F477924

General Info

Members Datasets Scaffolds Average Seq Length
730 360 1460 126

Family's Representative Sequence

Representative Sequence 3300033524|Ga0316592_1059147|Ga0316592_10591471
Length 125
Sequence MARIAGVDLPNKQIRIALTYIYGIGQTSADKICDKIGLDPVSRVNDLSSDDISKLRTILENDYRVEGRLRTEVALNIKRLMDIGCYRGLRHRRSLPVHGQRTSTNARTRKGPKRSAIKKKGAAKK

Samples

Sample ID Description Type Environment
1 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
210 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
211 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
212 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
215 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
216 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
217 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
218 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
227 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
247 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
256 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
288 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
351 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
352 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.85
Metatranscriptomes 3.01
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.16
Rhizosphere 93.15
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316592_1059147 3300033524 Unclassified 859
2 JGI24752J21851_1004064 3300001976 Bacteria 1921
3 JGI24746J21847_1020002 3300001977 Unclassified 941
4 JGI24745J21846_1001877 3300002073 Bacteria 2086
5 JGI24745J21846_1030132 3300002073 Bacteria 654
6 JGI24033J26618_1000974 3300002155 Unclassified 2760
7 Ga0007409J51694_1082230 3300003575 Bacteria 724
8 JGI25405J52794_10069282 3300003911 Bacteria 769
9 Ga0058859_11628607 3300004798 Bacteria 583
10 Ga0058860_12074324 3300004801 Bacteria 834
11 Ga0065707_10839861 3300005295 Bacteria 586
12 Ga0070676_10570373 3300005328 Bacteria 812
13 Ga0070683_100102034 3300005329 Bacteria 2702
14 Ga0070690_100048896 3300005330 Bacteria 2695
15 Ga0070690_100484133 3300005330 Bacteria 923
16 Ga0070670_100062379 3300005331 Bacteria 3200
17 Ga0068869_100098511 3300005334 Bacteria 2208
18 Ga0070666_10190417 3300005335 Bacteria 1441
19 Ga0070666_10840992 3300005335 Bacteria 677
20 Ga0068868_100151741 3300005338 Bacteria 1908
21 Ga0068868_100405701 3300005338 Bacteria 1177
22 Ga0070660_100123948 3300005339 Bacteria 2064
23 Ga0070660_100261615 3300005339 Bacteria 1413
24 Ga0070689_101313590 3300005340 Bacteria 652
25 Ga0070691_10023408 3300005341 Bacteria 2868
26 Ga0070661_100031306 3300005344 Bacteria 3846
27 Ga0070668_100151349 3300005347 Bacteria 1876
28 Ga0070668_100706260 3300005347 Bacteria 890
29 Ga0070669_100456507 3300005353 Bacteria 1054
30 Ga0070669_100895243 3300005353 Bacteria 758
31 Ga0070675_100041662 3300005354 Bacteria 3750
32 Ga0070674_100064122 3300005356 Bacteria 2573
33 Ga0070673_100439083 3300005364 Bacteria 1173
34 Ga0070659_100345404 3300005366 Bacteria 1248
35 Ga0070659_100689674 3300005366 Bacteria 882
36 Ga0070667_101332726 3300005367 Bacteria 673
37 Ga0070703_10003156 3300005406 Bacteria 4709
38 Ga0070703_10006895 3300005406 Bacteria 3187
39 Ga0070714_100476481 3300005435 Bacteria 1188
40 Ga0070701_10004277 3300005438 Bacteria 5761
41 Ga0070711_100048282 3300005439 Bacteria 2909
42 Ga0070705_100490055 3300005440 Bacteria 931
43 Ga0070700_100013216 3300005441 Bacteria 4633
44 Ga0070700_100655231 3300005441 Bacteria 829
45 Ga0070694_100013287 3300005444 Bacteria 5141
46 Ga0070694_100100856 3300005444 Bacteria 2042
47 Ga0070708_100014721 3300005445 Bacteria 6444
48 Ga0070708_100273803 3300005445 Bacteria 1588
49 Ga0070708_100644798 3300005445 Bacteria 998
50 Ga0070708_101316367 3300005445 Bacteria 675
51 Ga0070663_100030843 3300005455 Bacteria 3679
52 Ga0070678_100055745 3300005456 Bacteria 2887
53 Ga0070662_100276485 3300005457 Bacteria 1358
54 Ga0070681_10302860 3300005458 Bacteria 1508
55 Ga0068867_100034170 3300005459 Bacteria 3685
56 Ga0068867_100065006 3300005459 Bacteria 2713
57 Ga0068867_100862957 3300005459 Bacteria 812
58 Ga0068867_101348362 3300005459 Bacteria 660
59 Ga0070685_10698105 3300005466 Bacteria 739
60 Ga0070706_100229885 3300005467 Bacteria 1731
61 Ga0070706_100274655 3300005467 Bacteria 1573
62 Ga0070706_100988961 3300005467 Bacteria 776
63 Ga0070707_100006906 3300005468 Bacteria 10515
64 Ga0070707_101203492 3300005468 Bacteria 724
65 Ga0070698_100007643 3300005471 Bacteria 11696
66 Ga0070698_100041688 3300005471 Bacteria 4712
67 Ga0070698_100054167 3300005471 Bacteria 4074
68 Ga0070698_100107271 3300005471 Bacteria 2761
69 Ga0070698_100907534 3300005471 Bacteria 827
70 Ga0070698_101219900 3300005471 Bacteria 702
71 Ga0070699_100024703 3300005518 Bacteria 5180
72 Ga0070699_100277126 3300005518 Bacteria 1502
73 Ga0070699_100381527 3300005518 Bacteria 1272
74 Ga0070699_100788169 3300005518 Bacteria 870
75 Ga0070684_100647548 3300005535 Bacteria 983
76 Ga0068853_101173979 3300005539 Bacteria 741
77 Ga0070686_100043668 3300005544 Bacteria 2813
78 Ga0070695_100831598 3300005545 Bacteria 742
79 Ga0070696_100462117 3300005546 Bacteria 1003
80 Ga0070696_101845249 3300005546 Bacteria 523
81 Ga0070704_100000609 3300005549 Bacteria 17239
82 Ga0070704_101094172 3300005549 Bacteria 724
83 Ga0070664_100079930 3300005564 Bacteria 2815
84 Ga0070664_100178694 3300005564 Bacteria 1886
85 Ga0070664_100353064 3300005564 Bacteria 1338
86 Ga0068857_100116233 3300005577 Bacteria 2406
87 Ga0070702_100070055 3300005615 Bacteria 2068
88 Ga0070702_100566805 3300005615 Bacteria 846
89 Ga0068852_100063116 3300005616 Bacteria 3225
90 Ga0068859_100522081 3300005617 Bacteria 1282
91 Ga0068864_100024465 3300005618 Bacteria 5081
92 Ga0068864_100128273 3300005618 Bacteria 2275
93 Ga0068861_100584776 3300005719 Bacteria 1022
94 Ga0068861_101204216 3300005719 Bacteria 732
95 Ga0068861_102423028 3300005719 Bacteria 528
96 Ga0068851_10296965 3300005834 Bacteria 928
97 Ga0068870_10000274 3300005840 Bacteria 19150
98 Ga0068870_10740636 3300005840 Bacteria 682
99 Ga0068863_100013521 3300005841 Bacteria 7874
100 Ga0068858_100230507 3300005842 Bacteria 1756
101 Ga0068862_100029731 3300005844 Bacteria 4604
102 Ga0081455_10014778 3300005937 Bacteria 7618
103 Ga0081455_10019312 3300005937 Bacteria 6452
104 Ga0081455_10112518 3300005937 Bacteria 2160
105 Ga0081455_10720701 3300005937 Bacteria 633
106 Ga0081538_10103139 3300005981 Bacteria 1428
107 Ga0081538_10117869 3300005981 Bacteria 1284
108 Ga0081538_10144144 3300005981 Bacteria 1092
109 Ga0081538_10159089 3300005981 Bacteria 1007
110 Ga0081539_10011391 3300005985 Bacteria 7035
111 Ga0081539_10048241 3300005985 Bacteria 2424
