v4 | ABC transporter permease | 0.9791 | 22 | 322 |
GO:0005886
GO:0022857 |
| AF-A0A3L6ZMH8-F1-model_v4 | Autoinducer 2 import system permease protein LsrC | 0.9783 | 22 | 322 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar