F477705

General Info

Members Datasets Scaffolds Average Seq Length
726 318 717 133

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000129|Ga0496124_0000129_144766_145221
Length 151
Sequence MAMRRYPRASIISASAAPMAEIPDAAIVEEKFLAATGPGGQNVNKVATAVQLRIDVFRLGLSPYAYERLKELAGTRMTSAGELLITARQYRTQDANRTDARQRLSDLIDKAHERQARRVKTKPSKAAKXRRVDAKKGRSVVKAGRGKVSFD

Samples

Sample ID Description Type Environment
1 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
2 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
3 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
4 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
5 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
6 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
7 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
8 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
9 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
10 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
210 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
213 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
297 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
298 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
303 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
304 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
312 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
313 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
314 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
315 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
316 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
317 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
318 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.85
Nodule 0.14
Rhizoplane 3.17
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c011761 3300000041 Bacteria 748
2 ARcpr5yngRDRAFT_c009262 3300000043 Bacteria 843
3 JGI24740J21852_10003761 3300001979 Bacteria 6606
4 JGI24739J22299_10024914 3300001989 Bacteria 2106
5 JGI24737J22298_10000315 3300001990 Bacteria 16196
6 JGI24737J22298_10004866 3300001990 Bacteria 4657
7 JGI24737J22298_10005025 3300001990 Bacteria 4584
8 JGI24737J22298_10034423 3300001990 Bacteria 1570
9 JGI24735J21928_10005077 3300002067 Bacteria 4380
10 JGI24735J21928_10021864 3300002067 Bacteria 1950
11 JGI24735J21928_10051185 3300002067 Bacteria 1192
12 JGI24738J21930_10002201 3300002075 Bacteria 5187
13 JGI24738J21930_10041608 3300002075 Bacteria 934
14 JGI24744J21845_10002683 3300002077 Bacteria 3628
15 JGI25151J46595_10139345 3300003187 Bacteria 593
16 JGI25165J46597_1000040 3300003214 Bacteria 277491
17 JGI25153J46596_10000031 3300003215 Bacteria 196926
18 JGI25153J46596_10000091 3300003215 Bacteria 105614
19 JGI25153J46596_10045061 3300003215 Bacteria 1320
20 rootH2_10005041 3300003320 Bacteria 1664
21 Ga0055525_1000012 3300003759 Bacteria 486564
22 Ga0055542_1000322 3300003762 Bacteria 51124
23 Ga0055529_1000014 3300003763 Bacteria 367283
24 Ga0055526_1003569 3300003771 Bacteria 9796
25 Ga0055537_1001470 3300003773 Bacteria 9160
26 Ga0055537_1001547 3300003773 Bacteria 8796
27 Ga0055524_1001171 3300003775 Bacteria 15663
28 Ga0055536_1026317 3300003781 Bacteria 1634
29 Ga0055530_10009450 3300003791 Bacteria 3746
30 Ga0055530_10022076 3300003791 Bacteria 1860
31 Ga0055530_10075464 3300003791 Bacteria 718
32 Ga0055540_1004562 3300003792 Bacteria 6168
33 Ga0055531_10013567 3300003794 Bacteria 3746
34 Ga0055531_10029632 3300003794 Bacteria 1860
35 Ga0065165_1002705 3300005262 Bacteria 14222
36 Ga0065165_1003177 3300005262 Bacteria 12034
37 Ga0065165_1013615 3300005262 Bacteria 3220
38 Ga0065712_10075190 3300005290 Bacteria 3901
39 Ga0065715_10132303 3300005293 Bacteria 1993
40 Ga0070658_10000022 3300005327 Bacteria 186706
41 Ga0070658_10005125 3300005327 Bacteria 10668
42 Ga0070658_10010467 3300005327 Bacteria 7440
43 Ga0070658_11054536 3300005327 Bacteria 707
44 Ga0070676_10004634 3300005328 Bacteria 7259
45 Ga0070676_10009924 3300005328 Bacteria 5154
46 Ga0070676_10223767 3300005328 Bacteria 1244
47 Ga0070676_10770078 3300005328 Bacteria 708
48 Ga0070676_11104862 3300005328 Bacteria 599
49 Ga0070683_100384779 3300005329 Bacteria 1337
50 Ga0070683_100920270 3300005329 Bacteria 839
51 Ga0070670_100011899 3300005331 Bacteria 7440
52 Ga0070670_100025648 3300005331 Bacteria 5071
53 Ga0070670_100234775 3300005331 Bacteria 1596
54 Ga0070670_100466931 3300005331 Bacteria 1120
55 Ga0070677_10085291 3300005333 Bacteria 1362
56 Ga0068869_100000467 3300005334 Bacteria 22352
57 Ga0070666_10054920 3300005335 Bacteria 2687
58 Ga0070666_10062800 3300005335 Bacteria 2517
59 Ga0070680_100169757 3300005336 Bacteria 1835
60 Ga0068868_100000092 3300005338 Bacteria 55036
61 Ga0068868_100442712 3300005338 Bacteria 1129
62 Ga0070660_100000751 3300005339 Bacteria 21524
63 Ga0070660_100003262 3300005339 Bacteria 11132
64 Ga0070660_100056773 3300005339 Bacteria 3030
65 Ga0070660_100357805 3300005339 Bacteria 1203
66 Ga0070660_100541547 3300005339 Bacteria 971
67 Ga0070661_100000130 3300005344 Bacteria 62986
68 Ga0070661_100033253 3300005344 Bacteria 3735
69 Ga0070661_100164048 3300005344 Bacteria 1684
70 Ga0070661_100236900 3300005344 Bacteria 1404
71 Ga0070692_10001368 3300005345 Bacteria 8801
72 Ga0070692_10061516 3300005345 Bacteria 1979
73 Ga0070668_100000906 3300005347 Bacteria 20637
74 Ga0070668_100022772 3300005347 Bacteria 4736
75 Ga0070668_100029073 3300005347 Bacteria 4196
