F477927

General Info

Members Datasets Scaffolds Average Seq Length
730 533 497 315

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_000005|Ga0439438_000005_398438_399493
Length 351
Sequence MKKISPVSPLKMSRLPNLFTCFYVKANIMMTQTPVRSGLHASSAFKFNVRDAGTLIGLLIIIVTFSFLSPVFFTLPNLLNVLQQSSINALIALGMTLVIISGGIDLSVGPTAALSAVLGATLMVSGVPVPIAVLATLGVGAACGVFSGSLIAYAGLQPFIVTLGGLSLFRAIALIYTGGNPIFGIPMEFRSIINSTLFGVPTPIIIVAVIALVLWTVMNKTPLGEYILAIGGNEEAARVAGVPVKRTKVTVYVISGTLASLASLILIGRLGAAEPTIGNLWELDAIAAAAIGGASLMGGKGSVFGTIIGVIILGALRNGLTLLNIQAFYQLLATGLIIIIAMLIDRATRGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
7 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
8 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
9 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
10 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
11 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
12 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
13 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
14 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
15 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
16 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
17 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
18 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
21 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
22 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
23 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
24 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
25 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
26 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
27 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
28 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
29 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
30 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
31 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
32 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
33 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
34 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
35 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
36 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
37 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
38 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
39 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
40 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
41 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
42 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
43 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
44 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
45 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
47 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
48 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
49 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
50 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
51 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
52 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
53 2791355261 Rhizobium sp. J15 Isolate Nodule
54 2791355263 Rhizobium chutanense C5 Isolate Nodule
55 2791355265 Rhizobium sp. H4 Isolate Nodule
56 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
57 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
58 2802429633 Rhizobium anhuiense J3 Isolate Nodule
59 2802429634 Rhizobium anhuiense S10 Isolate Nodule
60 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
61 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
62 2802429637 Rhizobium anhuiense C15 Isolate Nodule
63 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
64 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
65 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
66 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
67 2838061910 Rhizobium phaseoli L15 Isolate Nodule
68 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
69 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
70 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
71 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
72 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
73 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
74 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
75 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
76 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
77 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
78 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
79 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
80 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
81 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
82 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
83 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
84 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
85 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
86 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
87 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
88 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
89 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
90 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
91 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
92 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
93 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
94 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
95 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
96 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
97 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
98 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
99 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
100 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
101 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
102 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
103 2847085930 Erwinia persicina B64 Isolate Bulb
104 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
105 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
106 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
107 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
108 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
109 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
110 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
111 2865014394 Pantoea sp. R-71966 Isolate Unclassified
112 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
113 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
114 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
115 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
116 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
117 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
118 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
119 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
120 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
121 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
122 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
123 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
124 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
125 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
126 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
127 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
128 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
129 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
130 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
131 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
132 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
133 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
134 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
135 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
136 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
137 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
138 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
139 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
140 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
141 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
142 2904504865 Serratia marcescens 1822 Isolate Unclassified
143 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
144 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
145 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
146 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
147 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
148 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
149 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
150 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
151 2919150387 Rahnella aceris 1817 Isolate Unclassified
152 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
153 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
154 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
155 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
156 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
157 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
158 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
159 2927143783 Rahnella sp. 2050 Isolate Unclassified
160 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
161 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
162 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
163 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
164 2936381700 Rhizobium chutanense C16 Isolate Unclassified
165 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
166 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
167 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
168 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
169 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
170 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
171 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
172 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
173 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
174 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
175 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
176 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
177 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
178 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
179 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
180 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
181 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
182 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
183 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
184 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
185 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
186 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
187 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
188 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
189 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
190 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
191 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
192 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
193 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
194 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
195 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
196 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
197 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
198 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
199 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
200 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
201 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
202 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
203 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
204 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