112 Ga0081539_10170642 3300005985 Bacteria 1029
113 Ga0075432_10026676 3300006058 Bacteria 1985
114 Ga0075432_10348868 3300006058 Bacteria 627
115 Ga0070715_10328701 3300006163 Bacteria 828
116 Ga0070716_100214734 3300006173 Bacteria 1288
117 Ga0075427_10003698 3300006194 Bacteria 2126
118 Ga0097621_100214381 3300006237 Bacteria 1676
119 Ga0068871_100065299 3300006358 Bacteria 2980
120 Ga0075428_100040383 3300006844 Bacteria 5134
121 Ga0075428_100127885 3300006844 Bacteria 2764
122 Ga0075428_100696452 3300006844 Bacteria 1082
123 Ga0075428_100941590 3300006844 Bacteria 915
124 Ga0075428_101030816 3300006844 Bacteria 870
125 Ga0075428_101154883 3300006844 Bacteria 817
126 Ga0075430_100000285 3300006846 Bacteria 35539
127 Ga0075430_100296003 3300006846 Bacteria 1338
128 Ga0075430_100457294 3300006846 Bacteria 1053
129 Ga0075431_100000899 3300006847 Bacteria 26201
130 Ga0075431_100355817 3300006847 Bacteria 1471
131 Ga0075431_100381039 3300006847 Bacteria 1414
132 Ga0075431_101555199 3300006847 Bacteria 619
133 Ga0075433_10032690 3300006852 Bacteria 4457
134 Ga0075434_100262482 3300006871 Bacteria 1746
135 Ga0075429_100000228 3300006880 Bacteria 38162
136 Ga0075429_100608504 3300006880 Bacteria 957
137 Ga0075429_100818455 3300006880 Bacteria 815
138 Ga0068865_100022751 3300006881 Bacteria 4093
139 Ga0068865_100170866 3300006881 Bacteria 1666
140 Ga0097620_100522084 3300006931 Bacteria 1282
141 Ga0105251_10006495 3300009011 Bacteria 7434
142 Ga0105251_10150715 3300009011 Bacteria 1050
143 Ga0105250_10524618 3300009092 Bacteria 540
144 Ga0111539_10369747 3300009094 Bacteria 1669
145 Ga0111539_11017403 3300009094 Bacteria 963
146 Ga0111539_11158676 3300009094 Bacteria 898
147 Ga0105245_10168452 3300009098 Bacteria 2084
148 Ga0105245_10698555 3300009098 Bacteria 1047
149 Ga0105245_10788394 3300009098 Bacteria 988
150 Ga0114129_10013928 3300009147 Bacteria 11456
151 Ga0114129_10035716 3300009147 Bacteria 7021
152 Ga0114129_10039220 3300009147 Bacteria 6678
153 Ga0114129_10145834 3300009147 Bacteria 3243
154 Ga0114129_11378331 3300009147 Bacteria 871
155 Ga0114129_13255886 3300009147 Bacteria 526
156 Ga0105243_10010219 3300009148 Bacteria 7133
157 Ga0105243_10191487 3300009148 Bacteria 1787
158 Ga0105243_10969211 3300009148 Bacteria 851
159 Ga0105242_10009980 3300009176 Bacteria 7270
160 Ga0105242_10014288 3300009176 Bacteria 6150
161 Ga0105242_10248573 3300009176 Bacteria 1602
162 Ga0105242_11448803 3300009176 Bacteria 716
163 Ga0105242_12097326 3300009176 Bacteria 609
164 Ga0105248_10652493 3300009177 Bacteria 1187
165 Ga0105248_11943541 3300009177 Bacteria 668
166 Ga0105248_11953720 3300009177 Bacteria 666
167 Ga0105238_10151244 3300009551 Bacteria 2296
168 Ga0105249_10615547 3300009553 Bacteria 1141
169 Ga0105249_11108211 3300009553 Bacteria 862
170 Ga0105249_12019079 3300009553 Bacteria 649
171 Ga0105239_10102797 3300010375 Bacteria 3162
172 Ga0105239_10382989 3300010375 Bacteria 1590
173 Ga0105239_11080629 3300010375 Bacteria 923
174 Ga0105246_10151781 3300011119 Bacteria 1754
175 Ga0105246_10696559 3300011119 Bacteria 890
176 Ga0157374_10128946 3300013296 Bacteria 2446
177 Ga0157378_10011509 3300013297 Bacteria 7745
178 Ga0157378_10245590 3300013297 Bacteria 1712
179 Ga0157378_10711463 3300013297 Bacteria 1024
180 Ga0163162_10157494 3300013306 Bacteria 2392
181 Ga0163162_10317375 3300013306 Bacteria 1691
182 Ga0163162_12854794 3300013306 Bacteria 556
183 Ga0157372_13059616 3300013307 Bacteria 534
184 Ga0157375_10470367 3300013308 Bacteria 1422
185 Ga0157375_10715568 3300013308 Bacteria 1154
186 Ga0163163_10006685 3300014325 Bacteria 10104
187 Ga0163163_11506803 3300014325 Bacteria 734
188 Ga0157380_10202487 3300014326 Bacteria 1762
189 Ga0157380_11565120 3300014326 Bacteria 714
190 Ga0157377_10055398 3300014745 Bacteria 2248
191 Ga0157377_11405692 3300014745 Bacteria 550
192 Ga0157379_10032557 3300014968 Bacteria 4648
193 Ga0157379_10321333 3300014968 Bacteria 1413
194 Ga0157379_10378122 3300014968 Bacteria 1299
195 Ga0163161_11503248 3300017792 Bacteria 591
196 Ga0207697_10221929 3300025315 Bacteria 834
197 Ga0207656_10061214 3300025321 Bacteria 1652
198 Ga0207653_10000045 3300025885 Bacteria 94691
199 Ga0207653_10001367 3300025885 Bacteria 7953
200 Ga0207642_10219840 3300025899 Bacteria 1061
201 Ga0207688_10093502 3300025901 Bacteria 1729
202 Ga0207688_10176191 3300025901 Bacteria 1273
203 Ga0207688_10920619 3300025901 Bacteria 553
204 Ga0207680_10114063 3300025903 Bacteria 1758
205 Ga0207647_10006436 3300025904 Bacteria 8538
206 Ga0207685_10020610 3300025905 Bacteria 2195
207 Ga0207645_10044165 3300025907 Bacteria 2852
208 Ga0207643_10000180 3300025908 Bacteria 43133
209 Ga0207705_11142073 3300025909 Bacteria 599
210 Ga0207684_10017792 3300025910 Bacteria 6096
211 Ga0207684_10264781 3300025910 Bacteria 1483
212 Ga0207684_10363109 3300025910 Bacteria 1246
213 Ga0207693_10009145 3300025915 Bacteria 8089
214 Ga0207663_10926401 3300025916 Bacteria 697
215 Ga0207660_10293791 3300025917 Bacteria 1293
216 Ga0207649_10038650 3300025920 Bacteria 2890
217 Ga0207646_10007412 3300025922 Bacteria 11152
218 Ga0207646_10589716 3300025922 Bacteria 998
219 Ga0207681_10091659 3300025923 Bacteria 2172
220 Ga0207694_10083865 3300025924 Bacteria 2506
221 Ga0207650_10020563 3300025925 Bacteria 4656
222 Ga0207659_10222511 3300025926 Bacteria 1518
223 Ga0207659_10330365 3300025926 Bacteria 1260
224 Ga0207687_10064320 3300025927 Bacteria 2601
225 Ga0207664_10365484 3300025929 Bacteria 1279
226 Ga0207690_10911867 3300025932 Bacteria 729
227 Ga0207706_10570871 3300025933 Bacteria 973
228 Ga0207706_10681480 3300025933 Bacteria 879
229 Ga0207686_10034275 3300025934 Bacteria 3038
230 Ga0207686_10077774 3300025934 Bacteria 2155
231 Ga0207686_10360132 3300025934 Bacteria 1098
232 Ga0207709_10041719 3300025935 Bacteria 2756
233 Ga0207709_10182917 3300025935 Bacteria 1482
234 Ga0207709_10197896 3300025935 Bacteria 1433
235 Ga0207670_10218160 3300025936 Bacteria 1459
236 Ga0207670_10224381 3300025936 Bacteria 1440
237 Ga0207670_10927373 3300025936 Bacteria 730
238 Ga0207669_10134146 3300025937 Bacteria 1707
239 Ga0207669_10181517 3300025937 Bacteria 1509
240 Ga0207669_10265581 3300025937 Bacteria 1286
241 Ga0207704_11240882 3300025938 Bacteria 636
242 Ga0207665_11087670 3300025939 Bacteria 637
243 Ga0207711_10121179 3300025941 Bacteria 2335
244 Ga0207689_10042243 3300025942 Bacteria 3772
245 Ga0207689_11674171 3300025942 Bacteria 528
246 Ga0207661_10026228 3300025944 Bacteria 4438
247 Ga0207661_11256336 3300025944 Bacteria 681
248 Ga0207679_10003258 3300025945 Bacteria 10029
249 Ga0207679_10326778 3300025945 Bacteria 1330