76 Ga0070668_101124712 3300005347 Bacteria 710
77 Ga0070669_100009672 3300005353 Bacteria 6867
78 Ga0070669_100107486 3300005353 Bacteria 2113
79 Ga0070669_100409854 3300005353 Bacteria 1110
80 Ga0070675_100095820 3300005354 Bacteria 2492
81 Ga0070675_100151839 3300005354 Bacteria 1986
82 Ga0070675_100364353 3300005354 Bacteria 1284
83 Ga0070671_100020082 3300005355 Bacteria 5443
84 Ga0070674_100000035 3300005356 Bacteria 60166
85 Ga0070674_100000329 3300005356 Bacteria 23441
86 Ga0070674_100714248 3300005356 Bacteria 858
87 Ga0070673_100000009 3300005364 Bacteria 155005
88 Ga0070673_100005666 3300005364 Bacteria 8024
89 Ga0070673_100256013 3300005364 Bacteria 1527
90 Ga0070659_100048117 3300005366 Bacteria 3348
91 Ga0070659_100140735 3300005366 Bacteria 1964
92 Ga0070659_100149520 3300005366 Bacteria 1904
93 Ga0070659_100427247 3300005366 Bacteria 1121
94 Ga0070659_100452625 3300005366 Bacteria 1089
95 Ga0070659_102158394 3300005366 Bacteria 501
96 Ga0070667_100000641 3300005367 Bacteria 33965
97 Ga0070667_100002416 3300005367 Bacteria 16338
98 Ga0070667_100018960 3300005367 Bacteria 5704
99 Ga0070667_100203038 3300005367 Bacteria 1759
100 Ga0070667_100603514 3300005367 Bacteria 1011
101 Ga0070663_100009984 3300005455 Bacteria 5902
102 Ga0070663_100086230 3300005455 Bacteria 2318
103 Ga0070663_101402580 3300005455 Bacteria 619
104 Ga0070678_100000060 3300005456 Bacteria 39901
105 Ga0070678_100009721 3300005456 Bacteria 5843
106 Ga0070678_100480004 3300005456 Bacteria 1094
107 Ga0070662_100010272 3300005457 Bacteria 6137
108 Ga0070662_100010751 3300005457 Bacteria 6024
109 Ga0070662_100098202 3300005457 Bacteria 2211
110 Ga0070662_100397579 3300005457 Bacteria 1137
111 Ga0070662_100480689 3300005457 Bacteria 1034
112 Ga0070681_10015840 3300005458 Bacteria 7516
113 Ga0070681_10107967 3300005458 Bacteria 2724
114 Ga0070681_10587461 3300005458 Bacteria 1028
115 Ga0070681_10729352 3300005458 Bacteria 907
116 Ga0068867_100000002 3300005459 Bacteria 247206
117 Ga0068867_100004940 3300005459 Bacteria 9396
118 Ga0068867_101384863 3300005459 Bacteria 652
119 Ga0070679_100000021 3300005530 Bacteria 124652
120 Ga0070679_100637845 3300005530 Bacteria 1008
121 Ga0070684_101007723 3300005535 Bacteria 782
122 Ga0068853_100038814 3300005539 Bacteria 4058
123 Ga0068853_100089389 3300005539 Bacteria 2705
124 Ga0068853_100114747 3300005539 Bacteria 2396
125 Ga0068853_100144186 3300005539 Bacteria 2139
126 Ga0068853_100550260 3300005539 Bacteria 1093
127 Ga0070672_100008045 3300005543 Bacteria 7202
128 Ga0070672_100022207 3300005543 Bacteria 4655
129 Ga0070672_100299934 3300005543 Bacteria 1362
130 Ga0070696_100006792 3300005546 Bacteria 7642
131 Ga0070665_100000115 3300005548 Bacteria 151164
132 Ga0070665_100084334 3300005548 Bacteria 3183
133 Ga0070665_100518185 3300005548 Bacteria 1204
134 Ga0068855_100000333 3300005563 Bacteria 58773
135 Ga0068855_100001164 3300005563 Bacteria 32603
136 Ga0068855_100049033 3300005563 Bacteria 4983
137 Ga0068855_100095443 3300005563 Bacteria 3427
138 Ga0068855_100899917 3300005563 Bacteria 935
139 Ga0068855_101844867 3300005563 Unclassified 613
140 Ga0070664_100008107 3300005564 Bacteria 8491
141 Ga0070664_100105053 3300005564 Bacteria 2460
142 Ga0070664_100272568 3300005564 Bacteria 1525
143 Ga0070664_100514718 3300005564 Bacteria 1104
144 Ga0068857_100004444 3300005577 Bacteria 11862
145 Ga0068854_100000380 3300005578 Bacteria 28213
146 Ga0068854_100025690 3300005578 Bacteria 4041
147 Ga0068854_100119227 3300005578 Bacteria 2001
148 Ga0068854_100241662 3300005578 Bacteria 1438
149 Ga0068854_101001322 3300005578 Bacteria 740
150 Ga0068856_100013110 3300005614 Bacteria 8029
151 Ga0068856_100031423 3300005614 Bacteria 5194
152 Ga0068852_100001302 3300005616 Bacteria 16691
153 Ga0068852_100347958 3300005616 Bacteria 1446
154 Ga0068859_100012317 3300005617 Bacteria 8605
155 Ga0068859_100160863 3300005617 Bacteria 2324
156 Ga0068859_100237719 3300005617 Bacteria 1910
157 Ga0068859_100622361 3300005617 Bacteria 1172
158 Ga0068859_100726087 3300005617 Bacteria 1083
159 Ga0068864_100000016 3300005618 Bacteria 292454
160 Ga0068864_100380181 3300005618 Bacteria 1338
161 Ga0068864_100399098 3300005618 Bacteria 1306
162 Ga0068851_10012325 3300005834 Bacteria 4027
163 Ga0068851_10438833 3300005834 Bacteria 774
164 Ga0068863_100000047 3300005841 Bacteria 140249
165 Ga0068863_100000089 3300005841 Bacteria 101645
166 Ga0068863_100003668 3300005841 Bacteria 15161
167 Ga0068863_100008189 3300005841 Bacteria 10212
168 Ga0068863_100058002 3300005841 Bacteria 3664
169 Ga0068863_100119831 3300005841 Bacteria 2508
170 Ga0068863_101829075 3300005841 Bacteria 617
171 Ga0068858_100008945 3300005842 Bacteria 9597
172 Ga0068860_100001603 3300005843 Bacteria 24294
173 Ga0068860_100148772 3300005843 Bacteria 2254
174 Ga0068860_100315051 3300005843 Bacteria 1535
175 Ga0068862_100000068 3300005844 Bacteria 123535
176 Ga0068862_100000986 3300005844 Bacteria 27222
177 Ga0081539_10007074 3300005985 Bacteria 10376
178 Ga0075369_10038377 3300006186 Bacteria 2043
179 Ga0097621_100021424 3300006237 Bacteria 4999
180 Ga0068871_100004655 3300006358 Bacteria 9585
181 Ga0068871_100171913 3300006358 Bacteria 1858
182 Ga0068871_100285428 3300006358 Bacteria 1445
183 Ga0068865_100000014 3300006881 Bacteria 138727
184 Ga0068865_100195482 3300006881 Bacteria 1567
185 Ga0068865_100384205 3300006881 Bacteria 1146
186 Ga0068865_100459451 3300006881 Bacteria 1054