205 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
206 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
207 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
208 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
209 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
210 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
211 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
212 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
213 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
214 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
215 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
216 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
217 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
218 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
219 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
220 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
221 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
222 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
223 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
224 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
225 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
226 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
227 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
228 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
229 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
230 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
231 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
232 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
233 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
234 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
235 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
236 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
237 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
238 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
239 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
240 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
241 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
242 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
243 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
244 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
245 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
246 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
247 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
248 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
249 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
250 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
251 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
252 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
253 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
254 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
255 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
256 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
257 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
258 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
259 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
260 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
261 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
262 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
263 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
264 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
265 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
266 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
267 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
268 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
269 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
270 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
271 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
272 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
273 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
274 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
275 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
276 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
277 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
278 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
279 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
280 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
281 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
282 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
283 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
284 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
285 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
286 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
287 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
288 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
289 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
290 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
291 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
292 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
293 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
294 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
295 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
296 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
297 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
298 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
299 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
300 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
301 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
302 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
307 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
308 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
309 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
311 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
312 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
313 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
315 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
317 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
319 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
345 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
347 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
349 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
350 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
351 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
352 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
353 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
354 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
355 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
356 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
357 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
358 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
359 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
360 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
361 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
362 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
363 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
364 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
365 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
366 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
367 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
368 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
369 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
370 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
371 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
372 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
373 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
374 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
375 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
376 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
377 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
378 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
379 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
380 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
381 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
382 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
383 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
384 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
385 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
386 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
387 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
390 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
391 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
392 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
393 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
394 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
395 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
396 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
397 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
398 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
399 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
400 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
401 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
402 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
403 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
404 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
405 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
406 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
407 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
408 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
409 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
410 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
411 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
412 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
413 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
414 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
415 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
416 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
417 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
418 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
419 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
420 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
421 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
422 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
423 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
424 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
425 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
426 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
427 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
428 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
429 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
430 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
431 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
432 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
433 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
434 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
435 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
436 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
441 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
454 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
455 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
461 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
462 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
463 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
464 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