250 Ga0207679_10484836 3300025945 Bacteria 1101
251 Ga0207712_10541394 3300025961 Bacteria 1000
252 Ga0207712_11735223 3300025961 Bacteria 560
253 Ga0207668_10354402 3300025972 Bacteria 1228
254 Ga0207668_10625722 3300025972 Bacteria 940
255 Ga0207640_10060121 3300025981 Bacteria 2510
256 Ga0207677_10006919 3300026023 Bacteria 6235
257 Ga0207703_10213161 3300026035 Bacteria 1723
258 Ga0207703_10535453 3300026035 Bacteria 1103
259 Ga0207639_10490914 3300026041 Bacteria 1120
260 Ga0207678_10008107 3300026067 Bacteria 9264
261 Ga0207678_10108665 3300026067 Bacteria 2366
262 Ga0207678_10310901 3300026067 Bacteria 1355
263 Ga0207708_10003283 3300026075 Bacteria 11908
264 Ga0207708_10104624 3300026075 Bacteria 2193
265 Ga0207708_10271838 3300026075 Bacteria 1371
266 Ga0207708_11074441 3300026075 Bacteria 701
267 Ga0207641_10038248 3300026088 Bacteria 4010
268 Ga0207648_10010808 3300026089 Bacteria 8625
269 Ga0207648_11301472 3300026089 Bacteria 683
270 Ga0207676_10000647 3300026095 Bacteria 27890
271 Ga0207676_10154279 3300026095 Bacteria 1981
272 Ga0207674_10019413 3300026116 Bacteria 7361
273 Ga0207674_10631358 3300026116 Bacteria 1034
274 Ga0207675_100061154 3300026118 Bacteria 3516
275 Ga0207675_101593803 3300026118 Bacteria 673
276 Ga0207683_10015626 3300026121 Bacteria 6461
277 Ga0207698_11134124 3300026142 Bacteria 795
278 Ga0209966_1022750 3300027695 Bacteria 1228
279 Ga0207428_10000755 3300027907 Bacteria 36919
280 Ga0207428_10117560 3300027907 Bacteria 2041
281 Ga0268265_10321612 3300028380 Bacteria 1401
282 Ga0268265_10938527 3300028380 Bacteria 852
283 Ga0268264_10101026 3300028381 Bacteria 2506
284 Ga0268264_10226672 3300028381 Bacteria 1723
285 Ga0268264_10602519 3300028381 Bacteria 1083
286 Ga0265334_10069544 3300028573 Bacteria 1314
287 Ga0265318_10061375 3300028577 Bacteria 1400
288 Ga0265322_10042246 3300028654 Bacteria 1298
289 Ga0265338_10017348 3300028800 Bacteria 7767
290 Ga0265330_10004083 3300031235 Bacteria 7490
291 Ga0265332_10028425 3300031238 Bacteria 2448
292 Ga0265320_10188908 3300031240 Bacteria 922
293 Ga0265329_10008504 3300031242 Bacteria 3887
294 Ga0265340_10328817 3300031247 Bacteria 676
295 Ga0265339_10500454 3300031249 Bacteria 561
296 Ga0265316_10001158 3300031344 Bacteria 28528
297 Ga0265316_10016442 3300031344 Bacteria 6416
298 Ga0265316_10100532 3300031344 Bacteria 2198
299 Ga0265314_10205880 3300031711 Bacteria 1159
300 Ga0265342_10004598 3300031712 Bacteria 10767
301 Ga0316576_10334238 3300031727 Bacteria 1129
302 Ga0316576_10623466 3300031727 Unclassified 786
303 Ga0316576_10815439 3300031727 Bacteria 671
304 Ga0316577_10499249 3300031733 Unclassified 692
305 Ga0307406_10347349 3300031901 Bacteria 1158
306 Ga0307416_101399308 3300032002 Bacteria 805
307 Ga0307415_100102589 3300032126 Bacteria 2102
308 Ga0307415_101029048 3300032126 Bacteria 767
309 Ga0316593_10225617 3300032168 Bacteria 697
310 Ga0316593_10296930 3300032168 Bacteria 611
311 Ga0316593_10432409 3300032168 Bacteria 512
312 Ga0316592_1122044 3300033524 Bacteria 605
313 Ga0316592_1125501 3300033524 Bacteria 597
314 Ga0316588_1005298 3300033528 Unclassified 2500
315 Ga0316588_1029297 3300033528 Bacteria 1287
316 Ga0316588_1111437 3300033528 Bacteria 689
317 Ga0316596_1021216 3300033541 Unclassified 1655
318 Ga0316596_1031012 3300033541 Bacteria 1387
319 Ga0316596_1096762 3300033541 Unclassified 797
320 Ga0373930_0165542 3300034816 Bacteria 561
321 Ga0373959_0073356 3300034820 Bacteria 777
322 Ga0373926_0002170 3300035083 Bacteria 6180
323 Ga0373929_0103781 3300035085 Bacteria 719
324 Ga0373940_0045577 3300035088 Bacteria 1217
325 Ga0373944_0001156 3300035089 Bacteria 6571
326 Ga0373949_0226166 3300035090 Bacteria 570
327 Ga0373932_0125928 3300035112 Bacteria 859
328 Ga0373932_0157523 3300035112 Bacteria 784
329 Ga0373936_0009500 3300035113 Bacteria 3666
330 Ga0373939_0003745 3300035114 Bacteria 3583
331 Ga0373941_0010912 3300035115 Bacteria 2336
332 Ga0373945_0004843 3300035116 Bacteria 4287
333 Ga0373943_0011049 3300035170 Bacteria 4055
334 Ga0373946_0002234 3300035171 Bacteria 6833
335 Ga0373955_0244914 3300035172 Bacteria 1074
336 Ga0373961_0008156 3300035241 Bacteria 2545
337 Ga0373962_0050244 3300035242 Bacteria 1200
338 Ga0373931_0024055 3300035691 Bacteria 3081
339 Ga0373935_0022388 3300035692 Bacteria 3874
340 Ga0373935_1017296 3300035692 Bacteria 616
341 Ga0373947_0002057 3300035725 Bacteria 12270
342 Ga0373937_0737959 3300036401 Bacteria 932
343 Ga0316582_0146012 3300036647 Bacteria 1597
344 Ga0316582_0290900 3300036647 Bacteria 1122
345 Ga0373925_0021904 3300037068 Bacteria 4658
346 Ga0395899_0038438 3300037312 Bacteria 3584
347 Ga0395899_0100621 3300037312 Bacteria 2087
348 Ga0395899_0209587 3300037312 Bacteria 1355
349 Ga0395899_0936363 3300037312 Bacteria 526
350 Ga0395900_0079780 3300037418 Bacteria 3363
351 Ga0395900_0261463 3300037418 Bacteria 1728
352 Ga0395900_0308758 3300037418 Bacteria 1565
353 Ga0395900_0481558 3300037418 Bacteria 1193
354 Ga0395900_0554082 3300037418 Bacteria 1094
355 Ga0395900_1166255 3300037418 Bacteria 686
356 Ga0395898_0029878 3300037466 Bacteria 5455
357 Ga0395898_0316427 3300037466 Bacteria 1489
358 Ga0395905_0087327 3300037471 Bacteria 2924
359 Ga0395905_0198084 3300037471 Bacteria 1883
360 Ga0395905_0243175 3300037471 Bacteria 1681
361 Ga0395905_0372514 3300037471 Bacteria 1321
362 Ga0395905_1028425 3300037471 Bacteria 727
363 Ga0436364_0675508 3300037853 Bacteria 1246
364 Ga0395901_0017158 3300038443 Bacteria 7384
365 Ga0395901_0067928 3300038443 Bacteria 3713
366 Ga0395901_0126345 3300038443 Bacteria 2687
367 Ga0395901_0150282 3300038443 Bacteria 2448
368 Ga0395901_0444755 3300038443 Bacteria 1326
369 Ga0395901_0492767 3300038443 Bacteria 1248
370 Ga0395901_0720320 3300038443 Bacteria 993
371 Ga0395901_1101342 3300038443 Bacteria 765
372 Ga0436363_1649457 3300039450 Bacteria 792
373 Ga0439438_062757 3300041405 Bacteria 929
374 Ga0451790_27342 3300041444 Bacteria 523
375 Ga0439448_0090742 3300042005 Bacteria 1032
376 Ga0439454_033771 3300042011 Bacteria 813
377 Ga0439455_0018566 3300042012 Bacteria 1632
378 Ga0439456_153247 3300042013 Bacteria 538
379 Ga0439463_084711 3300042016 Bacteria 816
380 Ga0450910_002285 3300042147 Bacteria 2509
381 Ga0439458_0079925 3300042157 Bacteria 833
382 Ga0439464_0036848 3300042439 Bacteria 1385
383 Ga0439460_0032270 3300042461 Bacteria 1499
384 Ga0451577_0599457 3300042876 Bacteria 1000
385 Ga0439440_0246160 3300042993 Bacteria 543
386 Ga0466968_0423899 3300044735 Bacteria 655
387 Ga0451576_0489698 3300045051 Bacteria 1292
388 Ga0451576_2154023 3300045051 Bacteria 573
389 Ga0495592_0090371 3300046454 Bacteria 2197
390 Ga0495603_0020616 3300046455 Bacteria 3994