187 Ga0068865_100803238 3300006881 Bacteria 812
188 Ga0097620_100012317 3300006931 Bacteria 8605
189 Ga0097620_100160860 3300006931 Bacteria 2324
190 Ga0097620_100237718 3300006931 Bacteria 1910
191 Ga0097620_100622359 3300006931 Bacteria 1172
192 Ga0097620_100726105 3300006931 Bacteria 1083
193 Ga0099826_10111731 3300006948 Bacteria 1627
194 Ga0105251_10001932 3300009011 Bacteria 16960
195 Ga0105240_10004046 3300009093 Bacteria 22558
196 Ga0105240_10038634 3300009093 Bacteria 6121
197 Ga0105240_10051063 3300009093 Bacteria 5207
198 Ga0105240_10282098 3300009093 Bacteria 1908
199 Ga0105245_10001236 3300009098 Bacteria 23068
200 Ga0105245_11816733 3300009098 Bacteria 662
201 Ga0105247_10000985 3300009101 Bacteria 21464
202 Ga0105247_10015646 3300009101 Bacteria 4541
203 Ga0105247_10106888 3300009101 Bacteria 1796
204 Ga0105243_10000070 3300009148 Bacteria 120851
205 Ga0105243_10001791 3300009148 Bacteria 18449
206 Ga0105243_10073758 3300009148 Bacteria 2766
207 Ga0105243_10546149 3300009148 Bacteria 1106
208 Ga0105243_10619836 3300009148 Bacteria 1044
209 Ga0105241_10004388 3300009174 Bacteria 10429
210 Ga0105241_10130977 3300009174 Bacteria 2031
211 Ga0105242_10000273 3300009176 Bacteria 41098
212 Ga0105242_11443763 3300009176 Bacteria 717
213 Ga0105248_10000021 3300009177 Bacteria 276159
214 Ga0105248_10002393 3300009177 Bacteria 20837
215 Ga0105248_10018071 3300009177 Bacteria 7783
216 Ga0105237_10004611 3300009545 Bacteria 15889
217 Ga0105237_10017550 3300009545 Bacteria 7416
218 Ga0105237_10032273 3300009545 Bacteria 5302
219 Ga0105237_10078880 3300009545 Bacteria 3282
220 Ga0105237_11523622 3300009545 Bacteria 675
221 Ga0105238_10080044 3300009551 Bacteria 3257
222 Ga0105238_10118232 3300009551 Bacteria 2631
223 Ga0105238_10558728 3300009551 Bacteria 1149
224 Ga0105249_10000017 3300009553 Bacteria 277115
225 Ga0105249_10001264 3300009553 Bacteria 22162
226 Ga0105249_10001584 3300009553 Bacteria 19942
227 Ga0105249_10288452 3300009553 Bacteria 1642
228 Ga0105249_11992838 3300009553 Bacteria 653
229 Ga0105249_12757113 3300009553 Bacteria 563
230 Ga0105249_13212122 3300009553 Bacteria 525
231 Ga0105239_10000546 3300010375 Bacteria 53959
232 Ga0105239_10038762 3300010375 Bacteria 5221
233 Ga0105239_10686070 3300010375 Bacteria 1171
234 Ga0105239_11258994 3300010375 Bacteria 853
235 Ga0105246_10002662 3300011119 Bacteria 10819
236 Ga0105246_10054421 3300011119 Bacteria 2758
237 Ga0157326_1001062 3300012513 Bacteria 3100
238 Ga0157373_10043654 3300013100 Bacteria 3202
239 Ga0157373_10083098 3300013100 Bacteria 2257
240 Ga0157373_10086011 3300013100 Bacteria 2216
241 Ga0157371_10000193 3300013102 Bacteria 90182
242 Ga0157371_10054006 3300013102 Bacteria 2854
243 Ga0157371_10073640 3300013102 Bacteria 2419
244 Ga0157371_10514372 3300013102 Bacteria 885
245 Ga0157371_10554301 3300013102 Bacteria 852
246 Ga0157371_10863917 3300013102 Bacteria 684
247 Ga0157370_10000117 3300013104 Bacteria 92168
248 Ga0157370_10853360 3300013104 Bacteria 827
249 Ga0157369_10030477 3300013105 Bacteria 5949
250 Ga0157369_10170694 3300013105 Bacteria 2292
251 Ga0157374_10000831 3300013296 Bacteria 27036
252 Ga0157374_10005135 3300013296 Bacteria 10980
253 Ga0157374_10041788 3300013296 Bacteria 4227
254 Ga0157374_10335658 3300013296 Bacteria 1500
255 Ga0157378_10000944 3300013297 Bacteria 26700
256 Ga0163162_10011469 3300013306 Bacteria 8644
257 Ga0157372_10182260 3300013307 Bacteria 2431
258 Ga0157372_10275339 3300013307 Bacteria 1956
259 Ga0157372_10286207 3300013307 Bacteria 1917
260 Ga0157372_10337359 3300013307 Bacteria 1756
261 Ga0157375_10002997 3300013308 Bacteria 14669
262 Ga0157375_10111021 3300013308 Bacteria 2840
263 Ga0157375_10141594 3300013308 Bacteria 2532
264 Ga0163163_10013700 3300014325 Bacteria 7429
265 Ga0163163_10067172 3300014325 Bacteria 3564
266 Ga0163163_12888084 3300014325 Bacteria 536
267 Ga0157377_10026133 3300014745 Bacteria 3121
268 Ga0157379_10151556 3300014968 Bacteria 2091
269 Ga0157376_10000186 3300014969 Bacteria 43043
270 Ga0163161_10261965 3300017792 Bacteria 1350
271 Ga0163161_10308905 3300017792 Bacteria 1247
272 Ga0213875_10419316 3300021388 Bacteria 639
273 Ga0209563_100030 3300025230 Bacteria 489259
274 Ga0207427_100441 3300025231 Bacteria 23126
275 Ga0207425_1000049 3300025245 Bacteria 180735
276 Ga0207425_1008078 3300025245 Bacteria 2723
277 Ga0209026_1000675 3300025250 Bacteria 20558
278 Ga0209677_117223 3300025253 Bacteria 905
279 Ga0209148_1000011 3300025254 Bacteria 1196503
280 Ga0209129_1001668 3300025258 Bacteria 12020
281 Ga0209233_1000003 3300025261 Bacteria 1607366
282 Ga0209565_1000007 3300025263 Bacteria 784361
283 Ga0209565_1000170 3300025263 Bacteria 84580
284 Ga0209455_1000006 3300025272 Bacteria 1196503
285 Ga0209455_1024217 3300025272 Bacteria 1125
286 Ga0209673_1007604 3300025273 Bacteria 4953
287 Ga0209673_1032519 3300025273 Bacteria 1606
288 Ga0209675_1004240 3300025291 Bacteria 6463
289 Ga0209676_1010374 3300025292 Bacteria 3892
290 Ga0209676_1023070 3300025292 Bacteria 2045
291 Ga0209025_1000068 3300025294 Bacteria 294129
292 Ga0209564_1000335 3300025295 Bacteria 91079
293 Ga0209564_1026133 3300025295 Bacteria 1939
294 Ga0209758_1000001 3300025297 Bacteria 1981790
295 Ga0209758_1000004 3300025297 Bacteria 1375322
296 Ga0209758_1018028 3300025297 Bacteria 3482
297 Ga0209758_1054268 3300025297 Bacteria 1370
298 Ga0209050_1000001 3300025298 Bacteria 3563507