465 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
466 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
467 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
468 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
469 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
470 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
471 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
472 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
473 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
474 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
475 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
476 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
477 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
478 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
483 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
484 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
485 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
486 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
487 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
488 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
489 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
492 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
493 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
494 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
495 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
496 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
497 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
500 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
501 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
502 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
503 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
504 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
505 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
506 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
507 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
508 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
509 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
510 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
511 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
512 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
513 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
515 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
516 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
517 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
518 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
519 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
520 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
521 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
522 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
523 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
524 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
525 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
526 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
527 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
528 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
529 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
530 8024501048 Rhizobium sp. H4 Isolate Nodule
531 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
532 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
533 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.08
Metatranscriptomes 0
Isolates 31.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0.14
Endosphere 14.11
Nodule 24.52
Rhizoplane 1.92
Rhizosphere 47.95
Stem 0
Stem Tuber 0
Unclassified 11.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_129826 2162886007 Bacteria 4123
2 JGI24739J22299_10027864 3300001989 Bacteria 1972
3 JGI25162J39368_1000002 3300002737 Bacteria 663004
4 JGI25162J39368_1003920 3300002737 Bacteria 3829
5 JGI25163J39215_1000043 3300002771 Bacteria 55468
6 JGI25164J39214_1000066 3300002772 Bacteria 106367
7 JGI25151J46595_10001615 3300003187 Bacteria 14941
8 JGI25153J46596_10006108 3300003215 Bacteria 6177
9 JGI25160J50197_1003728 3300003354 Bacteria 6720
10 JGI25161J50226_1002073 3300003374 Bacteria 5434
11 Ga0055538_1000003 3300003751 Bacteria 663004
12 Ga0055539_1000003 3300003752 Bacteria 663004
13 Ga0055533_1000005 3300003756 Bacteria 663004
14 Ga0055525_1000005 3300003759 Bacteria 663004
15 Ga0055526_1001395 3300003771 Bacteria 17166
16 Ga0055524_1000327 3300003775 Bacteria 44413
17 Ga0055528_1001431 3300003790 Bacteria 14595
18 Ga0055541_1000003 3300003841 Bacteria 663004
19 Ga0058692_1000052 3300003856 Bacteria 107855
20 Ga0058692_1000055 3300003856 Bacteria 105550
21 Ga0058692_1000066 3300003856 Bacteria 89302
22 Ga0058692_1000960 3300003856 Bacteria 11354
23 Ga0058692_1001591 3300003856 Bacteria 8184
24 Ga0055543_1000272 3300004625 Bacteria 38422
25 Ga0065165_1003076 3300005262 Bacteria 12458
26 Ga0065704_10000911 3300005289 Bacteria 13505
27 Ga0065715_10130877 3300005293 Bacteria 2018
28 Ga0065707_10145681 3300005295 Bacteria 1717
29 Ga0070670_100002435 3300005331 Bacteria 15345
30 Ga0068868_100386146 3300005338 Bacteria 1206
31 Ga0070668_100039963 3300005347 Bacteria 3588
32 Ga0070668_100104238 3300005347 Bacteria 2251
33 Ga0070675_100026142 3300005354 Bacteria 4682
34 Ga0070675_100097626 3300005354 Bacteria 2470
35 Ga0070674_100039543 3300005356 Bacteria 3186
36 Ga0070674_100040034 3300005356 Bacteria 3168
37 Ga0070673_100244833 3300005364 Bacteria 1560
38 Ga0070659_100237175 3300005366 Bacteria 1508
39 Ga0070659_100263277 3300005366 Bacteria 1431
40 Ga0070659_100307990 3300005366 Bacteria 1322
41 Ga0070701_10005828 3300005438 Bacteria 5131
42 Ga0070708_100079193 3300005445 Bacteria 2972
43 Ga0070663_100022264 3300005455 Bacteria 4234
44 Ga0070662_100069133 3300005457 Bacteria 2598
45 Ga0068867_100002314 3300005459 Bacteria 13408
46 Ga0070685_10005378 3300005466 Bacteria 6485
47 Ga0070698_100009329 3300005471 Bacteria 10522
48 Ga0068853_100494613 3300005539 Bacteria 1154
49 Ga0070672_100182204 3300005543 Bacteria 1751
50 Ga0068855_100389481 3300005563 Bacteria 1529
51 Ga0070664_100131425 3300005564 Bacteria 2199
52 Ga0068857_100008811 3300005577 Bacteria 8736
53 Ga0068857_100021708 3300005577 Bacteria 5648
54 Ga0070702_100060783 3300005615 Bacteria 2198
55 Ga0068859_100047448 3300005617 Bacteria 4315
56 Ga0068866_10112126 3300005718 Bacteria 1524
57 Ga0068863_100017887 3300005841 Bacteria 6783
58 Ga0068858_100113438 3300005842 Bacteria 2531
59 Ga0068860_100100376 3300005843 Bacteria 2761
60 Ga0068862_100034929 3300005844 Bacteria 4255
61 Ga0068862_100191104 3300005844 Bacteria 1842
62 Ga0075368_10015172 3300006042 Bacteria 2854
63 Ga0075368_10022163 3300006042 Bacteria 2416
64 Ga0075364_10045310 3300006051 Bacteria 2862
65 Ga0075362_10053612 3300006177 Bacteria 1810
66 Ga0075367_10034886 3300006178 Bacteria 2909
67 Ga0075367_10087247 3300006178 Bacteria 1895
68 Ga0075367_10125731 3300006178 Bacteria 1582
69 Ga0075369_10041177 3300006186 Bacteria 1977
70 Ga0075366_10000078 3300006195 Bacteria 38200
71 Ga0075366_10013872 3300006195 Bacteria 4593
72 Ga0097621_100061949 3300006237 Bacteria 3070
73 Ga0075370_10044307 3300006353 Bacteria 2515
74 Ga0075428_100259882 3300006844 Bacteria 1870
75 Ga0075430_100101975 3300006846 Bacteria 2396
76 Ga0068865_100023513 3300006881 Bacteria 4036
77 Ga0097620_100047456 3300006931 Bacteria 4315
78 Ga0079104_1001122 3300006946 Bacteria 19638
79 Ga0105251_10000911 3300009011 Bacteria 26509
80 Ga0105251_10003991 3300009011 Bacteria 10440
81 Ga0105251_10011259 3300009011 Bacteria 5119
82 Ga0105244_10000407 3300009036 Bacteria 40132
83 Ga0105244_10003474 3300009036 Bacteria 11214
84 Ga0105244_10007661 3300009036 Bacteria 6841
85 Ga0105250_10000046 3300009092 Bacteria 126280
86 Ga0105250_10000167 3300009092 Bacteria 56932
87 Ga0105250_10000456 3300009092 Bacteria 29378
88 Ga0111539_10000234 3300009094 Bacteria 66163
89 Ga0105245_10120681 3300009098 Bacteria 2448
90 Ga0114129_10013211 3300009147 Bacteria 11762
91 Ga0105243_10002962 3300009148 Bacteria 14034
92 Ga0105243_10021905 3300009148 Bacteria 4853
93 Ga0105241_10000002 3300009174 Bacteria 869480
94 Ga0105248_10036940 3300009177 Bacteria 5463
95 Ga0105237_10345119 3300009545 Bacteria 1493
96 Ga0105249_10003680 3300009553 Bacteria 13214
97 Ga0105239_10142952 3300010375 Bacteria 2667
98 Ga0157373_10012370 3300013100 Bacteria 6274
99 Ga0157371_10002928 3300013102 Bacteria 15937
100 Ga0157371_10009049 3300013102 Bacteria 7873
101 Ga0157371_10023141 3300013102 Bacteria 4544
102 Ga0157370_10000336 3300013104 Bacteria 59121
103 Ga0157369_10215448 3300013105 Bacteria 2011
104 Ga0163162_10209293 3300013306 Bacteria 2080
105 Ga0163162_10247408 3300013306 Bacteria 1914
106 Ga0157372_10037777 3300013307 Bacteria 5327
107 Ga0157375_10045052 3300013308 Bacteria 4291
108 Ga0163163_10173406 3300014325 Bacteria 2203
109 Ga0157380_10051769 3300014326 Bacteria 3249
110 Ga0157380_10128892 3300014326 Bacteria 2155
111 Ga0182008_10078705 3300014497 Bacteria 1622
112 Ga0157379_10283453 3300014968 Bacteria 1508
113 Ga0182005_1015464 3300015265 Bacteria 2128
114 Ga0209760_100005 3300025207 Bacteria 238315
115 Ga0209760_101871 3300025207 Bacteria 2079
116 Ga0209784_100001 3300025224 Bacteria 3600592
117 Ga0209566_100001 3300025225 Bacteria 3600765
118 Ga0209674_100002 3300025226 Bacteria 3600592
119 Ga0209563_100002 3300025230 Bacteria 2045675
120 Ga0207427_100009 3300025231 Bacteria 663036
121 Ga0209437_100001 3300025233 Bacteria 2045675
122 Ga0209437_100073 3300025233 Bacteria 302948
123 Ga0207425_1006579 3300025245 Bacteria 3161
124 Ga0207425_1016274 3300025245 Bacteria 1653
125 Ga0209677_100002 3300025253 Bacteria 2045675
126 Ga0209129_1000560 3300025258 Bacteria 25649
127 Ga0209233_1002354 3300025261 Bacteria 7031
128 Ga0209673_1000162 3300025273 Bacteria 139078
129 Ga0209673_1007772 3300025273 Bacteria 4872
130 Ga0209675_1010450 3300025291 Bacteria 3166
131 Ga0209025_1000530 3300025294 Bacteria 72703
132 Ga0209025_1019461 3300025294 Bacteria 3774
133 Ga0209564_1000234 3300025295 Bacteria 121532
134 Ga0209758_1000195 3300025297 Bacteria 133982
135 Ga0209758_1000514 3300025297 Bacteria 62177
136 Ga0209758_1035342 3300025297 Bacteria 1971
137 Ga0209256_1000992 3300025299 Bacteria 33792
138 Ga0207426_1000299 3300025302 Bacteria 97846
139 Ga0209051_1012619 3300025303 Bacteria 4076
140 Ga0207696_1000030 3300025711 Bacteria 395961
141 Ga0207696_1000037 3300025711 Bacteria 334893
142 Ga0207696_1002602 3300025711 Bacteria 8756
143 Ga0207696_1003306 3300025711 Bacteria 7428
144 Ga0207655_1000673 3300025728 Bacteria 40069
145 Ga0207655_1003170 3300025728 Bacteria 12416
146 Ga0207655_1003696 3300025728 Bacteria 11271
147 Ga0207655_1007562 3300025728 Bacteria 7034
148 Ga0207655_1009180 3300025728 Bacteria 6177
149 Ga0207655_1027280 3300025728 Bacteria 2723
150 Ga0207713_1000001 3300025735 Bacteria 2295391
151 Ga0207713_1000015 3300025735 Bacteria 424741
152 Ga0207642_10019392 3300025899 Bacteria 2632
153 Ga0207654_10000005 3300025911 Bacteria 869492
154 Ga0207662_10004749 3300025918 Bacteria 7180
155 Ga0207650_10089943 3300025925 Bacteria 2344
156 Ga0207659_10038480 3300025926 Bacteria 3327
157 Ga0207644_10222461 3300025931 Bacteria 1497
158 Ga0207706_10030049 3300025933 Bacteria 4849
159 Ga0207709_10018995 3300025935 Bacteria 3857
160 Ga0207709_10087386 3300025935 Bacteria 2026
161 Ga0207670_10054550 3300025936 Bacteria 2697
162 Ga0207669_10002812 3300025937 Bacteria 7457
163 Ga0207704_10079779 3300025938 Bacteria 2110
164 Ga0207691_10005888 3300025940 Bacteria 11842
165 Ga0207711_10017547 3300025941 Bacteria 5946
166 Ga0207689_10007009 3300025942 Bacteria 9908
167 Ga0207667_10247139 3300025949 Bacteria 1825