391 Ga0495603_0174579 3300046455 Bacteria 1244
392 Ga0495603_0181383 3300046455 Bacteria 1218
393 Ga0495590_0252390 3300046457 Bacteria 657
394 Ga0495591_040928 3300046458 Bacteria 1318
395 Ga0495629_0049329 3300046459 Bacteria 2950
396 Ga0495629_0395232 3300046459 Bacteria 940
397 Ga0495638_0365475 3300046460 Bacteria 758
398 Ga0495641_0001712 3300046461 Bacteria 18335
399 Ga0495641_0457639 3300046461 Bacteria 581
400 Ga0495651_0093971 3300046462 Bacteria 2245
401 Ga0495650_0168514 3300046471 Bacteria 777
402 Ga0495580_0064765 3300046472 Bacteria 2561
403 Ga0495580_0125895 3300046472 Bacteria 1778
404 Ga0495580_0326376 3300046472 Bacteria 1043
405 Ga0495582_0064566 3300046473 Bacteria 2021
406 Ga0495582_0479629 3300046473 Bacteria 719
407 Ga0495639_0001433 3300046475 Bacteria 10663
408 Ga0495662_0004361 3300046476 Bacteria 7102
409 Ga0495664_0797640 3300046477 Bacteria 555
410 Ga0495584_0058716 3300046491 Bacteria 1935
411 Ga0495584_0101981 3300046491 Bacteria 1451
412 Ga0495584_0135954 3300046491 Bacteria 1248
413 Ga0495584_0388758 3300046491 Bacteria 709
414 Ga0495585_0019868 3300046492 Bacteria 3867
415 Ga0495585_0071459 3300046492 Bacteria 1892
416 Ga0495585_0214669 3300046492 Bacteria 973
417 Ga0495594_0170210 3300046499 Bacteria 1239
418 Ga0495607_0159239 3300046501 Bacteria 1148
419 Ga0495607_0257451 3300046501 Bacteria 837
420 Ga0495583_0067489 3300046506 Bacteria 1580
421 Ga0495616_0315221 3300046513 Bacteria 658
422 Ga0495616_0443079 3300046513 Bacteria 527
423 Ga0495628_0098294 3300046516 Bacteria 2261
424 Ga0495630_0012230 3300046517 Bacteria 6224
425 Ga0495630_0272816 3300046517 Bacteria 1292
426 Ga0495630_1481568 3300046517 Bacteria 509
427 Ga0495631_0221466 3300046518 Bacteria 808
428 Ga0495631_0404697 3300046518 Bacteria 581
429 Ga0495637_0059712 3300046520 Bacteria 1568
430 Ga0495644_0014236 3300046523 Bacteria 3047
431 Ga0495663_0029820 3300046525 Bacteria 1613
432 Ga0495663_0238339 3300046525 Bacteria 643
433 Ga0495663_0332280 3300046525 Bacteria 551
434 Ga0495666_0003428 3300046526 Bacteria 7997
435 Ga0495642_0038020 3300046528 Bacteria 1949
436 Ga0495642_0204609 3300046528 Bacteria 861
437 Ga0495652_0637233 3300046529 Bacteria 723
438 Ga0495665_0005734 3300046531 Bacteria 6702
439 Ga0495665_0112155 3300046531 Bacteria 1430
440 Ga0495640_0015599 3300046533 Bacteria 5710
441 Ga0495640_0187405 3300046533 Bacteria 1316
442 Ga0495586_0015388 3300046535 Bacteria 4070
443 Ga0495586_0043241 3300046535 Bacteria 2427
444 Ga0495586_0113642 3300046535 Bacteria 1508
445 Ga0495598_0045424 3300046537 Bacteria 1301
446 Ga0495609_0102347 3300046538 Bacteria 1240
447 Ga0495609_0119522 3300046538 Bacteria 1134
448 Ga0495609_0339331 3300046538 Bacteria 607
449 Ga0495621_0015914 3300046539 Bacteria 2406
450 Ga0495633_0045747 3300046558 Bacteria 2071
451 Ga0495633_0335476 3300046558 Bacteria 685
452 Ga0495667_0390780 3300046559 Bacteria 877
453 Ga0495656_0030482 3300046615 Bacteria 2180
454 Ga0495656_0121523 3300046615 Bacteria 1233
455 Ga0495656_0557811 3300046615 Bacteria 611
456 Ga0495668_0120711 3300046616 Bacteria 1434
457 Ga0495634_0016753 3300046642 Bacteria 5236
458 Ga0495635_0060316 3300046663 Bacteria 2607
459 Ga0495659_0011787 3300046664 Bacteria 2819
460 Ga0495659_0224156 3300046664 Bacteria 777
461 Ga0495659_0253677 3300046664 Bacteria 734
462 Ga0495659_0277042 3300046664 Bacteria 704
463 Ga0495659_0421946 3300046664 Bacteria 578
464 Ga0495588_0002482 3300046674 Bacteria 7904
465 Ga0495588_0025412 3300046674 Bacteria 2950
466 Ga0495588_0201208 3300046674 Bacteria 1052
467 Ga0495599_0533662 3300046678 Bacteria 688
468 Ga0495647_0000723 3300046681 Bacteria 9761
469 Ga0495647_0247225 3300046681 Bacteria 793
470 Ga0495647_0286081 3300046681 Bacteria 740
471 Ga0495658_0008640 3300046683 Bacteria 5054
472 Ga0495658_0312022 3300046683 Bacteria 996
473 Ga0495669_0014426 3300046684 Bacteria 3377
474 Ga0495613_0017874 3300046689 Bacteria 5286
475 Ga0495613_0166010 3300046689 Bacteria 1568
476 Ga0495613_0544368 3300046689 Bacteria 777
477 Ga0495624_0006221 3300046690 Bacteria 8485
478 Ga0495670_0052710 3300046691 Bacteria 2037
479 Ga0495670_0269067 3300046691 Bacteria 910
480 Ga0495589_0136405 3300046794 Bacteria 1176
481 Ga0495660_0154151 3300046810 Bacteria 1132
482 Ga0495581_0036306 3300047315 Bacteria 2851
483 Ga0495581_0118923 3300047315 Bacteria 1537
484 Ga0495636_0167615 3300047318 Bacteria 992
485 Ga0495636_0349075 3300047318 Bacteria 698
486 Ga0495674_0021479 3300047319 Bacteria 5970
487 Ga0495676_0077090 3300047321 Bacteria 2542
488 Ga0495676_0184148 3300047321 Bacteria 1461
489 Ga0495680_0008963 3300047322 Bacteria 9041
490 Ga0495677_0133656 3300047445 Bacteria 950
491 Ga0495679_026340 3300047446 Bacteria 1932
492 Ga0495685_167972 3300047447 Bacteria 709
493 Ga0495681_0178530 3300047470 Bacteria 874
494 Ga0495684_0043770 3300047471 Bacteria 3428
495 Ga0495684_0302326 3300047471 Bacteria 1149
496 Ga0495593_0001673 3300047673 Bacteria 13132
497 Ga0495614_0092482 3300048089 Bacteria 1316
498 Ga0495615_0046944 3300048090 Bacteria 1099
499 Ga0495615_0162541 3300048090 Bacteria 671
500 Ga0496100_0041895 3300048903 Bacteria 2921
501 Ga0496100_1107559 3300048903 Bacteria 624
502 Ga0496101_0025291 3300048904 Bacteria 4117
503 Ga0496101_0432977 3300048904 Bacteria 1037
504 Ga0496101_0684545 3300048904 Bacteria 810
505 Ga0496101_1243945 3300048904 Bacteria 583
506 Ga0496102_0018527 3300048905 Bacteria 6119
507 Ga0496102_0480328 3300048905 Bacteria 1164
508 Ga0496103_0102296 3300048906 Bacteria 1814
509 Ga0496103_1034478 3300048906 Bacteria 510
510 Ga0496104_0205874 3300048907 Bacteria 1879
511 Ga0496104_0373616 3300048907 Bacteria 1338
512 Ga0496104_0535460 3300048907 Bacteria 1082
513 Ga0496105_0127286 3300048908 Bacteria 2100
514 Ga0496105_0187178 3300048908 Bacteria 1694
515 Ga0496105_0520445 3300048908 Bacteria 932
516 Ga0496106_0008125 3300048909 Bacteria 7749
517 Ga0496106_0226406 3300048909 Bacteria 1492
518 Ga0496107_0006741 3300048910 Bacteria 7904
519 Ga0496107_0043569 3300048910 Bacteria 3224
520 Ga0496108_0016189 3300048911 Bacteria 6081
521 Ga0496108_0023793 3300048911 Bacteria 5040
522 Ga0496108_0034603 3300048911 Bacteria 4198
523 Ga0496108_0923093 3300048911 Bacteria 748
524 Ga0496108_1784909 3300048911 Bacteria 504
525 Ga0496109_0002583 3300048912 Bacteria 15165
526 Ga0496109_0026262 3300048912 Bacteria 5193
527 Ga0496109_0069700 3300048912 Bacteria 3225
528 Ga0496109_0238479 3300048912 Bacteria 1711
529 Ga0496109_0634249 3300048912 Bacteria 1005
530 Ga0496110_0027911 3300048913 Bacteria 4842
531 Ga0496110_0112012 3300048913 Bacteria 2453
532 Ga0496110_0158635 3300048913 Bacteria 2050