299 Ga0209050_1006899 3300025298 Bacteria 6573
300 Ga0209050_1021069 3300025298 Bacteria 2394
301 Ga0209256_1000009 3300025299 Bacteria 922071
302 Ga0209256_1000010 3300025299 Bacteria 912110
303 Ga0207426_1032149 3300025302 Bacteria 1704
304 Ga0207426_1111532 3300025302 Bacteria 688
305 Ga0209051_1000191 3300025303 Bacteria 108763
306 Ga0209051_1071930 3300025303 Bacteria 1037
307 Ga0209257_1003180 3300025304 Bacteria 14609
308 Ga0209257_1003572 3300025304 Bacteria 13185
309 Ga0209257_1003678 3300025304 Bacteria 12808
310 Ga0207697_10126939 3300025315 Bacteria 1101
311 Ga0207656_10084319 3300025321 Bacteria 1433
312 Ga0207656_10348198 3300025321 Bacteria 739
313 Ga0207710_10082022 3300025900 Bacteria 1497
314 Ga0207688_10024275 3300025901 Bacteria 3324
315 Ga0207688_10274284 3300025901 Bacteria 1026
316 Ga0207680_10202815 3300025903 Bacteria 1352
317 Ga0207647_10009257 3300025904 Bacteria 7004
318 Ga0207647_10011528 3300025904 Bacteria 6195
319 Ga0207647_10018578 3300025904 Bacteria 4697
320 Ga0207647_10018802 3300025904 Bacteria 4661
321 Ga0207647_10144287 3300025904 Bacteria 1394
322 Ga0207647_10160000 3300025904 Bacteria 1314
323 Ga0207647_10358421 3300025904 Bacteria 825
324 Ga0207645_10015318 3300025907 Bacteria 5098
325 Ga0207645_10025433 3300025907 Bacteria 3831
326 Ga0207645_10509924 3300025907 Bacteria 815
327 Ga0207645_10664613 3300025907 Bacteria 708
328 Ga0207705_10000042 3300025909 Bacteria 182120
329 Ga0207705_10000188 3300025909 Bacteria 64247
330 Ga0207705_10021287 3300025909 Bacteria 4626
331 Ga0207705_10661603 3300025909 Bacteria 812
332 Ga0207705_10955698 3300025909 Bacteria 663
333 Ga0207654_10000227 3300025911 Bacteria 34512
334 Ga0207707_10013301 3300025912 Bacteria 7172
335 Ga0207707_10130828 3300025912 Bacteria 2195
336 Ga0207707_10286433 3300025912 Bacteria 1426
337 Ga0207695_10003844 3300025913 Bacteria 20795
338 Ga0207695_10015444 3300025913 Bacteria 8988
339 Ga0207695_10028168 3300025913 Bacteria 6237
340 Ga0207695_10083252 3300025913 Bacteria 3232
341 Ga0207695_10091255 3300025913 Bacteria 3060
342 Ga0207671_10004049 3300025914 Bacteria 14213
343 Ga0207671_10012108 3300025914 Bacteria 6965
344 Ga0207671_10036679 3300025914 Bacteria 3637
345 Ga0207671_10044525 3300025914 Bacteria 3282
346 Ga0207660_10003328 3300025917 Bacteria 10490
347 Ga0207662_10355880 3300025918 Bacteria 984
348 Ga0207657_10000900 3300025919 Bacteria 31430
349 Ga0207657_10001241 3300025919 Bacteria 27265
350 Ga0207657_10001555 3300025919 Bacteria 24617
351 Ga0207657_10016697 3300025919 Bacteria 7074
352 Ga0207657_10048500 3300025919 Bacteria 3708
353 Ga0207657_10136202 3300025919 Bacteria 2009
354 Ga0207657_10263111 3300025919 Bacteria 1372
355 Ga0207657_10322123 3300025919 Bacteria 1222
356 Ga0207657_10440642 3300025919 Bacteria 1023
357 Ga0207649_10000134 3300025920 Bacteria 63335
358 Ga0207649_10002240 3300025920 Bacteria 10928
359 Ga0207649_10032880 3300025920 Bacteria 3095
360 Ga0207649_10202905 3300025920 Bacteria 1402
361 Ga0207652_10000047 3300025921 Bacteria 125286
362 Ga0207652_10493523 3300025921 Bacteria 1103
363 Ga0207652_11278017 3300025921 Bacteria 636
364 Ga0207681_10008042 3300025923 Bacteria 6454
365 Ga0207681_10146964 3300025923 Bacteria 1762
366 Ga0207694_10000683 3300025924 Bacteria 30452
367 Ga0207650_10000069 3300025925 Bacteria 138442
368 Ga0207650_10003451 3300025925 Bacteria 10859
369 Ga0207650_10050776 3300025925 Bacteria 3068
370 Ga0207650_10216175 3300025925 Bacteria 1541
371 Ga0207650_10740809 3300025925 Bacteria 831
372 Ga0207659_10112865 3300025926 Bacteria 2069
373 Ga0207659_10240661 3300025926 Bacteria 1464
374 Ga0207659_11431214 3300025926 Bacteria 592
375 Ga0207687_10000252 3300025927 Bacteria 36302
376 Ga0207644_10006505 3300025931 Bacteria 7618
377 Ga0207690_10001286 3300025932 Bacteria 15851
378 Ga0207690_10063454 3300025932 Bacteria 2519
379 Ga0207690_10243567 3300025932 Bacteria 1386
380 Ga0207690_10420538 3300025932 Bacteria 1069
381 Ga0207690_10432323 3300025932 Bacteria 1055
382 Ga0207706_10004012 3300025933 Bacteria 13933
383 Ga0207706_10059349 3300025933 Bacteria 3369
384 Ga0207706_10101956 3300025933 Bacteria 2525
385 Ga0207706_10167689 3300025933 Bacteria 1930
386 Ga0207706_10737468 3300025933 Bacteria 840
387 Ga0207706_10893307 3300025933 Bacteria 751
388 Ga0207686_10001911 3300025934 Bacteria 11532
389 Ga0207709_10000066 3300025935 Bacteria 189194
390 Ga0207709_10000246 3300025935 Bacteria 66685
391 Ga0207709_11099301 3300025935 Bacteria 653
392 Ga0207669_10000030 3300025937 Bacteria 88341
393 Ga0207669_10000615 3300025937 Bacteria 15477
394 Ga0207669_10031379 3300025937 Bacteria 2968
395 Ga0207669_10037347 3300025937 Bacteria 2786
396 Ga0207704_10000002 3300025938 Bacteria 303025
397 Ga0207704_10000007 3300025938 Bacteria 211230
398 Ga0207704_10051567 3300025938 Bacteria 2489
399 Ga0207704_10894299 3300025938 Bacteria 746
400 Ga0207704_11304893 3300025938 Bacteria 621
401 Ga0207691_10008730 3300025940 Bacteria 9719
402 Ga0207691_10087107 3300025940 Bacteria 2801
403 Ga0207691_10134528 3300025940 Bacteria 2182
404 Ga0207691_10233886 3300025940 Bacteria 1590
405 Ga0207691_10290423 3300025940 Bacteria 1406
406 Ga0207711_10000025 3300025941 Bacteria 289972
407 Ga0207711_10020383 3300025941 Bacteria 5527
408 Ga0207711_10429445 3300025941 Bacteria 1229
409 Ga0207689_10000060 3300025942 Bacteria 85326
410 Ga0207689_10083820 3300025942 Bacteria 2621
411 Ga0207679_10038837 3300025945 Bacteria 3396