168 Ga0207668_10007866 3300025972 Bacteria 6337
169 Ga0207639_10327034 3300026041 Bacteria 1363
170 Ga0207639_10426223 3300026041 Bacteria 1200
171 Ga0207678_10054040 3300026067 Bacteria 3460
172 Ga0207708_10009068 3300026075 Bacteria 7360
173 Ga0207648_10004526 3300026089 Bacteria 14249
174 Ga0207674_10027567 3300026116 Bacteria 6006
175 Ga0207674_10035089 3300026116 Bacteria 5236
176 Ga0207674_10058113 3300026116 Bacteria 3920
177 Ga0207674_10182102 3300026116 Bacteria 2052
178 Ga0209281_1000765 3300027111 Bacteria 30782
179 Ga0209371_1000017 3300027312 Bacteria 625776
180 Ga0209371_1000033 3300027312 Bacteria 381084
181 Ga0209371_1000075 3300027312 Bacteria 196676
182 Ga0209371_1000183 3300027312 Bacteria 91570
183 Ga0207428_10000079 3300027907 Bacteria 136472
184 Ga0268265_10033652 3300028380 Bacteria 3728
185 Ga0307515_10000154 3300028794 Bacteria 166582
186 Ga0307515_10000252 3300028794 Bacteria 132500
187 Ga0307515_10000506 3300028794 Bacteria 93172
188 Ga0307515_10055581 3300028794 Bacteria 5779
189 Ga0268256_1000036 3300030500 Bacteria 370250
190 Ga0268256_1000068 3300030500 Bacteria 196676
191 Ga0268256_1000155 3300030500 Bacteria 91570
192 Ga0268256_1000652 3300030500 Bacteria 26448
193 Ga0307512_10076183 3300030522 Bacteria 2448
194 Ga0316181_1074575 3300030744 Bacteria 1620
195 Ga0307513_10002254 3300031456 Bacteria 26926
196 Ga0307513_10022796 3300031456 Bacteria 7348
197 Ga0307513_10026198 3300031456 Bacteria 6729
198 Ga0307513_10085649 3300031456 Bacteria 3233
199 Ga0307509_10001872 3300031507 Bacteria 34763
200 Ga0307509_10019418 3300031507 Bacteria 7752
201 Ga0307509_10026683 3300031507 Bacteria 6437
202 Ga0307408_100060235 3300031548 Bacteria 2766
203 Ga0307508_10000856 3300031616 Bacteria 35350
204 Ga0307508_10120579 3300031616 Bacteria 2225
205 Ga0307514_10013902 3300031649 Bacteria 6669
206 Ga0307410_10002601 3300031852 Bacteria 8772
207 Ga0307410_10124064 3300031852 Bacteria 1888
208 Ga0307410_10147044 3300031852 Bacteria 1750
209 Ga0307406_10064097 3300031901 Bacteria 2383
210 Ga0307407_10050867 3300031903 Bacteria 2372
211 Ga0307407_10100885 3300031903 Bacteria 1791
212 Ga0307412_10044851 3300031911 Bacteria 2886
213 Ga0307409_100174815 3300031995 Bacteria 1894
214 Ga0307409_100309381 3300031995 Bacteria 1474
215 Ga0307416_100098360 3300032002 Bacteria 2537
216 Ga0307416_100147574 3300032002 Bacteria 2151
217 Ga0307414_10005843 3300032004 Bacteria 6805
218 Ga0307411_10001057 3300032005 Bacteria 10666
219 Ga0307411_10307278 3300032005 Bacteria 1275
220 Ga0307415_100006784 3300032126 Bacteria 6212
221 Ga0307415_100122037 3300032126 Bacteria 1956
222 Ga0307415_100157818 3300032126 Bacteria 1754
223 Ga0307510_10213443 3300033180 Bacteria 1450
224 Ga0439438_000005 3300041405 Bacteria 408610
225 Ga0439438_014750 3300041405 Bacteria 2318
226 Ga0439439_0014485 3300041406 Bacteria 1921
227 Ga0439447_003169 3300041407 Bacteria 5859
228 Ga0439466_0000009 3300041411 Bacteria 232657
229 Ga0439465_0006701 3300041413 Bacteria 3656
230 Ga0451841_0122940 3300041498 Bacteria 1660
231 Ga0439445_0013306 3300042004 Bacteria 1991
232 Ga0439432_011630 3300042006 Bacteria 3031
233 Ga0439449_0014106 3300042007 Bacteria 3006
234 Ga0439449_0124386 3300042007 Bacteria 958
235 Ga0439452_000001 3300042010 Bacteria 1725439
236 Ga0450907_000466 3300042146 Bacteria 11488
237 Ga0439446_0013487 3300042156 Bacteria 2243
238 Ga0439464_0004430 3300042439 Bacteria 3593
239 Ga0466963_0006148 3300044694 Bacteria 7086
240 Ga0466970_0001082 3300044765 Bacteria 13195
241 Ga0466957_0012786 3300044842 Bacteria 4864
242 Ga0466958_0060735 3300045836 Bacteria 2301
243 Ga0466967_0254382 3300045976 Bacteria 1679
244 Ga0495617_004042 3300046452 Bacteria 5391
245 Ga0495627_006782 3300046453 Bacteria 4455
246 Ga0495592_0021281 3300046454 Bacteria 4932
247 Ga0495590_0029175 3300046457 Bacteria 1934
248 Ga0495591_000012 3300046458 Bacteria 274403
249 Ga0495591_001060 3300046458 Bacteria 18495
250 Ga0495629_0077213 3300046459 Bacteria 2325
251 Ga0495638_0000077 3300046460 Bacteria 158724
252 Ga0495638_0000218 3300046460 Bacteria 79814
253 Ga0495638_0001437 3300046460 Bacteria 21570
254 Ga0495638_0007842 3300046460 Bacteria 7619
255 Ga0495638_0033069 3300046460 Bacteria 3308
256 Ga0495638_0051254 3300046460 Bacteria 2574
257 Ga0495650_0000026 3300046471 Bacteria 476029
258 Ga0495650_0000106 3300046471 Bacteria 202178
259 Ga0495650_0025078 3300046471 Bacteria 2803
260 Ga0495650_0075839 3300046471 Bacteria 1308
261 Ga0495605_0006656 3300046474 Bacteria 6619
262 Ga0495605_0025655 3300046474 Bacteria 3070
263 Ga0495605_0065456 3300046474 Bacteria 1728
264 Ga0495662_0000315 3300046476 Bacteria 21018
265 Ga0495584_0029796 3300046491 Bacteria 2765
266 Ga0495585_0011922 3300046492 Bacteria 5133
267 Ga0495607_0004379 3300046501 Bacteria 10406
268 Ga0495607_0008326 3300046501 Bacteria 7092
269 Ga0495607_0081114 3300046501 Bacteria 1782
270 Ga0495583_0000749 3300046506 Bacteria 41285
271 Ga0495583_0007423 3300046506 Bacteria 6891
272 Ga0495583_0127185 3300046506 Bacteria 1068
273 Ga0495606_0000816 3300046507 Bacteria 47367
274 Ga0495606_0017410 3300046507 Bacteria 5434
275 Ga0495606_0037044 3300046507 Bacteria 3315
276 Ga0495606_0188145 3300046507 Bacteria 1185
277 Ga0495610_0011178 3300046512 Bacteria 5506
278 Ga0495610_0023063 3300046512 Bacteria 3391
279 Ga0495610_0034364 3300046512 Bacteria 2612
280 Ga0495610_0052858 3300046512 Bacteria 1970
281 Ga0495610_0065604 3300046512 Bacteria 1712
282 Ga0495610_0111951 3300046512 Bacteria 1208
283 Ga0495616_0005102 3300046513 Bacteria 8161
284 Ga0495616_0019065 3300046513 Bacteria 3750
285 Ga0495616_0070571 3300046513 Bacteria 1691
286 Ga0495620_0000045 3300046515 Bacteria 109595
287 Ga0495620_0001359 3300046515 Bacteria 14800
288 Ga0495631_0008932 3300046518 Bacteria 5026
289 Ga0495631_0070413 3300046518 Bacteria 1512
290 Ga0495631_0113138 3300046518 Bacteria 1167
291 Ga0495632_0000437 3300046519 Bacteria 39744
292 Ga0495632_0008974 3300046519 Bacteria 6067
293 Ga0495637_0000938 3300046520 Bacteria 18622
294 Ga0495643_0001301 3300046522 Bacteria 23726
295 Ga0495643_0024303 3300046522 Bacteria 3439
296 Ga0495643_0057033 3300046522 Bacteria 2082
297 Ga0495643_0078855 3300046522 Bacteria 1718
298 Ga0495644_0010649 3300046523 Bacteria 3542
299 Ga0495648_0009401 3300046524 Bacteria 7586
300 Ga0495648_0018761 3300046524 Bacteria 4882
301 Ga0495648_0023176 3300046524 Bacteria 4258
302 Ga0495648_0029018 3300046524 Bacteria 3677
303 Ga0495648_0083485 3300046524 Bacteria 1810
304 Ga0495648_0158451 3300046524 Bacteria 1173
305 Ga0495663_0002152 3300046525 Bacteria 6007
306 Ga0495654_0000021 3300046530 Bacteria 270163
307 Ga0495654_0000497 3300046530 Bacteria 32203
308 Ga0495654_0001498 3300046530 Bacteria 15974
309 Ga0495654_0002119 3300046530 Bacteria 12962
310 Ga0495654_0043991 3300046530 Bacteria 2211
311 Ga0495654_0121012 3300046530 Bacteria 1185
312 Ga0495609_0000419 3300046538 Bacteria 35536
313 Ga0495609_0026801 3300046538 Bacteria 2637
314 Ga0495597_0013560 3300046542 Bacteria 3899
315 Ga0495622_0024464 3300046557 Bacteria 2820
316 Ga0495633_0031969 3300046558 Bacteria 2545
317 Ga0495668_0022364 3300046616 Bacteria 3615
318 Ga0495668_0022886 3300046616 Bacteria 3569
319 Ga0495668_0038827 3300046616 Bacteria 2659
320 Ga0495611_0000804 3300046648 Bacteria 17407
321 Ga0495611_0068421 3300046648 Bacteria 1621
322 Ga0495611_0117122 3300046648 Bacteria 1242
323 Ga0495625_0002481 3300046660 Bacteria 19883
324 Ga0495625_0004783 3300046660 Bacteria 12660
325 Ga0495625_0025179 3300046660 Bacteria 4515
326 Ga0495625_0033428 3300046660 Bacteria 3803
327 Ga0495625_0209364 3300046660 Bacteria 1282
328 Ga0495635_0141076 3300046663 Bacteria 1641
329 Ga0495661_0004792 3300046665 Bacteria 9703
330 Ga0495661_0013097 3300046665 Bacteria 5581
331 Ga0495588_0000521 3300046674 Bacteria 18591
332 Ga0495588_0001026 3300046674 Bacteria 12146
333 Ga0495588_0099306 3300046674 Bacteria 1529
334 Ga0495613_0000804 3300046689 Bacteria 24340
335 Ga0495624_0058562 3300046690 Bacteria 2419
336 Ga0495670_0019954 3300046691 Bacteria 3303
337 Ga0495671_0000079 3300046692 Bacteria 93288
338 Ga0495671_0002261 3300046692 Bacteria 12245
339 Ga0495649_0000237 3300046694 Bacteria 48559
340 Ga0495649_0002547 3300046694 Bacteria 12774
341 Ga0495649_0078984 3300046694 Bacteria 1760
342 Ga0495649_0154135 3300046694 Bacteria 1206
343 Ga0495660_0000004 3300046810 Bacteria 1003183
344 Ga0495660_0000029 3300046810 Bacteria 228905
345 Ga0495660_0012644 3300046810 Bacteria 4899
346 Ga0495660_0027154 3300046810 Bacteria 3239
347 Ga0495636_0008470 3300047318 Bacteria 4058
348 Ga0495672_0000001 3300047320 Bacteria 1458820
349 Ga0495672_0000053 3300047320 Bacteria 233823
350 Ga0495683_0017012 3300047323 Bacteria 3771
351 Ga0495687_000090 3300047443 Bacteria 141153
352 Ga0495687_001665 3300047443 Bacteria 19940
353 Ga0495687_023268 3300047443 Bacteria 2961
354 Ga0495687_038849 3300047443 Bacteria 2109
355 Ga0495679_007164 3300047446 Bacteria 4686
356 Ga0495673_0000810 3300047469 Bacteria 29322
357 Ga0495681_0001033 3300047470 Bacteria 21264
358 Ga0495686_0000157 3300047472 Bacteria 130757
359 Ga0496100_0077096 3300048903 Bacteria 2240
360 Ga0496102_0010526 3300048905 Bacteria 7963
361 Ga0496104_0000895 3300048907 Bacteria 25644
362 Ga0496105_0001631 3300048908 Bacteria 15959
363 Ga0496106_0162871 3300048909 Bacteria 1765
364 Ga0496110_0366778 3300048913 Bacteria 1312
365 Ga0496110_0405752 3300048913 Bacteria 1242
366 Ga0496112_0019104 3300048915 Bacteria 6460
367 Ga0496116_0000074 3300048919 Bacteria 231767
368 Ga0496116_0000206 3300048919 Bacteria 112462
369 Ga0496117_0000022 3300048920 Bacteria 439512
370 Ga0496117_0000268 3300048920 Bacteria 98537
371 Ga0496117_0000643 3300048920 Bacteria 56275
372 Ga0496118_0000007 3300048921 Bacteria 650986
373 Ga0496118_0000085 3300048921 Bacteria 179731
374 Ga0496118_0000688 3300048921 Bacteria 54924
375 Ga0496118_0063689 3300048921 Bacteria 2711
376 Ga0496119_0000012 3300048922 Bacteria 411917
377 Ga0496119_0000162 3300048922 Bacteria 92734
378 Ga0496119_0006224 3300048922 Bacteria 11146
379 Ga0496119_0084221 3300048922 Bacteria 1824
380 Ga0496120_0000004 3300048923 Bacteria 534793
381 Ga0496120_0000107 3300048923 Bacteria 139739
382 Ga0496120_0107760 3300048923 Bacteria 1460
383 Ga0496121_0000504 3300048924 Bacteria 74639
384 Ga0496121_0015149 3300048924 Bacteria 8107
385 Ga0496122_0000064 3300048925 Bacteria 239959
386 Ga0496122_0006650 3300048925 Bacteria 13177
387 Ga0496122_0008815 3300048925 Bacteria 10777
388 Ga0496122_0163987 3300048925 Bacteria 1350
389 Ga0496123_0000049 3300048926 Bacteria 239949
390 Ga0496123_0000543 3300048926 Bacteria 64856
391 Ga0496123_0003729 3300048926 Bacteria 16752
392 Ga0496123_0033009 3300048926 Bacteria 3733
393 Ga0496123_0058208 3300048926 Bacteria 2509
394 Ga0496124_0000027 3300048927 Bacteria 376097
395 Ga0496124_0000216 3300048927 Bacteria 112485
396 Ga0496124_0012871 3300048927 Bacteria 8216
397 Ga0496124_0017248 3300048927 Bacteria 6811
398 Ga0496124_0025126 3300048927 Bacteria 5401
399 Ga0496124_0026922 3300048927 Bacteria 5175
400 Ga0496124_0032762 3300048927 Bacteria 4583
401 Ga0496124_0128672 3300048927 Bacteria 2014
402 Ga0496125_0000305 3300048928 Bacteria 96581
403 Ga0496125_0027077 3300048928 Bacteria 5206
404 Ga0496125_0094204 3300048928 Bacteria 2232
405 Ga0496126_0008230 3300048929 Bacteria 11268
406 Ga0496126_0021737 3300048929 Bacteria 6258
407 Ga0496126_0199349 3300048929 Bacteria 1691
408 Ga0495678_000059 3300049459 Bacteria 143694
409 Ga0495678_000991 3300049459 Bacteria 24332
410 Ga0495682_0000001 3300049460 Bacteria 1559116
411 Ga0495682_0001980 3300049460 Bacteria 10125
412 Ga0495682_0010492 3300049460 Bacteria 3586
413 Ga0495682_0033576 3300049460 Bacteria 1894
414 Ga0501036_0030409 3300049572 Bacteria 4562