533 Ga0496110_0691669 3300048913 Bacteria 921
534 Ga0496111_0032586 3300048914 Bacteria 3715
535 Ga0496111_0118733 3300048914 Bacteria 1952
536 Ga0496111_0136537 3300048914 Bacteria 1817
537 Ga0496112_0049244 3300048915 Bacteria 4130
538 Ga0496113_0010377 3300048916 Bacteria 6157
539 Ga0496113_0077648 3300048916 Bacteria 2539
540 Ga0496114_0012594 3300048917 Bacteria 6775
541 Ga0496114_0220275 3300048917 Bacteria 1666
542 Ga0496114_0462035 3300048917 Bacteria 1124
543 Ga0496115_0298175 3300048918 Bacteria 1321
544 Ga0501031_0005712 3300049568 Bacteria 8108
545 Ga0501031_0013361 3300049568 Bacteria 5358
546 Ga0501031_0033210 3300049568 Bacteria 3365
547 Ga0501031_0169764 3300049568 Bacteria 1425
548 Ga0501032_0052636 3300049569 Bacteria 2743
549 Ga0501032_0211659 3300049569 Bacteria 1263
550 Ga0501033_0007148 3300049570 Bacteria 8710
551 Ga0501033_0181337 3300049570 Bacteria 1509
552 Ga0501033_0232695 3300049570 Bacteria 1309
553 Ga0501033_0580566 3300049570 Bacteria 770
554 Ga0501034_0032649 3300049571 Bacteria 5286
555 Ga0501036_0036951 3300049572 Bacteria 4131
556 Ga0501036_0056450 3300049572 Bacteria 3327
557 Ga0501036_0116226 3300049572 Bacteria 2259
558 Ga0501036_0274233 3300049572 Bacteria 1412
559 Ga0501036_0334209 3300049572 Bacteria 1265
560 Ga0501036_1301202 3300049572 Bacteria 591
561 Ga0501037_0012014 3300049573 Bacteria 6379
562 Ga0501038_0010226 3300049574 Bacteria 8584
563 Ga0501038_0151602 3300049574 Bacteria 1889
564 Ga0501039_0006358 3300049575 Bacteria 8974
565 Ga0501039_0107202 3300049575 Bacteria 2182
566 Ga0501039_0172087 3300049575 Bacteria 1702
567 Ga0501039_0409660 3300049575 Bacteria 1065
568 Ga0501040_0037369 3300049576 Bacteria 3298
569 Ga0501040_0071157 3300049576 Bacteria 2401
570 Ga0501040_0079449 3300049576 Bacteria 2271
571 Ga0501040_0139756 3300049576 Bacteria 1705
572 Ga0501040_0508192 3300049576 Bacteria 869
573 Ga0501040_0572784 3300049576 Bacteria 815
574 Ga0501040_0761387 3300049576 Bacteria 700
575 Ga0501040_0942189 3300049576 Bacteria 626
576 Ga0501040_1367575 3300049576 Bacteria 514
577 Ga0501041_0013948 3300049577 Bacteria 4766
578 Ga0501041_0016181 3300049577 Bacteria 4431
579 Ga0501041_0205939 3300049577 Bacteria 1233
580 Ga0501041_0238350 3300049577 Bacteria 1143
581 Ga0501041_0285697 3300049577 Bacteria 1038
582 Ga0501042_0036758 3300049578 Bacteria 3475
583 Ga0501042_0091742 3300049578 Bacteria 2180
584 Ga0501042_0110079 3300049578 Bacteria 1983
585 Ga0501042_0127279 3300049578 Bacteria 1834
586 Ga0501042_0838151 3300049578 Bacteria 669
587 Ga0501043_0016572 3300049579 Bacteria 5775
588 Ga0501046_0042354 3300049580 Bacteria 3631
589 Ga0501046_0083408 3300049580 Bacteria 2467
590 Ga0501046_0321938 3300049580 Bacteria 1126
591 Ga0501047_0078177 3300049581 Bacteria 3182
592 Ga0501047_0465461 3300049581 Bacteria 1093
593 Ga0501048_0007798 3300049582 Bacteria 8118
594 Ga0501048_0123058 3300049582 Bacteria 1833
595 Ga0501048_0164743 3300049582 Bacteria 1569
596 Ga0501067_0046999 3300049583 Bacteria 2395
597 Ga0501067_0263345 3300049583 Bacteria 960
598 Ga0501067_0318905 3300049583 Bacteria 866
599 Ga0501068_0010128 3300049584 Bacteria 5289
600 Ga0501068_0046859 3300049584 Bacteria 2606
601 Ga0501068_0071793 3300049584 Bacteria 2113
602 Ga0501068_0223720 3300049584 Bacteria 1196
603 Ga0501068_0736238 3300049584 Bacteria 645
604 Ga0501069_0001092 3300049585 Bacteria 13073
605 Ga0501069_0118008 3300049585 Bacteria 1514
606 Ga0501069_0187689 3300049585 Bacteria 1196
607 Ga0501069_0478697 3300049585 Bacteria 741
608 Ga0501069_0496267 3300049585 Bacteria 728
609 Ga0501070_0098568 3300049586 Bacteria 2417
610 Ga0501070_0517290 3300049586 Bacteria 958
611 Ga0501070_0797106 3300049586 Bacteria 742
612 Ga0501071_0085739 3300049587 Bacteria 2309
613 Ga0501071_0091361 3300049587 Bacteria 2236
614 Ga0501071_0278604 3300049587 Bacteria 1265
615 Ga0501072_0018661 3300049588 Bacteria 5347
616 Ga0501072_0061889 3300049588 Bacteria 2952
617 Ga0501072_0637277 3300049588 Bacteria 839
618 Ga0501072_0817234 3300049588 Bacteria 729
619 Ga0501072_1041229 3300049588 Bacteria 637
620 Ga0501072_1064107 3300049588 Bacteria 630
621 Ga0501073_0005258 3300049589 Bacteria 9706
622 Ga0501073_0012868 3300049589 Bacteria 6099
623 Ga0501073_0248604 3300049589 Bacteria 1228
624 Ga0501074_0006881 3300049590 Bacteria 8212
625 Ga0501074_0185736 3300049590 Bacteria 1482
626 Ga0501074_0643167 3300049590 Bacteria 749
627 Ga0501074_0898064 3300049590 Bacteria 624
628 Ga0501075_0002249 3300049591 Bacteria 12793
629 Ga0501075_0104539 3300049591 Bacteria 2152
630 Ga0501075_0168367 3300049591 Bacteria 1671
631 Ga0501075_0210983 3300049591 Bacteria 1481
632 Ga0501075_0295986 3300049591 Bacteria 1233
633 Ga0501075_0429324 3300049591 Bacteria 1007
634 Ga0501075_0560213 3300049591 Bacteria 872
635 Ga0501075_0574351 3300049591 Bacteria 860
636 Ga0501076_0033915 3300049592 Bacteria 3987
637 Ga0501076_0039075 3300049592 Bacteria 3725
638 Ga0501076_0494947 3300049592 Bacteria 1007
639 Ga0501076_1369347 3300049592 Bacteria 581
640 Ga0501077_0004105 3300049593 Bacteria 8788
641 Ga0501077_0040119 3300049593 Bacteria 2983
642 Ga0501077_0236699 3300049593 Bacteria 1160
643 Ga0501077_0356113 3300049593 Bacteria 934
644 Ga0501077_0425913 3300049593 Bacteria 849
645 Ga0501079_0037240 3300049741 Bacteria 3748
646 Ga0501079_0093053 3300049741 Bacteria 2336
647 Ga0501079_0125001 3300049741 Bacteria 2001
648 Ga0501079_0250111 3300049741 Bacteria 1385
649 Ga0501079_0412504 3300049741 Bacteria 1059
650 Ga0501080_0042292 3300049742 Bacteria 4243
651 Ga0501080_0110562 3300049742 Bacteria 2547
652 Ga0501080_0341288 3300049742 Bacteria 1353
653 Ga0501080_0557516 3300049742 Bacteria 1020
654 Ga0501080_1654774 3300049742 Bacteria 541
655 Ga0501081_0012692 3300049743 Bacteria 5540
656 Ga0501081_0040976 3300049743 Bacteria 3170
657 Ga0501081_0125615 3300049743 Bacteria 1829
658 Ga0501081_0258729 3300049743 Bacteria 1271
659 Ga0501081_0506119 3300049743 Bacteria 900
660 Ga0501083_0007193 3300049744 Bacteria 7903
661 Ga0501083_0286778 3300049744 Bacteria 1071
662 Ga0501083_0475275 3300049744 Bacteria 813
663 Ga0501035_0105838 3300049822 Bacteria 2466
664 Ga0501035_0214143 3300049822 Bacteria 1647
665 Ga0501035_0314778 3300049822 Bacteria 1316
666 Ga0501044_0027418 3300049823 Bacteria 6020
667 Ga0501045_0044008 3300049824 Bacteria 3251
668 Ga0501045_0181394 3300049824 Bacteria 1568
669 Ga0501045_0410453 3300049824 Bacteria 1007
670 Ga0501045_1033601 3300049824 Bacteria 602
671 Ga0501045_1166359 3300049824 Bacteria 562
672 nmdc:mga05p37_10502_c1 3300050507 Bacteria 10983
673 nmdc:mga05p37_12934_c1 3300050507 Bacteria 9983