412 Ga0207679_10042339 3300025945 Bacteria 3272
413 Ga0207679_10240411 3300025945 Bacteria 1534
414 Ga0207667_10000002 3300025949 Bacteria 895662
415 Ga0207667_10000017 3300025949 Bacteria 390654
416 Ga0207667_10002977 3300025949 Bacteria 21052
417 Ga0207667_10016552 3300025949 Bacteria 8328
418 Ga0207667_10038294 3300025949 Bacteria 5123
419 Ga0207667_10104027 3300025949 Bacteria 2928
420 Ga0207667_10436746 3300025949 Bacteria 1331
421 Ga0207651_10000004 3300025960 Bacteria 290191
422 Ga0207651_10023484 3300025960 Bacteria 3794
423 Ga0207651_10061183 3300025960 Bacteria 2617
424 Ga0207712_10000012 3300025961 Bacteria 392363
425 Ga0207712_10001388 3300025961 Bacteria 16564
426 Ga0207712_10412158 3300025961 Bacteria 1138
427 Ga0207712_11105837 3300025961 Bacteria 705
428 Ga0207712_11452804 3300025961 Bacteria 614
429 Ga0207712_12001469 3300025961 Bacteria 518
430 Ga0207668_10000062 3300025972 Bacteria 88123
431 Ga0207668_10000459 3300025972 Bacteria 25616
432 Ga0207668_10124865 3300025972 Bacteria 1955
433 Ga0207640_10000406 3300025981 Bacteria 27343
434 Ga0207640_10001048 3300025981 Bacteria 15292
435 Ga0207640_10006873 3300025981 Bacteria 6257
436 Ga0207640_10045007 3300025981 Bacteria 2832
437 Ga0207640_10064358 3300025981 Bacteria 2441
438 Ga0207640_10213160 3300025981 Bacteria 1473
439 Ga0207658_10000153 3300025986 Bacteria 72252
440 Ga0207658_10000539 3300025986 Bacteria 34304
441 Ga0207658_10006472 3300025986 Bacteria 7994
442 Ga0207658_10124004 3300025986 Bacteria 2064
443 Ga0207677_10000060 3300026023 Bacteria 93186
444 Ga0207677_10088000 3300026023 Bacteria 2251
445 Ga0207677_10402104 3300026023 Bacteria 1162
446 Ga0207677_11225198 3300026023 Bacteria 687
447 Ga0207703_10105168 3300026035 Bacteria 2399
448 Ga0207639_10007346 3300026041 Bacteria 7508
449 Ga0207639_10039093 3300026041 Bacteria 3533
450 Ga0207639_10453273 3300026041 Bacteria 1165
451 Ga0207678_10001389 3300026067 Bacteria 22281
452 Ga0207678_10020196 3300026067 Bacteria 5849
453 Ga0207702_10007341 3300026078 Bacteria 9416
454 Ga0207702_10007866 3300026078 Bacteria 9038
455 Ga0207702_10009078 3300026078 Bacteria 8367
456 Ga0207702_10077149 3300026078 Bacteria 2881
457 Ga0207702_10077668 3300026078 Bacteria 2872
458 Ga0207641_10000079 3300026088 Bacteria 141110
459 Ga0207641_10000103 3300026088 Bacteria 122350
460 Ga0207641_10002442 3300026088 Bacteria 17185
461 Ga0207641_10009618 3300026088 Bacteria 7967
462 Ga0207641_10017602 3300026088 Bacteria 5851
463 Ga0207641_10174726 3300026088 Bacteria 1963
464 Ga0207648_10000003 3300026089 Bacteria 289983
465 Ga0207648_10016583 3300026089 Bacteria 6725
466 Ga0207648_11637483 3300026089 Bacteria 605
467 Ga0207676_10000044 3300026095 Bacteria 161679
468 Ga0207676_10147037 3300026095 Bacteria 2025
469 Ga0207676_10198802 3300026095 Bacteria 1769
470 Ga0207674_10000319 3300026116 Bacteria 61196
471 Ga0207674_10069420 3300026116 Bacteria 3544
472 Ga0207674_10234835 3300026116 Bacteria 1781
473 Ga0207674_12187787 3300026116 Bacteria 516
474 Ga0207675_100051165 3300026118 Bacteria 3854
475 Ga0207683_10000075 3300026121 Bacteria 77829
476 Ga0207683_10004168 3300026121 Bacteria 12512
477 Ga0207683_10015350 3300026121 Bacteria 6523
478 Ga0207683_10233772 3300026121 Bacteria 1676
479 Ga0207683_10876324 3300026121 Bacteria 833
480 Ga0207683_11314041 3300026121 Bacteria 669
481 Ga0207698_10001449 3300026142 Bacteria 13790
482 Ga0207698_10006501 3300026142 Bacteria 7297
483 Ga0207698_10737960 3300026142 Bacteria 983
484 Ga0268266_10000015 3300028379 Bacteria 630629
485 Ga0268266_10378178 3300028379 Bacteria 1335
486 Ga0268266_11071695 3300028379 Bacteria 780
487 Ga0268265_10000125 3300028380 Bacteria 96710
488 Ga0268265_10000754 3300028380 Bacteria 31429
489 Ga0268264_10000347 3300028381 Bacteria 70884
490 Ga0268264_10100845 3300028381 Bacteria 2508
491 Ga0268264_10398544 3300028381 Bacteria 1322
492 Ga0268264_11215153 3300028381 Bacteria 763
493 Ga0307517_10107907 3300028786 Bacteria 2141
494 Ga0307513_10016361 3300031456 Bacteria 8948
495 Ga0307513_10026396 3300031456 Bacteria 6697
496 Ga0307408_100006783 3300031548 Bacteria 7590
497 Ga0307408_100006926 3300031548 Bacteria 7503
498 Ga0307405_10058399 3300031731 Bacteria 2427
499 Ga0307405_10073616 3300031731 Bacteria 2206
500 Ga0307413_10006988 3300031824 Bacteria 5203
501 Ga0307413_10052817 3300031824 Bacteria 2457
502 Ga0307413_10775505 3300031824 Bacteria 804
503 Ga0307410_10017150 3300031852 Bacteria 4339
504 Ga0307410_10064810 3300031852 Bacteria 2511
505 Ga0307406_10037403 3300031901 Bacteria 2997
506 Ga0307406_10065133 3300031901 Bacteria 2367
507 Ga0307407_10016684 3300031903 Bacteria 3662
508 Ga0307407_10110075 3300031903 Bacteria 1727
509 Ga0307412_10005086 3300031911 Bacteria 7355
510 Ga0307412_10017698 3300031911 Bacteria 4269
511 Ga0307412_11697139 3300031911 Bacteria 579
512 Ga0307409_100015440 3300031995 Bacteria 5014
513 Ga0307409_100102052 3300031995 Bacteria 2382
514 Ga0307416_100002628 3300032002 Bacteria 10389
515 Ga0307416_100611774 3300032002 Bacteria 1170
516 Ga0307416_103033277 3300032002 Bacteria 562
517 Ga0307414_10007367 3300032004 Bacteria 6181
518 Ga0307414_10354398 3300032004 Bacteria 1260
519 Ga0307411_10005662 3300032005 Bacteria 6165
520 Ga0307411_10009772 3300032005 Bacteria 5068
521 Ga0307415_100052521 3300032126 Bacteria 2772
522 Ga0307415_100100170 3300032126 Bacteria 2122
523 Ga0307415_100887935 3300032126 Bacteria 821