415 Ga0501036_0105188 3300049572 Bacteria 2387
416 Ga0501038_0202208 3300049574 Bacteria 1594
417 Ga0501039_0186981 3300049575 Bacteria 1629
418 Ga0501040_0027447 3300049576 Bacteria 3834
419 Ga0501040_0068022 3300049576 Bacteria 2456
420 Ga0501042_0027489 3300049578 Bacteria 4001
421 Ga0501071_0055094 3300049587 Bacteria 2870
422 Ga0501072_0480418 3300049588 Bacteria 983
423 Ga0501074_0014446 3300049590 Bacteria 5746
424 Ga0501075_0057576 3300049591 Bacteria 2926
425 Ga0501075_0117698 3300049591 Bacteria 2020
426 Ga0501076_0079272 3300049592 Bacteria 2636
427 Ga0501077_0150560 3300049593 Bacteria 1476
428 Ga0501045_0216314 3300049824 Bacteria 1427
429 nmdc:mga03683_3718_c1 3300050489 Bacteria 4971
430 nmdc:mga03683_95944_c1 3300050489 Bacteria 1298
431 nmdc:mga00v17_16235_c1 3300050491 Bacteria 4196
432 nmdc:mga0k408_73_c1 3300050493 Bacteria 47723
433 nmdc:mga06z11_20500_c1 3300050494 Bacteria 3056
434 nmdc:mga05p37_286806_c1 3300050507 Bacteria 1961
435 nmdc:mga05p37_298760_c1 3300050507 Bacteria 1914
436 nmdc:mga05p37_62294_c1 3300050507 Bacteria 4590
437 nmdc:mga09592_82989_c1 3300050508 Bacteria 2731
438 nmdc:mga0qj67_44634_c1 3300050509 Bacteria 3494
439 nmdc:mga06r32_12278_c1 3300050510 Bacteria 7725
440 nmdc:mga08y16_66784_c1 3300050511 Bacteria 3754
441 nmdc:mga0n895_397218_c1 3300050512 Bacteria 1394
442 nmdc:mga0rr50_400404_c1 3300050513 Bacteria 1159
443 nmdc:mga0a205_106656_c1 3300050515 Bacteria 2699
444 nmdc:mga0a205_212761_c1 3300050515 Bacteria 1821
445 nmdc:mga0sz30_9195_c1 3300050516 Bacteria 3751
446 Ga0500578_0000148 3300053086 Bacteria 83724
447 Ga0500578_0016498 3300053086 Bacteria 4743
448 Ga0500644_0031855 3300053088 Bacteria 1680
449 Ga0500583_0000571 3300053092 Bacteria 11169
450 Ga0500557_006156 3300053105 Bacteria 2689
451 Ga0500560_000070 3300053107 Bacteria 9820
452 Ga0500562_043768 3300053108 Bacteria 1192
453 Ga0500569_014409 3300053109 Bacteria 1956
454 Ga0500572_001549 3300053111 Bacteria 6149
455 Ga0500592_008570 3300053116 Bacteria 1623
456 Ga0500594_0000906 3300053118 Bacteria 6358
457 Ga0500595_010875 3300053119 Bacteria 3592
458 Ga0500597_002155 3300053120 Bacteria 5359
459 Ga0500608_000204 3300053122 Bacteria 23691
460 Ga0500608_014178 3300053122 Bacteria 3553
461 Ga0500618_000278 3300053125 Bacteria 39344
462 Ga0500618_000814 3300053125 Bacteria 17169
463 Ga0500618_011530 3300053125 Bacteria 2341
464 Ga0500618_011690 3300053125 Bacteria 2320
465 Ga0500618_013987 3300053125 Bacteria 2062
466 Ga0500621_000003 3300053126 Bacteria 596975
467 Ga0500658_0000169 3300053134 Bacteria 30993
468 Ga0500559_0004388 3300053136 Bacteria 6709
469 Ga0500564_004134 3300053138 Bacteria 5766
470 Ga0500568_0000042 3300053139 Bacteria 127026
471 Ga0500573_0011508 3300053140 Bacteria 4955
472 Ga0500574_000020 3300053141 Bacteria 31411
473 Ga0500616_0000222 3300053153 Bacteria 88791
474 Ga0500616_0051491 3300053153 Bacteria 2169
475 Ga0500619_003044 3300053154 Bacteria 3355
476 Ga0500622_0000331 3300053156 Bacteria 46916
477 Ga0500622_0001696 3300053156 Bacteria 17110
478 Ga0500624_000030 3300053157 Bacteria 105085
479 Ga0500627_0020049 3300053158 Bacteria 2676
480 Ga0500636_0000007 3300053177 Bacteria 171404
481 Ga0500636_0000392 3300053177 Bacteria 24127
482 Ga0500636_0000852 3300053177 Bacteria 16393
483 Ga0500636_0023168 3300053177 Bacteria 3670
484 Ga0500636_0049767 3300053177 Bacteria 2464
485 Ga0500636_0049999 3300053177 Bacteria 2458
486 Ga0500567_059521 3300053723 Bacteria 1715
487 Ga0500609_000493 3300053731 Bacteria 5879
488 Ga0590071_000686 3300059421 Bacteria 9599
489 Ga0590071_004845 3300059421 Bacteria 3248
490 Ga0590074_003805 3300059423 Bacteria 2499
491 Ga0590075_000356 3300059424 Bacteria 12686
492 Ga0590075_001623 3300059424 Bacteria 5553
493 Ga0590077_000237 3300059426 Bacteria 15719
494 Ga0590077_000555 3300059426 Bacteria 10325
495 Ga0590077_004966 3300059426 Bacteria 2721
496 Ga0501082_0248393 3300060353 Bacteria 1548
497 Ga0530510_0060597 3300061734 Bacteria 2739

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042007 Ga0439449_0124386 Ga0439449_0124386_11_886 267
2 3300050513 nmdc:mga0rr50_400404_c1 nmdc:mga0rr50_400404_c1_190_1149 268
3 3300049574 Ga0501038_0202208 Ga0501038_0202208_560_1531 275
4 3300049575 Ga0501039_0186981 Ga0501039_0186981_618_1589 275
5 3300049576 Ga0501040_0068022 Ga0501040_0068022_53_1024 275
6 3300049578 Ga0501042_0027489 Ga0501042_0027489_2963_3934 275
7 3300049587 Ga0501071_0055094 Ga0501071_0055094_1879_2850 275
8 3300049591 Ga0501075_0057576 Ga0501075_0057576_92_1063 275
9 3300049572 Ga0501036_0030409 Ga0501036_0030409_3557_4528 276
10 3300050512 nmdc:mga0n895_397218_c1 nmdc:mga0n895_397218_c1_249_1193 277
11 3300031649 Ga0307514_10013902 Ga0307514_100139024 278
12 3300059426 Ga0590077_004966 Ga0590077_004966_1499_2464 278
13 3300028794 Ga0307515_10055581 Ga0307515_100555814 280
14 3300031456 Ga0307513_10002254 Ga0307513_1000225413 280
15 3300031507 Ga0307509_10026683 Ga0307509_100266833 281
16 3300031616 Ga0307508_10000856 Ga0307508_1000085619 281
17 iso_pu_bacteria 2513237156 2513988288 282
18 3300005293 Ga0065715_10130877 Ga0065715_101308772 283
19 3300005331 Ga0070670_100002435 Ga0070670_1000024359 283
20 3300005564 Ga0070664_100131425 Ga0070664_1001314252 283
21 3300005577 Ga0068857_100008811 Ga0068857_1000088116 283
22 3300006051 Ga0075364_10045310 Ga0075364_100453103 283
23 3300006178 Ga0075367_10034886 Ga0075367_100348862 283
24 3300006195 Ga0075366_10000078 Ga0075366_100000788 283
25 3300009094 Ga0111539_10000234 Ga0111539_1000023439 283
26 3300026116 Ga0207674_10027567 Ga0207674_100275674 283
27 3300027907 Ga0207428_10000079 Ga0207428_1000007990 283
28 3300050491 nmdc:mga00v17_16235_c1 nmdc:mga00v17_16235_c1_2902_3846 283
29 3300050493 nmdc:mga0k408_73_c1 nmdc:mga0k408_73_c1_17140_18084 283
30 3300050494 nmdc:mga06z11_20500_c1 nmdc:mga06z11_20500_c1_1246_2190 283
31 3300050507 nmdc:mga05p37_62294_c1 nmdc:mga05p37_62294_c1_37_981 283
32 3300050508 nmdc:mga09592_82989_c1 nmdc:mga09592_82989_c1_924_1868 283
33 3300050510 nmdc:mga06r32_12278_c1 nmdc:mga06r32_12278_c1_308_1252 283
34 3300050511 nmdc:mga08y16_66784_c1 nmdc:mga08y16_66784_c1_2324_3268 283
35 3300009147 Ga0114129_10013211 Ga0114129_100132116 285
36 3300025931 Ga0207644_10222461 Ga0207644_102224612 285
37 3300031548 Ga0307408_100060235 Ga0307408_1000602352 285
38 3300031852 Ga0307410_10002601 Ga0307410_100026015 285
39 3300031901 Ga0307406_10064097 Ga0307406_100640972 285
40 3300031903 Ga0307407_10050867 Ga0307407_100508672 285
41 3300031911 Ga0307412_10044851 Ga0307412_100448513 285
42 3300032002 Ga0307416_100098360 Ga0307416_1000983602 285
43 3300032004 Ga0307414_10005843 Ga0307414_100058435 285
44 3300032005 Ga0307411_10001057 Ga0307411_100010575 285
45 3300032126 Ga0307415_100006784 Ga0307415_1000067842 285
46 3300050507 nmdc:mga05p37_286806_c1 nmdc:mga05p37_286806_c1_198_1139 285
47 3300050515 nmdc:mga0a205_106656_c1 nmdc:mga0a205_106656_c1_1380_2324 285
48 3300048913 Ga0496110_0366778 Ga0496110_0366778_168_1157 286
49 3300005445 Ga0070708_100079193 Ga0070708_1000791932 287
50 3300046460 Ga0495638_0051254 Ga0495638_0051254_1133_2005 287
51 3300005471 Ga0070698_100009329 Ga0070698_1000093298 288
52 3300053156 Ga0500622_0001696 Ga0500622_0001696_13299_14270 288
53 3300005295 Ga0065707_10145681 Ga0065707_101456812 289
54 3300005354 Ga0070675_100097626 Ga0070675_1000976262 289
55 3300005577 Ga0068857_100021708 Ga0068857_1000217082 289
56 3300006844 Ga0075428_100259882 Ga0075428_1002598822 289
57 3300009553 Ga0105249_10003680 Ga0105249_100036803 289
58 3300014325 Ga0163163_10173406 Ga0163163_101734062 289
59 3300014326 Ga0157380_10128892 Ga0157380_101288922 289
60 3300025925 Ga0207650_10089943 Ga0207650_100899432 289
61 3300026116 Ga0207674_10035089 Ga0207674_100350893 289
62 3300030522 Ga0307512_10076183 Ga0307512_100761832 289
63 3300046474 Ga0495605_0065456 Ga0495605_0065456_10_882 290
64 3300048922 Ga0496119_0000012 Ga0496119_0000012_44213_45181 290
65 3300048923 Ga0496120_0000004 Ga0496120_0000004_366737_367705 290
66 3300049460 Ga0495682_0033576 Ga0495682_0033576_10_885 290
67 3300053158 Ga0500627_0020049 Ga0500627_0020049_848_1825 290
68 3300042156 Ga0439446_0013487 Ga0439446_0013487_1051_1998 291
69 3300046460 Ga0495638_0007842 Ga0495638_0007842_3546_4496 291
70 3300050507 nmdc:mga05p37_298760_c1 nmdc:mga05p37_298760_c1_749_1687 291
71 3300009011 Ga0105251_10003991 Ga0105251_100039919 292
72 3300009148 Ga0105243_10021905 Ga0105243_100219053 292
73 3300025728 Ga0207655_1007562 Ga0207655_10075625 292
74 3300025735 Ga0207713_1000015 Ga0207713_1000015298 292
75 3300025935 Ga0207709_10087386 Ga0207709_100873862 292
76 3300048926 Ga0496123_0058208 Ga0496123_0058208_926_1897 292
77 3300048927 Ga0496124_0025126 Ga0496124_0025126_3432_4403 292
78 3300048929 Ga0496126_0021737 Ga0496126_0021737_1923_2894 292
79 3300006846 Ga0075430_100101975 Ga0075430_1001019752 293
80 3300050509 nmdc:mga0qj67_44634_c1 nmdc:mga0qj67_44634_c1_896_1882 293
81 3300005366 Ga0070659_100307990 Ga0070659_1003079901 294
82 3300053116 Ga0500592_008570 Ga0500592_008570_504_1454 294
83 3300005338 Ga0068868_100386146 Ga0068868_1003861461 295
84 3300005347 Ga0070668_100104238 Ga0070668_1001042382 295
85 3300005354 Ga0070675_100026142 Ga0070675_1000261423 295
86 3300005356 Ga0070674_100040034 Ga0070674_1000400343 295
87 3300005364 Ga0070673_100244833 Ga0070673_1002448332 295
88 3300005366 Ga0070659_100263277 Ga0070659_1002632772 295
89 3300005438 Ga0070701_10005828 Ga0070701_100058283 295
90 3300005455 Ga0070663_100022264 Ga0070663_1000222644 295
91 3300005457 Ga0070662_100069133 Ga0070662_1000691332 295
92 3300005459 Ga0068867_100002314 Ga0068867_1000023143 295
93 3300005466 Ga0070685_10005378 Ga0070685_100053782 295
94 3300005539 Ga0068853_100494613 Ga0068853_1004946131 295
95 3300005543 Ga0070672_100182204 Ga0070672_1001822042 295
96 3300005615 Ga0070702_100060783 Ga0070702_1000607832 295
97 3300005617 Ga0068859_100047448 Ga0068859_1000474483 295
98 3300005718 Ga0068866_10112126 Ga0068866_101121262 295
99 3300005841 Ga0068863_100017887 Ga0068863_1000178875 295
100 3300005842 Ga0068858_100113438 Ga0068858_1001134382 295
101 3300005843 Ga0068860_100100376 Ga0068860_1001003762 295
102 3300005844 Ga0068862_100191104 Ga0068862_1001911042 295
103 3300006178 Ga0075367_10087247 Ga0075367_100872472 295
104 3300006237 Ga0097621_100061949 Ga0097621_1000619492 295
105 3300006881 Ga0068865_100023513 Ga0068865_1000235133 295
106 3300006931 Ga0097620_100047456 Ga0097620_1000474562 295
107 3300009098 Ga0105245_10120681 Ga0105245_101206812 295
108 3300009148 Ga0105243_10002962 Ga0105243_100029628 295
109 3300009177 Ga0105248_10036940 Ga0105248_100369403 295
110 3300013306 Ga0163162_10247408 Ga0163162_102474082 295
111 3300013308 Ga0157375_10045052 Ga0157375_100450522 295
112 3300014326 Ga0157380_10051769 Ga0157380_100517693 295
113 3300014968 Ga0157379_10283453 Ga0157379_102834532 295
114 3300025899 Ga0207642_10019392 Ga0207642_100193923 295
115 3300025918 Ga0207662_10004749 Ga0207662_100047493 295
116 3300025926 Ga0207659_10038480 Ga0207659_100384803 295
117 3300025933 Ga0207706_10030049 Ga0207706_100300493 295
118 3300025935 Ga0207709_10018995 Ga0207709_100189954 295
119 3300025936 Ga0207670_10054550 Ga0207670_100545502 295
120 3300025938 Ga0207704_10079779 Ga0207704_100797792 295
121 3300025940 Ga0207691_10005888 Ga0207691_100058888 295
122 3300025941 Ga0207711_10017547 Ga0207711_100175474 295
123 3300025942 Ga0207689_10007009 Ga0207689_100070098 295
124 3300026067 Ga0207678_10054040 Ga0207678_100540402 295
125 3300026075 Ga0207708_10009068 Ga0207708_100090686 295
126 3300026089 Ga0207648_10004526 Ga0207648_1000452612 295
127 3300026116 Ga0207674_10058113 Ga0207674_100581134 295