674 nmdc:mga05p37_142740_c1 3300050507 Bacteria 2933
675 nmdc:mga05p37_14947_c1 3300050507 Bacteria 9318
676 nmdc:mga05p37_1899666_c1 3300050507 Unclassified 569
677 nmdc:mga05p37_19236_c1 3300050507 Bacteria 8261
678 nmdc:mga05p37_456406_c1 3300050507 Bacteria 1478
679 nmdc:mga05p37_82027_c1 3300050507 Bacteria 3973
680 nmdc:mga05p37_902888_c1 3300050507 Bacteria 952
681 nmdc:mga09592_170191_c1 3300050508 Bacteria 1884
682 nmdc:mga09592_30411_c1 3300050508 Bacteria 4493
683 nmdc:mga0qj67_177733_c1 3300050509 Bacteria 1729
684 nmdc:mga0qj67_28824_c1 3300050509 Bacteria 4311
685 nmdc:mga06r32_1363378_c1 3300050510 Bacteria 652
686 nmdc:mga06r32_1398354_c1 3300050510 Bacteria 642
687 nmdc:mga06r32_344948_c1 3300050510 Bacteria 1474
688 nmdc:mga06r32_7418_c1 3300050510 Bacteria 9864
689 nmdc:mga08y16_143659_c1 3300050511 Bacteria 2481
690 nmdc:mga08y16_252419_c1 3300050511 Bacteria 1823
691 nmdc:mga0n895_48726_c1 3300050512 Bacteria 4149
692 nmdc:mga0n895_814134_c1 3300050512 Bacteria 924
693 nmdc:mga0rr50_566004_c1 3300050513 Bacteria 968
694 nmdc:mga0a205_1371788_c1 3300050515 Bacteria 555
695 nmdc:mga0a205_3780_c1 3300050515 Bacteria 13551
696 Ga0495601_0009906 3300053077 Bacteria 5645
697 Ga0495655_0022559 3300053083 Bacteria 1440
698 Ga0495619_0030323 3300053085 Bacteria 3500
699 Ga0495619_0180039 3300053085 Bacteria 1462
700 Ga0501084_0044744 3300054114 Bacteria 3706
701 Ga0501084_0110155 3300054114 Bacteria 2313
702 Ga0501084_0126394 3300054114 Bacteria 2151
703 Ga0501084_0152220 3300054114 Bacteria 1950
704 Ga0501084_0330227 3300054114 Bacteria 1288
705 Ga0501084_0785266 3300054114 Bacteria 802
706 Ga0590074_020206 3300059423 Bacteria 1145
707 Ga0590075_007808 3300059424 Bacteria 2548
708 Ga0590075_099261 3300059424 Bacteria 758
709 Ga0587122_020029 3300059628 Bacteria 720
710 Ga0587068_040802 3300059641 Bacteria 839
711 Ga0587079_193078 3300059647 Bacteria 552
712 Ga0587114_130813 3300059655 Bacteria 517
713 Ga0587071_070658 3300060344 Bacteria 760
714 Ga0587111_0251432 3300060346 Bacteria 523
715 Ga0501082_0015305 3300060353 Bacteria 6604
716 Ga0501082_0030614 3300060353 Bacteria 4637
717 Ga0501082_0081214 3300060353 Bacteria 2797
718 Ga0501082_0113711 3300060353 Bacteria 2344
719 Ga0501082_0364110 3300060353 Bacteria 1261
720 Ga0501082_0386316 3300060353 Bacteria 1221
721 Ga0501082_0428740 3300060353 Bacteria 1155
722 Ga0501082_0462952 3300060353 Bacteria 1108
723 Ga0501082_0840005 3300060353 Bacteria 803
724 Ga0501082_1854582 3300060353 Bacteria 526
725 Ga0530510_0010134 3300061734 Bacteria 6605
726 Ga0530510_0027152 3300061734 Bacteria 4101
727 Ga0530510_0334883 3300061734 Bacteria 1135
728 Ga0530510_0744721 3300061734 Bacteria 747
729 Ga0530510_1337646 3300061734 Bacteria 549
730 2837185944 2837183177 Bacteria 4637169
731 Ga0316592_1059147
732 JGI24752J21851_1004064
733 JGI24746J21847_1020002
734 JGI24745J21846_1001877
735 JGI24745J21846_1030132
736 JGI24033J26618_1000974
737 Ga0007409J51694_1082230
738 JGI25405J52794_10069282
739 Ga0058859_11628607
740 Ga0058860_12074324
741 Ga0065707_10839861
742 Ga0070676_10570373
743 Ga0070683_100102034
744 Ga0070690_100048896
745 Ga0070690_100484133
746 Ga0070670_100062379
747 Ga0068869_100098511
748 Ga0070666_10190417
749 Ga0070666_10840992
750 Ga0068868_100151741
751 Ga0068868_100405701
752 Ga0070660_100123948
753 Ga0070660_100261615
754 Ga0070689_101313590
755 Ga0070691_10023408
756 Ga0070661_100031306
757 Ga0070668_100151349
758 Ga0070668_100706260
759 Ga0070669_100456507
760 Ga0070669_100895243
761 Ga0070675_100041662
762 Ga0070674_100064122
763 Ga0070673_100439083
764 Ga0070659_100345404
765 Ga0070659_100689674
766 Ga0070667_101332726
767 Ga0070703_10003156
768 Ga0070703_10006895
769 Ga0070714_100476481
770 Ga0070701_10004277
771 Ga0070711_100048282
772 Ga0070705_100490055
773 Ga0070700_100013216
774 Ga0070700_100655231
775 Ga0070694_100013287
776 Ga0070694_100100856
777 Ga0070708_100014721
778 Ga0070708_100273803
779 Ga0070708_100644798
780 Ga0070708_101316367
781 Ga0070663_100030843
782 Ga0070678_100055745
783 Ga0070662_100276485
784 Ga0070681_10302860
785 Ga0068867_100034170
786 Ga0068867_100065006
787 Ga0068867_100862957
788 Ga0068867_101348362
789 Ga0070685_10698105
790 Ga0070706_100229885
791 Ga0070706_100274655
792 Ga0070706_100988961
793 Ga0070707_100006906
794 Ga0070707_101203492
795 Ga0070698_100007643
796 Ga0070698_100041688
797 Ga0070698_100054167
798 Ga0070698_100107271
799 Ga0070698_100907534
800 Ga0070698_101219900
801 Ga0070699_100024703
802 Ga0070699_100277126
803 Ga0070699_100381527
804 Ga0070699_100788169
805 Ga0070684_100647548
806 Ga0068853_101173979
807 Ga0070686_100043668
808 Ga0070695_100831598
809 Ga0070696_100462117
810 Ga0070696_101845249
811 Ga0070704_100000609
812 Ga0070704_101094172
813 Ga0070664_100079930
814 Ga0070664_100178694
815 Ga0070664_100353064
816 Ga0068857_100116233
817 Ga0070702_100070055
818 Ga0070702_100566805
819 Ga0068852_100063116
820 Ga0068859_100522081
821 Ga0068864_100024465
822 Ga0068864_100128273
823 Ga0068861_100584776
824 Ga0068861_101204216
825 Ga0068861_102423028
826 Ga0068851_10296965
827 Ga0068870_10000274
828 Ga0068870_10740636
829 Ga0068863_100013521
830 Ga0068858_100230507
831 Ga0068862_100029731
832 Ga0081455_10014778
833 Ga0081455_10019312
834 Ga0081455_10112518
835 Ga0081455_10720701
836 Ga0081538_10103139
837 Ga0081538_10117869
838 Ga0081538_10144144
839 Ga0081538_10159089
840 Ga0081539_10011391
841 Ga0081539_10048241
842 Ga0081539_10170642
843 Ga0075432_10026676
844 Ga0075432_10348868
845 Ga0070715_10328701
846 Ga0070716_100214734
847 Ga0075427_10003698
848 Ga0097621_100214381
849 Ga0068871_100065299
850 Ga0075428_100040383
851 Ga0075428_100127885
852 Ga0075428_100696452
853 Ga0075428_100941590
854 Ga0075428_101030816
855 Ga0075428_101154883
856 Ga0075430_100000285
857 Ga0075430_100296003
858 Ga0075430_100457294
859 Ga0075431_100000899
860 Ga0075431_100355817
861 Ga0075431_100381039
862 Ga0075431_101555199
863 Ga0075433_10032690
864 Ga0075434_100262482
865 Ga0075429_100000228
866 Ga0075429_100608504
867 Ga0075429_100818455
868 Ga0068865_100022751
869 Ga0068865_100170866
870 Ga0097620_100522084
871 Ga0105251_10006495
872 Ga0105251_10150715
873 Ga0105250_10524618
874 Ga0111539_10369747
875 Ga0111539_11017403
876 Ga0111539_11158676
877 Ga0105245_10168452
878 Ga0105245_10698555
879 Ga0105245_10788394
880 Ga0114129_10013928
881 Ga0114129_10035716
882 Ga0114129_10039220
883 Ga0114129_10145834
884 Ga0114129_11378331
885 Ga0114129_13255886
886 Ga0105243_10010219
887 Ga0105243_10191487
888 Ga0105243_10969211
889 Ga0105242_10009980
890 Ga0105242_10014288
891 Ga0105242_10248573
892 Ga0105242_11448803
893 Ga0105242_12097326