524 Ga0395899_0002738 3300037312 Bacteria 14208
525 Ga0395899_0067795 3300037312 Bacteria 2618
526 Ga0395900_0055176 3300037418 Bacteria 4091
527 Ga0395900_0337395 3300037418 Bacteria 1483
528 Ga0395900_0411067 3300037418 Bacteria 1315
529 Ga0395898_0637887 3300037466 Bacteria 1008
530 Ga0395905_0114530 3300037471 Bacteria 2533
531 Ga0395905_0215918 3300037471 Bacteria 1796
532 Ga0395905_0382755 3300037471 Bacteria 1301
533 Ga0436364_1302975 3300037853 Bacteria 1044
534 Ga0395901_0099192 3300038443 Bacteria 3054
535 Ga0395901_0309646 3300038443 Bacteria 1636
536 Ga0395901_0328606 3300038443 Bacteria 1581
537 Ga0395901_1927983 3300038443 Bacteria 538
538 Ga0237819_02653 3300038705 Bacteria 3496
539 Ga0237816_05045 3300039145 Bacteria 898
540 Ga0436365_0412715 3300039437 Bacteria 2429
541 Ga0439436_0016645 3300041404 Bacteria 2204
542 Ga0439439_0121155 3300041406 Bacteria 729
543 Ga0439461_0004626 3300041410 Bacteria 2306
544 Ga0439465_0006757 3300041413 Bacteria 3643
545 Ga0451793_0255256 3300041452 Bacteria 634
546 Ga0451853_2493251 3300041512 Bacteria 575
547 Ga0439431_0005179 3300041997 Bacteria 2874
548 Ga0439432_010633 3300042006 Bacteria 3183
549 Ga0439446_0064186 3300042156 Bacteria 1114
550 Ga0466966_0067597 3300044684 Bacteria 2244
551 Ga0466966_0319672 3300044684 Bacteria 933
552 Ga0466961_0040935 3300044693 Bacteria 2970
553 Ga0466961_0122674 3300044693 Bacteria 1631
554 Ga0466963_0058844 3300044694 Bacteria 2563
555 Ga0466963_0108707 3300044694 Bacteria 1902
556 Ga0466964_0099856 3300044706 Bacteria 1278
557 Ga0466971_0004979 3300044719 Bacteria 5746
558 Ga0466971_0199951 3300044719 Bacteria 943
559 Ga0466970_0103804 3300044765 Bacteria 1549
560 Ga0466970_0411923 3300044765 Bacteria 772
561 Ga0466957_0009863 3300044842 Bacteria 5461
562 Ga0466957_0128384 3300044842 Bacteria 1622
563 Ga0466957_0131074 3300044842 Bacteria 1606
564 Ga0466957_0169830 3300044842 Bacteria 1420
565 Ga0466959_0036850 3300045049 Bacteria 3613
566 Ga0466958_0022147 3300045836 Bacteria 3720
567 Ga0466958_0048182 3300045836 Bacteria 2574
568 Ga0466967_0003933 3300045976 Bacteria 9871
569 Ga0495617_125856 3300046452 Bacteria 824
570 Ga0495592_0786948 3300046454 Bacteria 566
571 Ga0495638_0309533 3300046460 Bacteria 848
572 Ga0495650_0000259 3300046471 Bacteria 102151
573 Ga0495650_0006744 3300046471 Bacteria 7102
574 Ga0495584_0005639 3300046491 Bacteria 6615
575 Ga0495584_0059190 3300046491 Bacteria 1927
576 Ga0495585_0009056 3300046492 Bacteria 5997
577 Ga0495596_0018840 3300046500 Bacteria 2842
578 Ga0495583_0033072 3300046506 Bacteria 2489
579 Ga0495583_0042526 3300046506 Bacteria 2121
580 Ga0495583_0122490 3300046506 Bacteria 1093
581 Ga0495606_0000029 3300046507 Bacteria 250473
582 Ga0495606_0066199 3300046507 Bacteria 2292
583 Ga0495616_0090193 3300046513 Bacteria 1453
584 Ga0495616_0183023 3300046513 Bacteria 930
585 Ga0495631_0009935 3300046518 Bacteria 4732
586 Ga0495631_0332613 3300046518 Bacteria 646
587 Ga0495637_0038137 3300046520 Bacteria 2082
588 Ga0495637_0135631 3300046520 Bacteria 937
589 Ga0495643_0000163 3300046522 Bacteria 106228
590 Ga0495643_0006968 3300046522 Bacteria 7349
591 Ga0495643_0007751 3300046522 Bacteria 6874
592 Ga0495643_0317560 3300046522 Bacteria 705
593 Ga0495648_0000291 3300046524 Bacteria 56777
594 Ga0495663_0000756 3300046525 Bacteria 11088
595 Ga0495642_0071207 3300046528 Bacteria 1454
596 Ga0495587_0468400 3300046536 Bacteria 697
597 Ga0495597_0097196 3300046542 Bacteria 1244
598 Ga0495622_0006792 3300046557 Bacteria 5309
599 Ga0495633_0002070 3300046558 Bacteria 14437
600 Ga0495633_0027359 3300046558 Bacteria 2788
601 Ga0495668_0000016 3300046616 Bacteria 438197
602 Ga0495668_0048602 3300046616 Bacteria 2353
603 Ga0495668_0146365 3300046616 Bacteria 1293
604 Ga0495611_0143960 3300046648 Bacteria 1113
605 Ga0495611_0558796 3300046648 Bacteria 518
606 Ga0495625_0000092 3300046660 Bacteria 146172
607 Ga0495625_0004356 3300046660 Bacteria 13449
608 Ga0495625_0010250 3300046660 Bacteria 7771
609 Ga0495625_0014866 3300046660 Bacteria 6191
610 Ga0495625_0054925 3300046660 Bacteria 2843
611 Ga0495661_0064241 3300046665 Bacteria 2167
612 Ga0495669_0000039 3300046684 Bacteria 92973
613 Ga0495669_0010231 3300046684 Bacteria 3962
614 Ga0495669_0022480 3300046684 Bacteria 2739
615 Ga0495669_0051827 3300046684 Bacteria 1842
616 Ga0495669_0059502 3300046684 Bacteria 1725
617 Ga0495670_0000015 3300046691 Bacteria 131137
618 Ga0495670_0221147 3300046691 Bacteria 1006
619 Ga0495670_0720909 3300046691 Bacteria 544
620 Ga0495649_0058382 3300046694 Bacteria 2079
621 Ga0495600_0024882 3300046809 Bacteria 3854
622 Ga0495600_0110165 3300046809 Bacteria 1792
623 Ga0495660_0196273 3300046810 Bacteria 966
624 Ga0495636_0235789 3300047318 Bacteria 843
625 Ga0495683_0000947 3300047323 Bacteria 20420
626 Ga0495683_0047570 3300047323 Bacteria 2152
627 Ga0495683_0271664 3300047323 Bacteria 737
628 Ga0495687_000098 3300047443 Bacteria 132403
629 Ga0495687_000471 3300047443 Bacteria 48815
630 Ga0495677_0002246 3300047445 Bacteria 7635
631 Ga0495677_0013510 3300047445 Bacteria 2973
632 Ga0495677_0018391 3300047445 Bacteria 2533
633 Ga0495685_138427 3300047447 Bacteria 794
634 Ga0495681_0007945 3300047470 Bacteria 6700
635 Ga0495681_0153535 3300047470 Bacteria 964
636 Ga0495686_0000486 3300047472 Bacteria 58640
637 Ga0495686_0040153 3300047472 Bacteria 2986
638 Ga0496100_0464024 3300048903 Bacteria 972
639 Ga0496100_0562510 3300048903 Bacteria 883