128 3300028380 Ga0268265_10033652 Ga0268265_100336522 295
129 3300005563 Ga0068855_100389481 Ga0068855_1003894812 296
130 3300006042 Ga0075368_10022163 Ga0075368_100221632 296
131 3300006178 Ga0075367_10125731 Ga0075367_101257311 296
132 3300009545 Ga0105237_10345119 Ga0105237_103451192 296
133 3300010375 Ga0105239_10142952 Ga0105239_101429522 296
134 3300025949 Ga0207667_10247139 Ga0207667_102471392 296
135 3300031507 Ga0307509_10019418 Ga0307509_100194187 296
136 3300033180 Ga0307510_10213443 Ga0307510_102134432 296
137 3300046507 Ga0495606_0037044 Ga0495606_0037044_797_1777 296
138 3300046524 Ga0495648_0029018 Ga0495648_0029018_603_1583 296
139 3300046616 Ga0495668_0022886 Ga0495668_0022886_399_1379 296
140 3300048915 Ga0496112_0019104 Ga0496112_0019104_3609_4586 296
141 3300049460 Ga0495682_0010492 Ga0495682_0010492_2268_3248 296
142 3300050489 nmdc:mga03683_95944_c1 nmdc:mga03683_95944_c1_117_1058 296
143 iso_pu_bacteria 2965032056 2965038786 296
144 3300027312 Ga0209371_1000033 Ga0209371_1000033237 297
145 3300030500 Ga0268256_1000652 Ga0268256_100065228 297
146 3300031507 Ga0307509_10001872 Ga0307509_1000187230 297
147 3300053177 Ga0500636_0023168 Ga0500636_0023168_1127_2107 297
148 3300001989 JGI24739J22299_10027864 JGI24739J22299_100278642 298
149 3300009036 Ga0105244_10007661 Ga0105244_100076614 298
150 3300013102 Ga0157371_10002928 Ga0157371_100029289 298
151 3300013104 Ga0157370_10000336 Ga0157370_1000033635 298
152 3300025728 Ga0207655_1027280 Ga0207655_10272802 298
153 3300042010 Ga0439452_000001 Ga0439452_000001_825929_826900 298
154 3300046454 Ga0495592_0021281 Ga0495592_0021281_3578_4558 298
155 3300046459 Ga0495629_0077213 Ga0495629_0077213_238_1218 298
156 3300046476 Ga0495662_0000315 Ga0495662_0000315_6243_7223 298
157 3300046524 Ga0495648_0083485 Ga0495648_0083485_734_1714 298
158 3300046663 Ga0495635_0141076 Ga0495635_0141076_190_1170 298
159 3300046690 Ga0495624_0058562 Ga0495624_0058562_765_1745 298
160 3300048919 Ga0496116_0000206 Ga0496116_0000206_91001_91972 298
161 3300048920 Ga0496117_0000643 Ga0496117_0000643_53442_54413 298
162 3300048921 Ga0496118_0000688 Ga0496118_0000688_1890_2861 298
163 3300048922 Ga0496119_0084221 Ga0496119_0084221_733_1713 298
164 3300048927 Ga0496124_0017248 Ga0496124_0017248_1313_2284 298
165 3300013102 Ga0157371_10009049 Ga0157371_100090494 299
166 3300031456 Ga0307513_10026198 Ga0307513_100261988 299
167 3300032126 Ga0307415_100122037 Ga0307415_1001220372 299
168 3300046507 Ga0495606_0000816 Ga0495606_0000816_8288_9259 299
169 3300047320 Ga0495672_0000001 Ga0495672_0000001_76816_77787 299
170 iso_pu_bacteria 2882632389 2882633789 299
171 3300005366 Ga0070659_100237175 Ga0070659_1002371751 300
172 3300009174 Ga0105241_10000002 Ga0105241_10000002732 300
173 3300013100 Ga0157373_10012370 Ga0157373_100123703 300
174 3300025911 Ga0207654_10000005 Ga0207654_10000005730 300
175 3300005844 Ga0068862_100034929 Ga0068862_1000349291 302
176 3300046460 Ga0495638_0033069 Ga0495638_0033069_612_1586 302
177 3300053125 Ga0500618_000278 Ga0500618_000278_2249_3226 303
178 3300053731 Ga0500609_000493 Ga0500609_000493_3271_4248 304
179 iso_pu_bacteria 2874604998 2874605718 304
180 3300005356 Ga0070674_100039543 Ga0070674_1000395433 305
181 3300025937 Ga0207669_10002812 Ga0207669_100028122 305
182 3300031995 Ga0307409_100309381 Ga0307409_1003093812 305
183 3300026116 Ga0207674_10182102 Ga0207674_101821022 306
184 3300042004 Ga0439445_0013306 Ga0439445_0013306_186_1133 307
185 3300061734 Ga0530510_0060597 Ga0530510_0060597_1211_2140 307
186 3300026041 Ga0207639_10327034 Ga0207639_103270342 308
187 3300045836 Ga0466958_0060735 Ga0466958_0060735_928_1902 308
188 3300015265 Ga0182005_1015464 Ga0182005_10154642 309
189 3300044694 Ga0466963_0006148 Ga0466963_0006148_4958_5932 309
190 3300044765 Ga0466970_0001082 Ga0466970_0001082_8974_9948 309
191 3300044842 Ga0466957_0012786 Ga0466957_0012786_2041_3015 309
192 3300045976 Ga0466967_0254382 Ga0466967_0254382_282_1256 309
193 3300046512 Ga0495610_0111951 Ga0495610_0111951_36_1010 309
194 3300050515 nmdc:mga0a205_212761_c1 nmdc:mga0a205_212761_c1_790_1731 309
195 3300053125 Ga0500618_000814 Ga0500618_000814_9369_10343 309
196 3300005262 Ga0065165_1003076 Ga0065165_10030763 310
197 3300014497 Ga0182008_10078705 Ga0182008_100787052 310
198 3300026041 Ga0207639_10426223 Ga0207639_104262232 310
199 3300048923 Ga0496120_0107760 Ga0496120_0107760_269_1246 310
200 3300048926 Ga0496123_0033009 Ga0496123_0033009_342_1313 310
201 3300031903 Ga0307407_10100885 Ga0307407_101008852 311
202 3300031995 Ga0307409_100174815 Ga0307409_1001748152 311
203 3300032126 Ga0307415_100157818 Ga0307415_1001578182 311
204 3300049572 Ga0501036_0105188 Ga0501036_0105188_716_1657 311
205 3300049576 Ga0501040_0027447 Ga0501040_0027447_197_1138 311
206 3300049588 Ga0501072_0480418 Ga0501072_0480418_18_959 311
207 3300049590 Ga0501074_0014446 Ga0501074_0014446_41_982 311
208 3300049591 Ga0501075_0117698 Ga0501075_0117698_1059_2000 311
209 3300049592 Ga0501076_0079272 Ga0501076_0079272_478_1419 311
210 3300049593 Ga0501077_0150560 Ga0501077_0150560_20_961 311
211 3300049824 Ga0501045_0216314 Ga0501045_0216314_325_1266 311
212 3300053177 Ga0500636_0000852 Ga0500636_0000852_2504_3481 311
213 3300059421 Ga0590071_000686 Ga0590071_000686_7684_8625 311
214 3300059423 Ga0590074_003805 Ga0590074_003805_471_1412 311
215 3300059424 Ga0590075_000356 Ga0590075_000356_7336_8277 311
216 3300059426 Ga0590077_000555 Ga0590077_000555_7125_8066 311
217 3300060353 Ga0501082_0248393 Ga0501082_0248393_594_1535 311
218 3300006353 Ga0075370_10044307 Ga0075370_100443073 312
219 iso_pu_bacteria 2904504865 2904506044 312
220 3300031852 Ga0307410_10124064 Ga0307410_101240642 313
221 3300032002 Ga0307416_100147574 Ga0307416_1001475742 313
222 3300046512 Ga0495610_0023063 Ga0495610_0023063_179_1150 313
223 3300003856 Ga0058692_1000066 Ga0058692_100006656 315
224 3300027312 Ga0209371_1000183 Ga0209371_100018338 315
225 3300028794 Ga0307515_10000154 Ga0307515_10000154143 315
226 3300030500 Ga0268256_1000155 Ga0268256_100015558 315
227 3300031456 Ga0307513_10022796 Ga0307513_100227967 315
228 3300053088 Ga0500644_0031855 Ga0500644_0031855_660_1634 315
229 3300053156 Ga0500622_0000331 Ga0500622_0000331_17020_17994 315
230 3300048928 Ga0496125_0027077 Ga0496125_0027077_3806_4774 316
231 iso_pu_bacteria 2937126314 2937131984 316
232 iso_pu_bacteria 2970627176 2970632311 316
233 3300003856 Ga0058692_1000052 Ga0058692_100005222 317
234 3300009092 Ga0105250_10000456 Ga0105250_100004564 317
235 3300025711 Ga0207696_1000030 Ga0207696_100003073 317
236 3300046471 Ga0495650_0075839 Ga0495650_0075839_301_1272 317
237 3300048929 Ga0496126_0199349 Ga0496126_0199349_23_994 317
238 iso_pu_bacteria 2512875024 2512961319 317
239 iso_pu_bacteria 2513237164 2514035333 317
240 iso_pu_bacteria 2597489875 2597813060 317
241 iso_pu_bacteria 2687453392 2688596672 317
242 iso_pu_bacteria 2844009547 2844011915 317
243 iso_pu_bacteria 2856328259 2856329544 317
244 iso_pu_bacteria 2856334872 2856338174 317
245 iso_pu_bacteria 2857367948 2857370015 317
246 iso_pu_bacteria 2869169390 2869175278 317
247 iso_pu_bacteria 2869234852 2869240360 317
248 iso_pu_bacteria 2869242130 2869244343 317
249 iso_pu_bacteria 2869249662 2869253540 317
250 iso_pu_bacteria 2869256925 2869263297 317
251 iso_pu_bacteria 2869264136 2869270248 317
252 iso_pu_bacteria 2869271264 2869272313 317
253 iso_pu_bacteria 2871435913 2871441101 317
254 iso_pu_bacteria 2871451962 2871455469 317
255 iso_pu_bacteria 2871459585 2871464164 317
256 iso_pu_bacteria 2874109183 2874116044 317
257 iso_pu_bacteria 2874116593 2874118736 317
258 iso_pu_bacteria 2874131515 2874133756 317
259 iso_pu_bacteria 2874162495 2874166756 317
260 iso_pu_bacteria 2874168670 2874175944 317
261 iso_pu_bacteria 2876386047 2876389185 317
262 iso_pu_bacteria 2876399893 2876405820 317
263 iso_pu_bacteria 2876406927 2876411646 317
264 iso_pu_bacteria 2876420981 2876421773 317
265 iso_pu_bacteria 2878730984 2878738309 317
266 iso_pu_bacteria 2878774303 2878776244 317
267 iso_pu_bacteria 2878781027 2878782564 317
268 iso_pu_bacteria 2903513507 2903518774 317
269 iso_pu_bacteria 2906363423 2906368157 317
270 iso_pu_bacteria 2906370794 2906374527 317
271 iso_pu_bacteria 2906393657 2906399483 317
272 iso_pu_bacteria 2906401398 2906406248 317
273 iso_pu_bacteria 2906408224 2906411647 317
274 iso_pu_bacteria 2906427513 2906433376 317
275 iso_pu_bacteria 2922151315 2922151653 317
276 iso_pu_bacteria 2922172374 2922172480 317
277 iso_pu_bacteria 2924710171 2924718477 317
278 iso_pu_bacteria 2924733363 2924738420 317
279 iso_pu_bacteria 2924741084 2924745054 317
280 iso_pu_bacteria 2924748358 2924748689 317
281 iso_pu_bacteria 2937861824 2937863804 317
282 iso_pu_bacteria 2958108152 2958111985 317
283 iso_pu_bacteria 2958122699 2958124098 317
284 iso_pu_bacteria 2958137437 2958143320 317
285 iso_pu_bacteria 2961183825 2961188390 317
286 iso_pu_bacteria 2965025482 2965025497 317
287 iso_pu_bacteria 2965040258 2965044427 317
288 iso_pu_bacteria 2965089291 2965093480 317
289 iso_pu_bacteria 2965102966 2965108899 317
290 iso_pu_bacteria 2965110997 2965112110 317
291 iso_pu_bacteria 2968138860 2968144810 317
292 iso_pu_bacteria 2970489779 2970491206 317
293 iso_pu_bacteria 2970510686 2970517588 317
294 iso_pu_bacteria 2970532167 2970536679 317
295 iso_pu_bacteria 2970547951 2970551301 317
296 iso_pu_bacteria 2970619444 2970624292 317
297 iso_pu_bacteria 2977851361 2977852169 317
298 iso_pu_bacteria 2977872689 2977879749 317
299 iso_pu_bacteria 2977898635 2977898759 317
300 iso_pu_bacteria 2977907340 2977909450 317
301 iso_pu_bacteria 2977915119 2977921850 317
302 iso_pu_bacteria 2977950692 2977951131 317
303 iso_pu_bacteria 2977957713 2977961578 317
304 iso_pu_bacteria 2979772303 2979774088 317
305 iso_pu_bacteria 2979793036 2979797449 317
306 iso_pu_bacteria 2987673487 2987676082 317
307 iso_pu_bacteria 2996386984 2996391362 317
308 iso_pu_bacteria 3004195979 3004200649 317
309 iso_pu_bacteria 3004232784 3004233311 317
310 iso_pu_bacteria 3004248173 3004253033 317
311 iso_pu_bacteria 3004268573 3004274360 317
312 iso_pu_bacteria 649633066 649871226 317
313 iso_pu_bacteria 8004312739 8004315260 317
314 iso_pu_bacteria 8004361976 8004367775 317
315 iso_pu_bacteria 8004695233 8004696713 317
316 iso_pu_bacteria 8004727605 8004731460 317
317 3300059421 Ga0590071_004845 Ga0590071_004845_551_1564 318
318 3300059424 Ga0590075_001623 Ga0590075_001623_3995_5008 318
319 3300059426 Ga0590077_000237 Ga0590077_000237_2301_3314 318
320 3300046507 Ga0495606_0188145 Ga0495606_0188145_99_1070 319
321 3300046512 Ga0495610_0011178 Ga0495610_0011178_2533_3507 319
322 3300053125 Ga0500618_013987 Ga0500618_013987_1012_1983 319
323 iso_pu_bacteria 2511231035 2511435772 319
324 iso_pu_bacteria 2513237093 2513635209 319
325 iso_pu_bacteria 2516653046 2516898319 319
326 iso_pu_bacteria 2582581299 2585233758 319
327 iso_pu_bacteria 2585427528 2585539015 319
328 iso_pu_bacteria 2585427593 2585836965 319
329 iso_pu_bacteria 2585427633 2585992702 319
330 iso_pu_bacteria 2585427634 2586003434 319
331 iso_pu_bacteria 2599185236 2599720781 319
332 iso_pu_bacteria 2599185299 2599925636 319
333 iso_pu_bacteria 2608642108 2608669456 319
334 iso_pu_bacteria 2615840698 2616550962 319
335 iso_pu_bacteria 2648501693 2650898969 319
336 iso_pu_bacteria 2667528173 2671107379 319
337 iso_pu_bacteria 2684622997 2686353353 319
338 iso_pu_bacteria 2718218232 2720610408 319
339 iso_pu_bacteria 2718218235 2720628958 319
340 iso_pu_bacteria 2718218269 2720772906 319
341 iso_pu_bacteria 2721755556 2723030363 319
342 iso_pu_bacteria 2721755684 2723564725 319
343 iso_pu_bacteria 2721755819 2724092935 319
344 iso_pu_bacteria 2721755823 2724113324 319
345 iso_pu_bacteria 2728369352 2730110896 319