894 Ga0105248_10652493
895 Ga0105248_11943541
896 Ga0105248_11953720
897 Ga0105238_10151244
898 Ga0105249_10615547
899 Ga0105249_11108211
900 Ga0105249_12019079
901 Ga0105239_10102797
902 Ga0105239_10382989
903 Ga0105239_11080629
904 Ga0105246_10151781
905 Ga0105246_10696559
906 Ga0157374_10128946
907 Ga0157378_10011509
908 Ga0157378_10245590
909 Ga0157378_10711463
910 Ga0163162_10157494
911 Ga0163162_10317375
912 Ga0163162_12854794
913 Ga0157372_13059616
914 Ga0157375_10470367
915 Ga0157375_10715568
916 Ga0163163_10006685
917 Ga0163163_11506803
918 Ga0157380_10202487
919 Ga0157380_11565120
920 Ga0157377_10055398
921 Ga0157377_11405692
922 Ga0157379_10032557
923 Ga0157379_10321333
924 Ga0157379_10378122
925 Ga0163161_11503248
926 Ga0207697_10221929
927 Ga0207656_10061214
928 Ga0207653_10000045
929 Ga0207653_10001367
930 Ga0207642_10219840
931 Ga0207688_10093502
932 Ga0207688_10176191
933 Ga0207688_10920619
934 Ga0207680_10114063
935 Ga0207647_10006436
936 Ga0207685_10020610
937 Ga0207645_10044165
938 Ga0207643_10000180
939 Ga0207705_11142073
940 Ga0207684_10017792
941 Ga0207684_10264781
942 Ga0207684_10363109
943 Ga0207693_10009145
944 Ga0207663_10926401
945 Ga0207660_10293791
946 Ga0207649_10038650
947 Ga0207646_10007412
948 Ga0207646_10589716
949 Ga0207681_10091659
950 Ga0207694_10083865
951 Ga0207650_10020563
952 Ga0207659_10222511
953 Ga0207659_10330365
954 Ga0207687_10064320
955 Ga0207664_10365484
956 Ga0207690_10911867
957 Ga0207706_10570871
958 Ga0207706_10681480
959 Ga0207686_10034275
960 Ga0207686_10077774
961 Ga0207686_10360132
962 Ga0207709_10041719
963 Ga0207709_10182917
964 Ga0207709_10197896
965 Ga0207670_10218160
966 Ga0207670_10224381
967 Ga0207670_10927373
968 Ga0207669_10134146
969 Ga0207669_10181517
970 Ga0207669_10265581
971 Ga0207704_11240882
972 Ga0207665_11087670
973 Ga0207711_10121179
974 Ga0207689_10042243
975 Ga0207689_11674171
976 Ga0207661_10026228
977 Ga0207661_11256336
978 Ga0207679_10003258
979 Ga0207679_10326778
980 Ga0207679_10484836
981 Ga0207712_10541394
982 Ga0207712_11735223
983 Ga0207668_10354402
984 Ga0207668_10625722
985 Ga0207640_10060121
986 Ga0207677_10006919
987 Ga0207703_10213161
988 Ga0207703_10535453
989 Ga0207639_10490914
990 Ga0207678_10008107
991 Ga0207678_10108665
992 Ga0207678_10310901
993 Ga0207708_10003283
994 Ga0207708_10104624
995 Ga0207708_10271838
996 Ga0207708_11074441
997 Ga0207641_10038248
998 Ga0207648_10010808
999 Ga0207648_11301472
1000 Ga0207676_10000647
1001 Ga0207676_10154279
1002 Ga0207674_10019413
1003 Ga0207674_10631358
1004 Ga0207675_100061154
1005 Ga0207675_101593803
1006 Ga0207683_10015626
1007 Ga0207698_11134124
1008 Ga0209966_1022750
1009 Ga0207428_10000755
1010 Ga0207428_10117560
1011 Ga0268265_10321612
1012 Ga0268265_10938527
1013 Ga0268264_10101026
1014 Ga0268264_10226672
1015 Ga0268264_10602519
1016 Ga0265334_10069544
1017 Ga0265318_10061375
1018 Ga0265322_10042246
1019 Ga0265338_10017348
1020 Ga0265330_10004083
1021 Ga0265332_10028425
1022 Ga0265320_10188908
1023 Ga0265329_10008504
1024 Ga0265340_10328817
1025 Ga0265339_10500454
1026 Ga0265316_10001158
1027 Ga0265316_10016442
1028 Ga0265316_10100532
1029 Ga0265314_10205880
1030 Ga0265342_10004598
1031 Ga0316576_10334238
1032 Ga0316576_10623466
1033 Ga0316576_10815439
1034 Ga0316577_10499249
1035 Ga0307406_10347349
1036 Ga0307416_101399308
1037 Ga0307415_100102589
1038 Ga0307415_101029048
1039 Ga0316593_10225617
1040 Ga0316593_10296930
1041 Ga0316593_10432409
1042 Ga0316592_1122044
1043 Ga0316592_1125501
1044 Ga0316588_1005298
1045 Ga0316588_1029297
1046 Ga0316588_1111437
1047 Ga0316596_1021216
1048 Ga0316596_1031012
1049 Ga0316596_1096762
1050 Ga0373930_0165542
1051 Ga0373959_0073356
1052 Ga0373926_0002170
1053 Ga0373929_0103781
1054 Ga0373940_0045577
1055 Ga0373944_0001156
1056 Ga0373949_0226166
1057 Ga0373932_0125928
1058 Ga0373932_0157523
1059 Ga0373936_0009500
1060 Ga0373939_0003745
1061 Ga0373941_0010912
1062 Ga0373945_0004843
1063 Ga0373943_0011049
1064 Ga0373946_0002234
1065 Ga0373955_0244914
1066 Ga0373961_0008156
1067 Ga0373962_0050244
1068 Ga0373931_0024055
1069 Ga0373935_0022388
1070 Ga0373935_1017296
1071 Ga0373947_0002057
1072 Ga0373937_0737959
1073 Ga0316582_0146012
1074 Ga0316582_0290900
1075 Ga0373925_0021904
1076 Ga0395899_0038438
1077 Ga0395899_0100621
1078 Ga0395899_0209587
1079 Ga0395899_0936363
1080 Ga0395900_0079780
1081 Ga0395900_0261463
1082 Ga0395900_0308758
1083 Ga0395900_0481558
1084 Ga0395900_0554082
1085 Ga0395900_1166255
1086 Ga0395898_0029878
1087 Ga0395898_0316427
1088 Ga0395905_0087327
1089 Ga0395905_0198084
1090 Ga0395905_0243175
1091 Ga0395905_0372514
1092 Ga0395905_1028425
1093 Ga0436364_0675508
1094 Ga0395901_0017158
1095 Ga0395901_0067928
1096 Ga0395901_0126345
1097 Ga0395901_0150282
1098 Ga0395901_0444755
1099 Ga0395901_0492767
1100 Ga0395901_0720320
1101 Ga0395901_1101342
1102 Ga0436363_1649457
1103 Ga0439438_062757
1104 Ga0451790_27342
1105 Ga0439448_0090742
1106 Ga0439454_033771
1107 Ga0439455_0018566
1108 Ga0439456_153247
1109 Ga0439463_084711
1110 Ga0450910_002285
1111 Ga0439458_0079925
1112 Ga0439464_0036848
1113 Ga0439460_0032270
1114 Ga0451577_0599457
1115 Ga0439440_0246160
1116 Ga0466968_0423899
1117 Ga0451576_0489698
1118 Ga0451576_2154023
1119 Ga0495592_0090371
1120 Ga0495603_0020616
1121 Ga0495603_0174579
1122 Ga0495603_0181383
1123 Ga0495590_0252390
1124 Ga0495591_040928
1125 Ga0495629_0049329
1126 Ga0495629_0395232
1127 Ga0495638_0365475
1128 Ga0495641_0001712
1129 Ga0495641_0457639
1130 Ga0495651_0093971
1131 Ga0495650_0168514
1132 Ga0495580_0064765
1133 Ga0495580_0125895
1134 Ga0495580_0326376
1135 Ga0495582_0064566
1136 Ga0495582_0479629
1137 Ga0495639_0001433
1138 Ga0495662_0004361
1139 Ga0495664_0797640
1140 Ga0495584_0058716
1141 Ga0495584_0101981
1142 Ga0495584_0135954
1143 Ga0495584_0388758
1144 Ga0495585_0019868
1145 Ga0495585_0071459
1146 Ga0495585_0214669
1147 Ga0495594_0170210
1148 Ga0495607_0159239
1149 Ga0495607_0257451
1150 Ga0495583_0067489
1151 Ga0495616_0315221
1152 Ga0495616_0443079
1153 Ga0495628_0098294
1154 Ga0495630_0012230
1155 Ga0495630_0272816
1156 Ga0495630_1481568
1157 Ga0495631_0221466
1158 Ga0495631_0404697
1159 Ga0495637_0059712
1160 Ga0495644_0014236
1161 Ga0495663_0029820
1162 Ga0495663_0238339
1163 Ga0495663_0332280
1164 Ga0495666_0003428
1165 Ga0495642_0038020
1166 Ga0495642_0204609
1167 Ga0495652_0637233
1168 Ga0495665_0005734
1169 Ga0495665_0112155
1170 Ga0495640_0015599
1171 Ga0495640_0187405
1172 Ga0495586_0015388
1173 Ga0495586_0043241
1174 Ga0495586_0113642
1175 Ga0495598_0045424
1176 Ga0495609_0102347
1177 Ga0495609_0119522
1178 Ga0495609_0339331
1179 Ga0495621_0015914
1180 Ga0495633_0045747