640 Ga0496101_0464135 3300048904 Bacteria 999
641 Ga0496102_0000961 3300048905 Bacteria 27087
642 Ga0496102_0634626 3300048905 Bacteria 991
643 Ga0496103_0000145 3300048906 Bacteria 74388
644 Ga0496103_0085761 3300048906 Bacteria 1984
645 Ga0496103_0299526 3300048906 Bacteria 1034
646 Ga0496104_0003941 3300048907 Bacteria 12844
647 Ga0496105_0000218 3300048908 Bacteria 38487
648 Ga0496107_0185584 3300048910 Bacteria 1545
649 Ga0496108_0006377 3300048911 Bacteria 9561
650 Ga0496109_0043625 3300048912 Bacteria 4066
651 Ga0496110_0007061 3300048913 Bacteria 8937
652 Ga0496111_0003030 3300048914 Bacteria 10300
653 Ga0496112_0043596 3300048915 Bacteria 4392
654 Ga0496113_0006174 3300048916 Bacteria 7564
655 Ga0496113_0753739 3300048916 Bacteria 775
656 Ga0496114_0026742 3300048917 Bacteria 4726
657 Ga0496115_0000195 3300048918 Bacteria 56609
658 Ga0496115_0001359 3300048918 Bacteria 17461
659 Ga0496116_0010920 3300048919 Bacteria 7566
660 Ga0496117_0000910 3300048920 Bacteria 45331
661 Ga0496117_0003090 3300048920 Bacteria 19927
662 Ga0496117_0151533 3300048920 Bacteria 1372
663 Ga0496118_0000091 3300048921 Bacteria 173092
664 Ga0496118_0000339 3300048921 Bacteria 80008
665 Ga0496119_0010325 3300048922 Bacteria 7869
666 Ga0496120_0059756 3300048923 Bacteria 2135
667 Ga0496120_0074129 3300048923 Bacteria 1860
668 Ga0496121_0000105 3300048924 Bacteria 191437
669 Ga0496121_0000429 3300048924 Bacteria 82577
670 Ga0496121_0003357 3300048924 Bacteria 22967
671 Ga0496121_0014603 3300048924 Bacteria 8313
672 Ga0496121_0330273 3300048924 Bacteria 1023
673 Ga0496122_0128770 3300048925 Bacteria 1614
674 Ga0496122_0219332 3300048925 Bacteria 1093
675 Ga0496123_0042673 3300048926 Bacteria 3127
676 Ga0496123_0070886 3300048926 Bacteria 2178
677 Ga0496123_0170339 3300048926 Bacteria 1149
678 Ga0496123_0292996 3300048926 Bacteria 780
679 Ga0496124_0000129 3300048927 Bacteria 156648
680 Ga0496124_0000375 3300048927 Bacteria 81352
681 Ga0496124_0018814 3300048927 Bacteria 6452
682 Ga0496124_0050792 3300048927 Bacteria 3531
683 Ga0496124_0178404 3300048927 Bacteria 1637
684 Ga0496124_0380187 3300048927 Bacteria 988
685 Ga0496125_0052345 3300048928 Bacteria 3357
686 Ga0496126_0000443 3300048929 Bacteria 82811
687 Ga0496126_0010422 3300048929 Bacteria 9742
688 Ga0496126_0038558 3300048929 Bacteria 4445
689 Ga0495682_0374199 3300049460 Bacteria 502
690 Ga0501070_0636980 3300049586 Bacteria 847
691 nmdc:mga0sz30_48265_c1 3300050516 Bacteria 1801
692 Ga0500610_0000063 3300053079 Bacteria 33821
693 Ga0500643_000466 3300053087 Bacteria 29832
694 Ga0500643_001269 3300053087 Bacteria 14922
695 Ga0500643_018551 3300053087 Bacteria 2307
696 Ga0500647_0117418 3300053091 Bacteria 1261
697 Ga0500641_0006923 3300053096 Bacteria 4033
698 Ga0500556_0231231 3300053104 Bacteria 729
699 Ga0500562_046930 3300053108 Bacteria 1152
700 Ga0500562_071691 3300053108 Bacteria 935
701 Ga0500595_000475 3300053119 Bacteria 24774
702 Ga0500597_001091 3300053120 Bacteria 6523
703 Ga0500607_155702 3300053121 Bacteria 1052
704 Ga0500642_0004242 3300053130 Bacteria 4456
705 Ga0500658_0019033 3300053134 Bacteria 2580
706 Ga0500585_150412 3300053144 Bacteria 813
707 Ga0500588_0037695 3300053146 Bacteria 1437
708 Ga0500616_0017435 3300053153 Bacteria 4073
709 Ga0500619_083722 3300053154 Bacteria 1073
710 Ga0500624_000023 3300053157 Bacteria 114997
711 Ga0500627_0170718 3300053158 Bacteria 980
712 Ga0500636_0000462 3300053177 Bacteria 22121
713 Ga0500637_0000013 3300053178 Bacteria 73168
714 Ga0500645_000002 3300053730 Bacteria 388892
715 Ga0500645_031256 3300053730 Bacteria 1600
716 Ga0500609_015863 3300053731 Bacteria 1021
717 Ga0500596_000052 3300053735 Bacteria 15694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10729352 Ga0070681_107293522 98
2 3300005347 Ga0070668_100022772 Ga0070668_1000227724 116
3 3300025972 Ga0207668_10124865 Ga0207668_101248652 116
4 3300044694 Ga0466963_0108707 Ga0466963_0108707_1302_1718 116
5 3300044765 Ga0466970_0103804 Ga0466970_0103804_486_920 116
6 3300005328 Ga0070676_10004634 Ga0070676_100046342 117
7 3300005347 Ga0070668_100000906 Ga0070668_10000090612 117
8 3300005353 Ga0070669_100009672 Ga0070669_10000967210 117
9 3300005354 Ga0070675_100364353 Ga0070675_1003643533 117
10 3300005364 Ga0070673_100256013 Ga0070673_1002560133 117
11 3300005367 Ga0070667_100002416 Ga0070667_10000241615 117
12 3300005459 Ga0068867_100004940 Ga0068867_1000049408 117
13 3300005617 Ga0068859_100237719 Ga0068859_1002377192 117
14 3300005618 Ga0068864_100000016 Ga0068864_100000016132 117
15 3300005841 Ga0068863_100000089 Ga0068863_10000008913 117
16 3300005844 Ga0068862_100000068 Ga0068862_100000068131 117
17 3300006931 Ga0097620_100237718 Ga0097620_1002377182 117
18 3300009011 Ga0105251_10001932 Ga0105251_1000193213 117
19 3300009148 Ga0105243_10546149 Ga0105243_105461492 117
20 3300025315 Ga0207697_10126939 Ga0207697_101269392 117
21 3300025907 Ga0207645_10015318 Ga0207645_100153186 117
22 3300025923 Ga0207681_10008042 Ga0207681_100080422 117
23 3300025925 Ga0207650_10000069 Ga0207650_1000006962 117
24 3300025926 Ga0207659_10240661 Ga0207659_102406612 117
25 3300025937 Ga0207669_10037347 Ga0207669_100373474 117
26 3300025938 Ga0207704_10051567 Ga0207704_100515673 117
27 3300025940 Ga0207691_10134528 Ga0207691_101345283 117
28 3300025942 Ga0207689_10083820 Ga0207689_100838203 117
29 3300025960 Ga0207651_10061183 Ga0207651_100611832 117