346 iso_pu_bacteria 2738541333 2739034560 319
347 iso_pu_bacteria 2791355261 2793329155 319
348 iso_pu_bacteria 2791355263 2793340876 319
349 iso_pu_bacteria 2791355265 2793352403 319
350 iso_pu_bacteria 2802429605 2805927659 319
351 iso_pu_bacteria 2802429606 2805936134 319
352 iso_pu_bacteria 2802429633 2806049083 319
353 iso_pu_bacteria 2802429634 2806055588 319
354 iso_pu_bacteria 2802429635 2806061386 319
355 iso_pu_bacteria 2802429636 2806069910 319
356 iso_pu_bacteria 2802429637 2806077697 319
357 iso_pu_bacteria 2808606414 2809123573 319
358 iso_pu_bacteria 2818991461 2819682691 319
359 iso_pu_bacteria 2821123053 2821129510 319
360 iso_pu_bacteria 2838042994 2838048862 319
361 iso_pu_bacteria 2838061910 2838062403 319
362 iso_pu_bacteria 2838661181 2838662518 319
363 iso_pu_bacteria 2838668709 2838670104 319
364 iso_pu_bacteria 2838701080 2838702475 319
365 iso_pu_bacteria 2842146304 2842146980 319
366 iso_pu_bacteria 2842192696 2842196961 319
367 iso_pu_bacteria 2842250916 2842252045 319
368 iso_pu_bacteria 2842264693 2842268472 319
369 iso_pu_bacteria 2842285085 2842287471 319
370 iso_pu_bacteria 2842317721 2842318229 319
371 iso_pu_bacteria 2842402390 2842405000 319
372 iso_pu_bacteria 2842409023 2842411582 319
373 iso_pu_bacteria 2842415677 2842417967 319
374 iso_pu_bacteria 2842428310 2842432444 319
375 iso_pu_bacteria 2842434925 2842438748 319
376 iso_pu_bacteria 2842441272 2842445415 319
377 iso_pu_bacteria 2842469257 2842473363 319
378 iso_pu_bacteria 2842489311 2842492808 319
379 iso_pu_bacteria 2842495871 2842496497 319
380 iso_pu_bacteria 2844528606 2844530914 319
381 iso_pu_bacteria 2847085930 2847086828 319
382 iso_pu_bacteria 2847797336 2847799868 319
383 iso_pu_bacteria 2852103415 2852105333 319
384 iso_pu_bacteria 2857531043 2857535857 319
385 iso_pu_bacteria 2865014394 2865015286 319
386 iso_pu_bacteria 2881609920 2881612296 319
387 iso_pu_bacteria 2904474040 2904476325 319
388 iso_pu_bacteria 2917832318 2917832770 319
389 iso_pu_bacteria 2919150387 2919152494 319
390 iso_pu_bacteria 2921257292 2921262553 319
391 iso_pu_bacteria 2927143783 2927145163 319
392 iso_pu_bacteria 2936381700 2936384342 319
393 iso_pu_bacteria 2937023124 2937027783 319
394 iso_pu_bacteria 2945951305 2945952963 319
395 iso_pu_bacteria 2957382221 2957383872 319
396 iso_pu_bacteria 2957395598 2957400551 319
397 iso_pu_bacteria 2957402308 2957405213 319
398 iso_pu_bacteria 2960674078 2960674972 319
399 iso_pu_bacteria 2964615318 2964620605 319
400 iso_pu_bacteria 2964705432 2964708287 319
401 iso_pu_bacteria 2967755722 2967760650 319
402 iso_pu_bacteria 2970102677 2970107171 319
403 iso_pu_bacteria 2984494565 2984496640 319
404 iso_pu_bacteria 2990261002 2990262058 319
405 iso_pu_bacteria 8005282627 8005285982 319
406 iso_pu_bacteria 8005430974 8005436070 319
407 iso_pu_bacteria 8005563573 8005567029 319
408 iso_pu_bacteria 8005570704 8005576103 319
409 iso_pu_bacteria 8005619151 8005624415 319
410 iso_pu_bacteria 8005626139 8005629676 319
411 iso_pu_bacteria 8018163183 8018166006 319
412 iso_pu_bacteria 8024479707 8024483811 319
413 iso_pu_bacteria 8024501048 8024505269 319
414 iso_pu_bacteria 8056382006 8056388317 319
415 3300003187 JGI25151J46595_10001615 JGI25151J46595_100016155 320
416 3300003354 JGI25160J50197_1003728 JGI25160J50197_10037282 320
417 3300003374 JGI25161J50226_1002073 JGI25161J50226_10020732 320
418 3300003771 Ga0055526_1001395 Ga0055526_10013954 320
419 3300003775 Ga0055524_1000327 Ga0055524_100032734 320
420 3300003790 Ga0055528_1001431 Ga0055528_10014314 320
421 3300004625 Ga0055543_1000272 Ga0055543_100027212 320
422 3300006042 Ga0075368_10015172 Ga0075368_100151722 320
423 3300006177 Ga0075362_10053612 Ga0075362_100536122 320
424 3300006186 Ga0075369_10041177 Ga0075369_100411772 320
425 3300006195 Ga0075366_10013872 Ga0075366_100138723 320
426 3300006946 Ga0079104_1001122 Ga0079104_10011228 320
427 3300025245 Ga0207425_1006579 Ga0207425_10065791 320
428 3300025258 Ga0209129_1000560 Ga0209129_10005602 320
429 3300025273 Ga0209673_1000162 Ga0209673_1000162114 320
430 3300025291 Ga0209675_1010450 Ga0209675_10104503 320
431 3300025294 Ga0209025_1000530 Ga0209025_100053066 320
432 3300025294 Ga0209025_1019461 Ga0209025_10194613 320
433 3300025295 Ga0209564_1000234 Ga0209564_100023491 320
434 3300025297 Ga0209758_1000195 Ga0209758_100019516 320
435 3300025297 Ga0209758_1000514 Ga0209758_100051447 320
436 3300025299 Ga0209256_1000992 Ga0209256_10009924 320
437 3300025302 Ga0207426_1000299 Ga0207426_100029957 320
438 3300025303 Ga0209051_1012619 Ga0209051_10126192 320
439 3300027111 Ga0209281_1000765 Ga0209281_10007657 320
440 3300028794 Ga0307515_10000252 Ga0307515_10000252126 320
441 3300028794 Ga0307515_10000506 Ga0307515_1000050613 320
442 3300031456 Ga0307513_10085649 Ga0307513_100856492 320
443 3300041406 Ga0439439_0014485 Ga0439439_0014485_294_1289 320
444 3300041413 Ga0439465_0006701 Ga0439465_0006701_2326_3300 320
445 3300042007 Ga0439449_0014106 Ga0439449_0014106_1874_2848 320
446 3300046460 Ga0495638_0000077 Ga0495638_0000077_132139_133113 320
447 3300046519 Ga0495632_0000437 Ga0495632_0000437_18601_19575 320
448 3300046524 Ga0495648_0158451 Ga0495648_0158451_146_1141 320
449 3300046530 Ga0495654_0000497 Ga0495654_0000497_27060_28034 320
450 3300046530 Ga0495654_0121012 Ga0495654_0121012_67_1041 320
451 3300046558 Ga0495633_0031969 Ga0495633_0031969_1267_2241 320
452 3300048924 Ga0496121_0015149 Ga0496121_0015149_1461_2435 320
453 3300048925 Ga0496122_0008815 Ga0496122_0008815_2657_3631 320
454 3300048926 Ga0496123_0003729 Ga0496123_0003729_7635_8609 320
455 3300048927 Ga0496124_0012871 Ga0496124_0012871_3982_4956 320
456 3300050489 nmdc:mga03683_3718_c1 nmdc:mga03683_3718_c1_2296_3270 320
457 3300050516 nmdc:mga0sz30_9195_c1 nmdc:mga0sz30_9195_c1_361_1335 320
458 3300053107 Ga0500560_000070 Ga0500560_000070_1627_2601 320
459 3300053125 Ga0500618_011690 Ga0500618_011690_845_1819 320
460 3300053153 Ga0500616_0051491 Ga0500616_0051491_320_1294 320
461 iso_pu_bacteria 2513237085 2513579761 320
462 iso_pu_bacteria 2515154134 2515738298 320
463 iso_pu_bacteria 2516653085 2517080339 320
464 iso_pu_bacteria 2585427526 2585526669 320
465 iso_pu_bacteria 2721755686 2723577054 320
466 iso_pu_bacteria 2838686498 2838690646 320
467 iso_pu_bacteria 2838729681 2838735940 320
468 iso_pu_bacteria 2838742623 2838748812 320
469 iso_pu_bacteria 2841734538 2841738917 320
470 iso_pu_bacteria 2841851746 2841855567 320
471 iso_pu_bacteria 2842156927 2842160727 320
472 iso_pu_bacteria 2842163707 2842164247 320
473 iso_pu_bacteria 2842180545 2842184343 320
474 iso_pu_bacteria 2842229732 2842231926 320
475 iso_pu_bacteria 2842243621 2842249747 320
476 iso_pu_bacteria 2842257432 2842263722 320
477 iso_pu_bacteria 2842271015 2842275040 320
478 iso_pu_bacteria 2842304105 2842307524 320
479 iso_pu_bacteria 2844454524 2844460302 320
480 iso_pu_bacteria 2856342000 2856343238 320
481 iso_pu_bacteria 2871474448 2871481127 320
482 iso_pu_bacteria 2874123672 2874129841 320
483 iso_pu_bacteria 2894232714 2894234539 320
484 iso_pu_bacteria 2919114240 2919119073 320
485 iso_pu_bacteria 2933570622 2933573820 320
486 iso_pu_bacteria 2935901341 2935903349 320
487 iso_pu_bacteria 2937836603 2937842978 320
488 iso_pu_bacteria 2958071322 2958072204 320
489 iso_pu_bacteria 2970524798 2970528360 320
490 iso_pu_bacteria 2977864932 2977867198 320
491 iso_pu_bacteria 3003665799 3003670725 320
492 iso_pu_bacteria 8004633249 8004634377 320
493 iso_pu_bacteria 8005307578 8005308118 320
494 iso_pu_bacteria 8054460903 8054465103 320
495 iso_pu_bacteria 8055617313 8055620529 320
496 3300053136 Ga0500559_0004388 Ga0500559_0004388_76_1062 321
497 iso_pu_bacteria 2510917026 2511173795 321
498 iso_pu_bacteria 2515154113 2515635635 321
499 iso_pu_bacteria 2565956521 2566038383 321
500 iso_pu_bacteria 2582581306 2585268446 321
501 iso_pu_bacteria 2582581307 2585275980 321
502 iso_pu_bacteria 2582581308 2585282199 321
503 iso_pu_bacteria 2582581316 2585334698 321
504 iso_pu_bacteria 2582581865 2585390335 321
505 iso_pu_bacteria 2582581867 2585399227 321
506 iso_pu_bacteria 2585427527 2585534272 321
507 iso_pu_bacteria 2585427530 2585557761 321
508 iso_pu_bacteria 2585427531 2585563541 321
509 iso_pu_bacteria 2585427608 2585900952 321
510 iso_pu_bacteria 2599185156 2599336076 321
511 iso_pu_bacteria 2724679232 2725946051 321
512 iso_pu_bacteria 2775506902 2776267235 321
513 iso_pu_bacteria 2775506904 2776282746 321
514 iso_pu_bacteria 2842922631 2842927511 321
515 iso_pu_bacteria 2936367885 2936371351 321
516 iso_pu_bacteria 2936375103 2936375447 321
517 3300003215 JGI25153J46596_10006108 JGI25153J46596_100061083 322
518 3300025245 Ga0207425_1016274 Ga0207425_10162742 322
519 3300025273 Ga0209673_1007772 Ga0209673_10077722 322
520 3300025297 Ga0209758_1035342 Ga0209758_10353422 322
521 3300030744 Ga0316181_1074575 Ga0316181_10745752 322
522 3300031852 Ga0307410_10147044 Ga0307410_101470442 322
523 3300032005 Ga0307411_10307278 Ga0307411_103072782 322
524 3300041498 Ga0451841_0122940 Ga0451841_0122940_271_1248 322
525 3300046452 Ga0495617_004042 Ga0495617_004042_200_1180 322
526 3300046453 Ga0495627_006782 Ga0495627_006782_736_1716 322
527 3300046457 Ga0495590_0029175 Ga0495590_0029175_641_1621 322
528 3300046460 Ga0495638_0000218 Ga0495638_0000218_64277_65257 322
529 3300046460 Ga0495638_0001437 Ga0495638_0001437_2336_3316 322
530 3300046471 Ga0495650_0025078 Ga0495650_0025078_43_1023 322
531 3300046474 Ga0495605_0006656 Ga0495605_0006656_3015_3995 322
532 3300046474 Ga0495605_0025655 Ga0495605_0025655_1637_2614 322
533 3300046492 Ga0495585_0011922 Ga0495585_0011922_1432_2412 322
534 3300046501 Ga0495607_0004379 Ga0495607_0004379_6959_7939 322
535 3300046501 Ga0495607_0081114 Ga0495607_0081114_493_1470 322
536 3300046506 Ga0495583_0000749 Ga0495583_0000749_37301_38281 322
537 3300046506 Ga0495583_0007423 Ga0495583_0007423_4020_5000 322
538 3300046506 Ga0495583_0127185 Ga0495583_0127185_32_1009 322
539 3300046507 Ga0495606_0017410 Ga0495606_0017410_4071_5048 322
540 3300046512 Ga0495610_0034364 Ga0495610_0034364_89_1069 322
541 3300046512 Ga0495610_0052858 Ga0495610_0052858_89_1069 322
542 3300046512 Ga0495610_0065604 Ga0495610_0065604_33_1010 322
543 3300046513 Ga0495616_0005102 Ga0495616_0005102_2549_3529 322
544 3300046513 Ga0495616_0019065 Ga0495616_0019065_915_1895 322
545 3300046515 Ga0495620_0000045 Ga0495620_0000045_773_1753 322
546 3300046515 Ga0495620_0001359 Ga0495620_0001359_233_1213 322
547 3300046518 Ga0495631_0008932 Ga0495631_0008932_2418_3398 322
548 3300046518 Ga0495631_0113138 Ga0495631_0113138_36_1016 322
549 3300046519 Ga0495632_0008974 Ga0495632_0008974_2529_3509 322
550 3300046520 Ga0495637_0000938 Ga0495637_0000938_17163_18143 322
551 3300046522 Ga0495643_0001301 Ga0495643_0001301_11195_12175 322
552 3300046522 Ga0495643_0057033 Ga0495643_0057033_33_1010 322
553 3300046524 Ga0495648_0023176 Ga0495648_0023176_1680_2657 322
554 3300046525 Ga0495663_0002152 Ga0495663_0002152_428_1408 322
555 3300046530 Ga0495654_0002119 Ga0495654_0002119_6310_7290 322
556 3300046530 Ga0495654_0043991 Ga0495654_0043991_145_1125 322
557 3300046538 Ga0495609_0000419 Ga0495609_0000419_4294_5274 322
558 3300046538 Ga0495609_0026801 Ga0495609_0026801_1003_1980 322
559 3300046542 Ga0495597_0013560 Ga0495597_0013560_1620_2597 322
560 3300046557 Ga0495622_0024464 Ga0495622_0024464_30_1010 322
561 3300046616 Ga0495668_0022364 Ga0495668_0022364_2074_3054 322
562 3300046616 Ga0495668_0038827 Ga0495668_0038827_1055_2032 322
563 3300046648 Ga0495611_0000804 Ga0495611_0000804_14274_15254 322
564 3300046648 Ga0495611_0068421 Ga0495611_0068421_77_1057 322
565 3300046660 Ga0495625_0002481 Ga0495625_0002481_1956_2936 322
566 3300046660 Ga0495625_0004783 Ga0495625_0004783_3697_4677 322