1181 Ga0495633_0335476
1182 Ga0495667_0390780
1183 Ga0495656_0030482
1184 Ga0495656_0121523
1185 Ga0495656_0557811
1186 Ga0495668_0120711
1187 Ga0495634_0016753
1188 Ga0495635_0060316
1189 Ga0495659_0011787
1190 Ga0495659_0224156
1191 Ga0495659_0253677
1192 Ga0495659_0277042
1193 Ga0495659_0421946
1194 Ga0495588_0002482
1195 Ga0495588_0025412
1196 Ga0495588_0201208
1197 Ga0495599_0533662
1198 Ga0495647_0000723
1199 Ga0495647_0247225
1200 Ga0495647_0286081
1201 Ga0495658_0008640
1202 Ga0495658_0312022
1203 Ga0495669_0014426
1204 Ga0495613_0017874
1205 Ga0495613_0166010
1206 Ga0495613_0544368
1207 Ga0495624_0006221
1208 Ga0495670_0052710
1209 Ga0495670_0269067
1210 Ga0495589_0136405
1211 Ga0495660_0154151
1212 Ga0495581_0036306
1213 Ga0495581_0118923
1214 Ga0495636_0167615
1215 Ga0495636_0349075
1216 Ga0495674_0021479
1217 Ga0495676_0077090
1218 Ga0495676_0184148
1219 Ga0495680_0008963
1220 Ga0495677_0133656
1221 Ga0495679_026340
1222 Ga0495685_167972
1223 Ga0495681_0178530
1224 Ga0495684_0043770
1225 Ga0495684_0302326
1226 Ga0495593_0001673
1227 Ga0495614_0092482
1228 Ga0495615_0046944
1229 Ga0495615_0162541
1230 Ga0496100_0041895
1231 Ga0496100_1107559
1232 Ga0496101_0025291
1233 Ga0496101_0432977
1234 Ga0496101_0684545
1235 Ga0496101_1243945
1236 Ga0496102_0018527
1237 Ga0496102_0480328
1238 Ga0496103_0102296
1239 Ga0496103_1034478
1240 Ga0496104_0205874
1241 Ga0496104_0373616
1242 Ga0496104_0535460
1243 Ga0496105_0127286
1244 Ga0496105_0187178
1245 Ga0496105_0520445
1246 Ga0496106_0008125
1247 Ga0496106_0226406
1248 Ga0496107_0006741
1249 Ga0496107_0043569
1250 Ga0496108_0016189
1251 Ga0496108_0023793
1252 Ga0496108_0034603
1253 Ga0496108_0923093
1254 Ga0496108_1784909
1255 Ga0496109_0002583
1256 Ga0496109_0026262
1257 Ga0496109_0069700
1258 Ga0496109_0238479
1259 Ga0496109_0634249
1260 Ga0496110_0027911
1261 Ga0496110_0112012
1262 Ga0496110_0158635
1263 Ga0496110_0691669
1264 Ga0496111_0032586
1265 Ga0496111_0118733
1266 Ga0496111_0136537
1267 Ga0496112_0049244
1268 Ga0496113_0010377
1269 Ga0496113_0077648
1270 Ga0496114_0012594
1271 Ga0496114_0220275
1272 Ga0496114_0462035
1273 Ga0496115_0298175
1274 Ga0501031_0005712
1275 Ga0501031_0013361
1276 Ga0501031_0033210
1277 Ga0501031_0169764
1278 Ga0501032_0052636
1279 Ga0501032_0211659
1280 Ga0501033_0007148
1281 Ga0501033_0181337
1282 Ga0501033_0232695
1283 Ga0501033_0580566
1284 Ga0501034_0032649
1285 Ga0501036_0036951
1286 Ga0501036_0056450
1287 Ga0501036_0116226
1288 Ga0501036_0274233
1289 Ga0501036_0334209
1290 Ga0501036_1301202
1291 Ga0501037_0012014
1292 Ga0501038_0010226
1293 Ga0501038_0151602
1294 Ga0501039_0006358
1295 Ga0501039_0107202
1296 Ga0501039_0172087
1297 Ga0501039_0409660
1298 Ga0501040_0037369
1299 Ga0501040_0071157
1300 Ga0501040_0079449
1301 Ga0501040_0139756
1302 Ga0501040_0508192
1303 Ga0501040_0572784
1304 Ga0501040_0761387
1305 Ga0501040_0942189
1306 Ga0501040_1367575
1307 Ga0501041_0013948
1308 Ga0501041_0016181
1309 Ga0501041_0205939
1310 Ga0501041_0238350
1311 Ga0501041_0285697
1312 Ga0501042_0036758
1313 Ga0501042_0091742
1314 Ga0501042_0110079
1315 Ga0501042_0127279
1316 Ga0501042_0838151
1317 Ga0501043_0016572
1318 Ga0501046_0042354
1319 Ga0501046_0083408
1320 Ga0501046_0321938
1321 Ga0501047_0078177
1322 Ga0501047_0465461
1323 Ga0501048_0007798
1324 Ga0501048_0123058
1325 Ga0501048_0164743
1326 Ga0501067_0046999
1327 Ga0501067_0263345
1328 Ga0501067_0318905
1329 Ga0501068_0010128
1330 Ga0501068_0046859
1331 Ga0501068_0071793
1332 Ga0501068_0223720
1333 Ga0501068_0736238
1334 Ga0501069_0001092
1335 Ga0501069_0118008
1336 Ga0501069_0187689
1337 Ga0501069_0478697
1338 Ga0501069_0496267
1339 Ga0501070_0098568
1340 Ga0501070_0517290
1341 Ga0501070_0797106
1342 Ga0501071_0085739
1343 Ga0501071_0091361
1344 Ga0501071_0278604
1345 Ga0501072_0018661
1346 Ga0501072_0061889
1347 Ga0501072_0637277
1348 Ga0501072_0817234
1349 Ga0501072_1041229
1350 Ga0501072_1064107
1351 Ga0501073_0005258
1352 Ga0501073_0012868
1353 Ga0501073_0248604
1354 Ga0501074_0006881
1355 Ga0501074_0185736
1356 Ga0501074_0643167
1357 Ga0501074_0898064
1358 Ga0501075_0002249
1359 Ga0501075_0104539
1360 Ga0501075_0168367
1361 Ga0501075_0210983
1362 Ga0501075_0295986
1363 Ga0501075_0429324
1364 Ga0501075_0560213
1365 Ga0501075_0574351
1366 Ga0501076_0033915
1367 Ga0501076_0039075
1368 Ga0501076_0494947
1369 Ga0501076_1369347
1370 Ga0501077_0004105
1371 Ga0501077_0040119
1372 Ga0501077_0236699
1373 Ga0501077_0356113
1374 Ga0501077_0425913
1375 Ga0501079_0037240
1376 Ga0501079_0093053
1377 Ga0501079_0125001
1378 Ga0501079_0250111
1379 Ga0501079_0412504
1380 Ga0501080_0042292
1381 Ga0501080_0110562
1382 Ga0501080_0341288
1383 Ga0501080_0557516
1384 Ga0501080_1654774
1385 Ga0501081_0012692
1386 Ga0501081_0040976
1387 Ga0501081_0125615
1388 Ga0501081_0258729
1389 Ga0501081_0506119
1390 Ga0501083_0007193
1391 Ga0501083_0286778
1392 Ga0501083_0475275
1393 Ga0501035_0105838
1394 Ga0501035_0214143
1395 Ga0501035_0314778
1396 Ga0501044_0027418
1397 Ga0501045_0044008
1398 Ga0501045_0181394
1399 Ga0501045_0410453
1400 Ga0501045_1033601
1401 Ga0501045_1166359
1402 nmdc:mga05p37_10502_c1
1403 nmdc:mga05p37_12934_c1
1404 nmdc:mga05p37_142740_c1
1405 nmdc:mga05p37_14947_c1
1406 nmdc:mga05p37_1899666_c1
1407 nmdc:mga05p37_19236_c1
1408 nmdc:mga05p37_456406_c1
1409 nmdc:mga05p37_82027_c1
1410 nmdc:mga05p37_902888_c1
1411 nmdc:mga09592_170191_c1
1412 nmdc:mga09592_30411_c1
1413 nmdc:mga0qj67_177733_c1
1414 nmdc:mga0qj67_28824_c1
1415 nmdc:mga06r32_1363378_c1
1416 nmdc:mga06r32_1398354_c1
1417 nmdc:mga06r32_344948_c1
1418 nmdc:mga06r32_7418_c1
1419 nmdc:mga08y16_143659_c1
1420 nmdc:mga08y16_252419_c1
1421 nmdc:mga0n895_48726_c1
1422 nmdc:mga0n895_814134_c1
1423 nmdc:mga0rr50_566004_c1
1424 nmdc:mga0a205_1371788_c1
1425 nmdc:mga0a205_3780_c1
1426 Ga0495601_0009906
1427 Ga0495655_0022559
1428 Ga0495619_0030323
1429 Ga0495619_0180039
1430 Ga0501084_0044744
1431 Ga0501084_0110155
1432 Ga0501084_0126394
1433 Ga0501084_0152220
1434 Ga0501084_0330227
1435 Ga0501084_0785266
1436 Ga0590074_020206
1437 Ga0590075_007808
1438 Ga0590075_099261
1439 Ga0587122_020029
1440 Ga0587068_040802
1441 Ga0587079_193078
1442 Ga0587114_130813
1443 Ga0587071_070658
1444 Ga0587111_0251432
1445 Ga0501082_0015305
1446 Ga0501082_0030614
1447 Ga0501082_0081214
1448 Ga0501082_0113711
1449 Ga0501082_0364110
1450 Ga0501082_0386316
1451 Ga0501082_0428740
1452 Ga0501082_0462952
1453 Ga0501082_0840005
1454 Ga0501082_1854582
1455 Ga0530510_0010134
1456 Ga0530510_0027152
1457 Ga0530510_0334883
1458 Ga0530510_0744721
1459 Ga0530510_1337646
1460 2837185944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

3

108

0.98

Map