567 3300046660 Ga0495625_0025179 Ga0495625_0025179_3167_4147 322
568 3300046660 Ga0495625_0033428 Ga0495625_0033428_2543_3523 322
569 3300046660 Ga0495625_0209364 Ga0495625_0209364_22_1002 322
570 3300046665 Ga0495661_0004792 Ga0495661_0004792_6098_7078 322
571 3300046665 Ga0495661_0013097 Ga0495661_0013097_27_1007 322
572 3300046674 Ga0495588_0000521 Ga0495588_0000521_2830_3810 322
573 3300046674 Ga0495588_0001026 Ga0495588_0001026_8083_9063 322
574 3300046674 Ga0495588_0099306 Ga0495588_0099306_361_1341 322
575 3300046689 Ga0495613_0000804 Ga0495613_0000804_14740_15720 322
576 3300046691 Ga0495670_0019954 Ga0495670_0019954_656_1636 322
577 3300046692 Ga0495671_0000079 Ga0495671_0000079_2075_3055 322
578 3300046694 Ga0495649_0000237 Ga0495649_0000237_21381_22361 322
579 3300046694 Ga0495649_0002547 Ga0495649_0002547_9983_10963 322
580 3300046694 Ga0495649_0078984 Ga0495649_0078984_752_1729 322
581 3300046810 Ga0495660_0027154 Ga0495660_0027154_305_1282 322
582 3300047318 Ga0495636_0008470 Ga0495636_0008470_2505_3485 322
583 3300047443 Ga0495687_000090 Ga0495687_000090_112386_113366 322
584 3300047443 Ga0495687_001665 Ga0495687_001665_13850_14830 322
585 3300047443 Ga0495687_023268 Ga0495687_023268_1893_2873 322
586 3300047443 Ga0495687_038849 Ga0495687_038849_764_1741 322
587 3300047470 Ga0495681_0001033 Ga0495681_0001033_17747_18727 322
588 3300047472 Ga0495686_0000157 Ga0495686_0000157_76046_77026 322
589 3300048921 Ga0496118_0063689 Ga0496118_0063689_542_1519 322
590 3300048925 Ga0496122_0006650 Ga0496122_0006650_10173_11150 322
591 3300048927 Ga0496124_0032762 Ga0496124_0032762_1660_2637 322
592 3300049459 Ga0495678_000059 Ga0495678_000059_114933_115913 322
593 3300049460 Ga0495682_0001980 Ga0495682_0001980_3371_4351 322
594 3300053086 Ga0500578_0000148 Ga0500578_0000148_16335_17315 322
595 3300053086 Ga0500578_0016498 Ga0500578_0016498_1298_2275 322
596 3300053092 Ga0500583_0000571 Ga0500583_0000571_6193_7173 322
597 3300053105 Ga0500557_006156 Ga0500557_006156_1131_2111 322
598 3300053108 Ga0500562_043768 Ga0500562_043768_59_1039 322
599 3300053109 Ga0500569_014409 Ga0500569_014409_144_1121 322
600 3300053111 Ga0500572_001549 Ga0500572_001549_2784_3761 322
601 3300053118 Ga0500594_0000906 Ga0500594_0000906_4119_5099 322
602 3300053119 Ga0500595_010875 Ga0500595_010875_386_1366 322
603 3300053120 Ga0500597_002155 Ga0500597_002155_1562_2542 322
604 3300053122 Ga0500608_000204 Ga0500608_000204_20538_21518 322
605 3300053122 Ga0500608_014178 Ga0500608_014178_972_1952 322
606 3300053125 Ga0500618_011530 Ga0500618_011530_229_1209 322
607 3300053134 Ga0500658_0000169 Ga0500658_0000169_5036_6013 322
608 3300053138 Ga0500564_004134 Ga0500564_004134_504_1484 322
609 3300053139 Ga0500568_0000042 Ga0500568_0000042_24055_25035 322
610 3300053140 Ga0500573_0011508 Ga0500573_0011508_3365_4345 322
611 3300053141 Ga0500574_000020 Ga0500574_000020_9274_10254 322
612 3300053153 Ga0500616_0000222 Ga0500616_0000222_72457_73437 322
613 3300053154 Ga0500619_003044 Ga0500619_003044_966_1946 322
614 3300053157 Ga0500624_000030 Ga0500624_000030_72493_73473 322
615 3300053177 Ga0500636_0000007 Ga0500636_0000007_49642_50619 322
616 3300053177 Ga0500636_0000392 Ga0500636_0000392_3835_4812 322
617 3300053177 Ga0500636_0049767 Ga0500636_0049767_1163_2143 322
618 3300053177 Ga0500636_0049999 Ga0500636_0049999_322_1302 322
619 3300053723 Ga0500567_059521 Ga0500567_059521_662_1642 322
620 2162886007 SwRhRL2b_contig_129826 SwRhRL2b_0620.00007010 323
621 3300002737 JGI25162J39368_1000002 JGI25162J39368_1000002109 323
622 3300002737 JGI25162J39368_1003920 JGI25162J39368_10039204 323
623 3300002771 JGI25163J39215_1000043 JGI25163J39215_100004351 323
624 3300002772 JGI25164J39214_1000066 JGI25164J39214_10000667 323
625 3300003751 Ga0055538_1000003 Ga0055538_1000003109 323
626 3300003752 Ga0055539_1000003 Ga0055539_1000003508 323
627 3300003756 Ga0055533_1000005 Ga0055533_1000005508 323
628 3300003759 Ga0055525_1000005 Ga0055525_1000005109 323
629 3300003841 Ga0055541_1000003 Ga0055541_1000003109 323
630 3300003856 Ga0058692_1000055 Ga0058692_10000559 323
631 3300003856 Ga0058692_1000960 Ga0058692_10009605 323
632 3300003856 Ga0058692_1001591 Ga0058692_10015915 323
633 3300005289 Ga0065704_10000911 Ga0065704_1000091114 323
634 3300005347 Ga0070668_100039963 Ga0070668_1000399632 323
635 3300009011 Ga0105251_10000911 Ga0105251_100009112 323
636 3300009011 Ga0105251_10011259 Ga0105251_100112592 323
637 3300009036 Ga0105244_10000407 Ga0105244_1000040724 323
638 3300009036 Ga0105244_10003474 Ga0105244_100034746 323
639 3300009092 Ga0105250_10000046 Ga0105250_1000004668 323
640 3300009092 Ga0105250_10000167 Ga0105250_100001675 323
641 3300013102 Ga0157371_10023141 Ga0157371_100231411 323
642 3300013105 Ga0157369_10215448 Ga0157369_102154481 323
643 3300013306 Ga0163162_10209293 Ga0163162_102092932 323
644 3300013307 Ga0157372_10037777 Ga0157372_100377775 323
645 3300025207 Ga0209760_100005 Ga0209760_100005108 323
646 3300025207 Ga0209760_101871 Ga0209760_1018712 323
647 3300025224 Ga0209784_100001 Ga0209784_1000013265 323
648 3300025225 Ga0209566_100001 Ga0209566_1000013265 323
649 3300025226 Ga0209674_100002 Ga0209674_1000023265 323
650 3300025230 Ga0209563_100002 Ga0209563_1000021800 323
651 3300025231 Ga0207427_100009 Ga0207427_100009108 323
652 3300025233 Ga0209437_100001 Ga0209437_1000011800 323
653 3300025233 Ga0209437_100073 Ga0209437_100073211 323
654 3300025253 Ga0209677_100002 Ga0209677_1000021800 323
655 3300025261 Ga0209233_1002354 Ga0209233_10023545 323
656 3300025711 Ga0207696_1000037 Ga0207696_100003751 323
657 3300025711 Ga0207696_1002602 Ga0207696_10026026 323
658 3300025711 Ga0207696_1003306 Ga0207696_10033065 323
659 3300025728 Ga0207655_1000673 Ga0207655_100067323 323
660 3300025728 Ga0207655_1003170 Ga0207655_10031706 323
661 3300025728 Ga0207655_1003696 Ga0207655_10036966 323
662 3300025728 Ga0207655_1009180 Ga0207655_10091802 323
663 3300025735 Ga0207713_1000001 Ga0207713_10000011097 323
664 3300025972 Ga0207668_10007866 Ga0207668_100078663 323
665 3300027312 Ga0209371_1000017 Ga0209371_100001722 323
666 3300027312 Ga0209371_1000075 Ga0209371_1000075130 323
667 3300030500 Ga0268256_1000036 Ga0268256_100003686 323
668 3300030500 Ga0268256_1000068 Ga0268256_100006867 323
669 3300031616 Ga0307508_10120579 Ga0307508_101205792 323
670 3300041405 Ga0439438_000005 Ga0439438_000005_398438_399493 323
671 3300041405 Ga0439438_014750 Ga0439438_014750_17_988 323
672 3300041407 Ga0439447_003169 Ga0439447_003169_2359_3330 323
673 3300041411 Ga0439466_0000009 Ga0439466_0000009_137917_138888 323
674 3300042006 Ga0439432_011630 Ga0439432_011630_1849_2820 323
675 3300042146 Ga0450907_000466 Ga0450907_000466_3020_3991 323
676 3300042439 Ga0439464_0004430 Ga0439464_0004430_148_1119 323
677 3300046458 Ga0495591_000012 Ga0495591_000012_172929_173900 323
678 3300046458 Ga0495591_001060 Ga0495591_001060_11119_12090 323
679 3300046471 Ga0495650_0000026 Ga0495650_0000026_55271_56242 323
680 3300046471 Ga0495650_0000106 Ga0495650_0000106_12455_13426 323
681 3300046491 Ga0495584_0029796 Ga0495584_0029796_1748_2719 323
682 3300046501 Ga0495607_0008326 Ga0495607_0008326_5670_6641 323
683 3300046513 Ga0495616_0070571 Ga0495616_0070571_225_1196 323
684 3300046518 Ga0495631_0070413 Ga0495631_0070413_237_1208 323
685 3300046522 Ga0495643_0024303 Ga0495643_0024303_347_1318 323
686 3300046522 Ga0495643_0078855 Ga0495643_0078855_468_1439 323
687 3300046523 Ga0495644_0010649 Ga0495644_0010649_1000_1971 323
688 3300046524 Ga0495648_0009401 Ga0495648_0009401_3239_4210 323
689 3300046524 Ga0495648_0018761 Ga0495648_0018761_3567_4538 323
690 3300046530 Ga0495654_0000021 Ga0495654_0000021_177980_178951 323
691 3300046530 Ga0495654_0001498 Ga0495654_0001498_8893_9864 323
692 3300046648 Ga0495611_0117122 Ga0495611_0117122_141_1112 323
693 3300046692 Ga0495671_0002261 Ga0495671_0002261_4071_5042 323
694 3300046694 Ga0495649_0154135 Ga0495649_0154135_209_1180 323
695 3300046810 Ga0495660_0000004 Ga0495660_0000004_10821_11792 323
696 3300046810 Ga0495660_0000029 Ga0495660_0000029_174763_175734 323
697 3300046810 Ga0495660_0012644 Ga0495660_0012644_3750_4721 323
698 3300047320 Ga0495672_0000053 Ga0495672_0000053_71748_72719 323
699 3300047323 Ga0495683_0017012 Ga0495683_0017012_2788_3759 323
700 3300047446 Ga0495679_007164 Ga0495679_007164_1207_2178 323
701 3300047469 Ga0495673_0000810 Ga0495673_0000810_24662_25633 323
702 3300048903 Ga0496100_0077096 Ga0496100_0077096_295_1266 323
703 3300048905 Ga0496102_0010526 Ga0496102_0010526_6388_7359 323
704 3300048907 Ga0496104_0000895 Ga0496104_0000895_42_1013 323
705 3300048908 Ga0496105_0001631 Ga0496105_0001631_12807_13778 323
706 3300048909 Ga0496106_0162871 Ga0496106_0162871_718_1689 323
707 3300048913 Ga0496110_0405752 Ga0496110_0405752_164_1135 323
708 3300048919 Ga0496116_0000074 Ga0496116_0000074_218351_219322 323
709 3300048920 Ga0496117_0000022 Ga0496117_0000022_295780_296751 323
710 3300048920 Ga0496117_0000268 Ga0496117_0000268_83381_84352 323
711 3300048921 Ga0496118_0000007 Ga0496118_0000007_279647_280618 323
712 3300048921 Ga0496118_0000085 Ga0496118_0000085_174256_175227 323
713 3300048922 Ga0496119_0000162 Ga0496119_0000162_31792_32763 323
714 3300048922 Ga0496119_0006224 Ga0496119_0006224_2070_3041 323
715 3300048923 Ga0496120_0000107 Ga0496120_0000107_57802_58773 323
716 3300048924 Ga0496121_0000504 Ga0496121_0000504_4051_5022 323
717 3300048925 Ga0496122_0000064 Ga0496122_0000064_228238_229209 323
718 3300048925 Ga0496122_0163987 Ga0496122_0163987_30_1001 323
719 3300048926 Ga0496123_0000049 Ga0496123_0000049_10743_11714 323
720 3300048926 Ga0496123_0000543 Ga0496123_0000543_63048_64019 323
721 3300048927 Ga0496124_0000027 Ga0496124_0000027_8442_9413 323
722 3300048927 Ga0496124_0000216 Ga0496124_0000216_56616_57587 323
723 3300048927 Ga0496124_0026922 Ga0496124_0026922_3552_4523 323
724 3300048927 Ga0496124_0128672 Ga0496124_0128672_334_1305 323
725 3300048928 Ga0496125_0000305 Ga0496125_0000305_10332_11303 323
726 3300048928 Ga0496125_0094204 Ga0496125_0094204_235_1206 323
727 3300048929 Ga0496126_0008230 Ga0496126_0008230_8228_9199 323
728 3300049459 Ga0495678_000991 Ga0495678_000991_9237_10208 323
729 3300049460 Ga0495682_0000001 Ga0495682_0000001_1005830_1006801 323
730 3300053126 Ga0500621_000003 Ga0500621_000003_426410_427381 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

77

342

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.5867 52 313
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5749 52 314
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5558 52 314
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5554 23 290
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.5399 22 292
ID Description Score Start End Superfamily
af_P39328_55_321_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9773 50 313 1.10.3470.10
af_P0AGI1_45_314_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9764 49 313 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9757 49 313 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.972 53 313 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9685 49 313 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A6I4G7W6-F1-model_v4 deleted 0.9838 22 323
AF-A0A2V8DE02-F1-model_v4 Ribose ABC transporter permease 0.983 22 322 GO:0005886
GO:0022857
AF-A0A2S4JJN0-F1-model_v4 Ribose ABC transporter permease 0.9793 22 323 GO:0005886
GO:0022857
AF-A0A6I3CFM3-F1-model_v4 ABC transporter permease 0.9791 22 322 GO:0005886
GO:0022857
AF-A0A3L6ZMH8-F1-model_v4 Autoinducer 2 import system permease protein LsrC 0.9783 22 322 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.76 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map