30 3300025972 Ga0207668_10000062 Ga0207668_1000006257 117
31 3300025986 Ga0207658_10000153 Ga0207658_1000015374 117
32 3300025986 Ga0207658_10124004 Ga0207658_101240043 117
33 3300026088 Ga0207641_10000103 Ga0207641_10000103120 117
34 3300026089 Ga0207648_10016583 Ga0207648_100165836 117
35 3300026095 Ga0207676_10000044 Ga0207676_10000044120 117
36 3300026118 Ga0207675_100051165 Ga0207675_1000511653 117
37 3300026121 Ga0207683_10876324 Ga0207683_108763242 117
38 3300028380 Ga0268265_10000754 Ga0268265_1000075421 117
39 3300048906 Ga0496103_0085761 Ga0496103_0085761_685_1095 117
40 3300048920 Ga0496117_0003090 Ga0496117_0003090_6209_6619 117
41 3300048921 Ga0496118_0000339 Ga0496118_0000339_5363_5773 117
42 3300005563 Ga0068855_101844867 Ga0068855_1018448671 118
43 3300005617 Ga0068859_100012317 Ga0068859_1000123176 118
44 3300006931 Ga0097620_100012317 Ga0097620_1000123176 118
45 3300009101 Ga0105247_10015646 Ga0105247_100156462 118
46 3300009177 Ga0105248_10000021 Ga0105248_1000002195 118
47 3300009177 Ga0105248_10002393 Ga0105248_100023938 118
48 3300009553 Ga0105249_11992838 Ga0105249_119928382 118
49 3300025900 Ga0207710_10082022 Ga0207710_100820222 118
50 3300025941 Ga0207711_10000025 Ga0207711_10000025201 118
51 3300025949 Ga0207667_10104027 Ga0207667_101040272 118
52 3300025949 Ga0207667_10436746 Ga0207667_104367462 118
53 3300025961 Ga0207712_11452804 Ga0207712_114528042 118
54 3300026078 Ga0207702_10077149 Ga0207702_100771494 118
55 3300037418 Ga0395900_0055176 Ga0395900_0055176_102_512 118
56 3300037418 Ga0395900_0337395 Ga0395900_0337395_717_1130 118
57 3300038443 Ga0395901_1927983 Ga0395901_1927983_96_506 118
58 3300038705 Ga0237819_02653 Ga0237819_02653_1601_2017 118
59 3300039145 Ga0237816_05045 Ga0237816_05045_30_446 118
60 3300048904 Ga0496101_0464135 Ga0496101_0464135_394_804 118
61 3300053096 Ga0500641_0006923 Ga0500641_0006923_2050_2463 118
62 3300005344 Ga0070661_100000130 Ga0070661_10000013045 119
63 3300009553 Ga0105249_10001264 Ga0105249_1000126425 119
64 3300014968 Ga0157379_10151556 Ga0157379_101515562 119
65 3300025920 Ga0207649_10000134 Ga0207649_1000013432 119
66 3300025961 Ga0207712_10001388 Ga0207712_1000138819 119
67 3300053087 Ga0500643_000466 Ga0500643_000466_11298_11714 119
68 3300053087 Ga0500643_001269 Ga0500643_001269_13764_14180 119
69 3300005329 Ga0070683_100384779 Ga0070683_1003847792 120
70 3300005336 Ga0070680_100169757 Ga0070680_1001697572 120
71 3300005458 Ga0070681_10107967 Ga0070681_101079673 120
72 3300005530 Ga0070679_100637845 Ga0070679_1006378451 120
73 3300005539 Ga0068853_100038814 Ga0068853_1000388143 120
74 3300005563 Ga0068855_100000333 Ga0068855_10000033354 120
75 3300005564 Ga0070664_100514718 Ga0070664_1005147182 120
76 3300005614 Ga0068856_100013110 Ga0068856_1000131108 120
77 3300006881 Ga0068865_100803238 Ga0068865_1008032382 120
78 3300009093 Ga0105240_10282098 Ga0105240_102820983 120
79 3300009101 Ga0105247_10106888 Ga0105247_101068882 120
80 3300009174 Ga0105241_10130977 Ga0105241_101309772 120
81 3300009545 Ga0105237_11523622 Ga0105237_115236221 120
82 3300009553 Ga0105249_10288452 Ga0105249_102884522 120
83 3300025912 Ga0207707_10286433 Ga0207707_102864333 120
84 3300025913 Ga0207695_10015444 Ga0207695_100154446 120
85 3300025919 Ga0207657_10263111 Ga0207657_102631111 120
86 3300025921 Ga0207652_10493523 Ga0207652_104935232 120
87 3300025938 Ga0207704_10894299 Ga0207704_108942992 120
88 3300025938 Ga0207704_11304893 Ga0207704_113048931 120
89 3300025945 Ga0207679_10240411 Ga0207679_102404112 120
90 3300025949 Ga0207667_10002977 Ga0207667_100029773 120
91 3300025961 Ga0207712_10412158 Ga0207712_104121582 120
92 3300026023 Ga0207677_10088000 Ga0207677_100880002 120
93 3300026041 Ga0207639_10039093 Ga0207639_100390934 120
94 3300026078 Ga0207702_10007866 Ga0207702_100078665 120
95 3300026121 Ga0207683_11314041 Ga0207683_113140412 120
96 3300044684 Ga0466966_0319672 Ga0466966_0319672_466_879 120
97 3300044693 Ga0466961_0122674 Ga0466961_0122674_1051_1464 120
98 3300044694 Ga0466963_0058844 Ga0466963_0058844_249_662 120
99 3300044706 Ga0466964_0099856 Ga0466964_0099856_66_479 120
100 3300044719 Ga0466971_0004979 Ga0466971_0004979_65_478 120
101 3300044842 Ga0466957_0009863 Ga0466957_0009863_84_497 120
102 3300045836 Ga0466958_0048182 Ga0466958_0048182_1140_1553 120
103 3300045976 Ga0466967_0003933 Ga0466967_0003933_3953_4366 120
104 3300046522 Ga0495643_0000163 Ga0495643_0000163_99149_99568 120
105 3300046616 Ga0495668_0146365 Ga0495668_0146365_300_719 120
106 3300053153 Ga0500616_0017435 Ga0500616_0017435_2554_2964 120
107 3300005345 Ga0070692_10001368 Ga0070692_100013683 121
108 3300005345 Ga0070692_10061516 Ga0070692_100615162 121
109 3300005578 Ga0068854_101001322 Ga0068854_1010013222 121
110 3300025981 Ga0207640_10045007 Ga0207640_100450074 121
111 3300041404 Ga0439436_0016645 Ga0439436_0016645_224_625 121
112 3300041406 Ga0439439_0121155 Ga0439439_0121155_241_642 121
113 3300041410 Ga0439461_0004626 Ga0439461_0004626_600_1001 121
114 3300041413 Ga0439465_0006757 Ga0439465_0006757_321_722 121
115 3300041997 Ga0439431_0005179 Ga0439431_0005179_1276_1677 121
116 3300042006 Ga0439432_010633 Ga0439432_010633_71_472 121
117 3300042156 Ga0439446_0064186 Ga0439446_0064186_600_1001 121
118 3300044842 Ga0466957_0131074 Ga0466957_0131074_195_605 121
119 3300046491 Ga0495584_0059190 Ga0495584_0059190_685_1104 121
120 3300046492 Ga0495585_0009056 Ga0495585_0009056_4733_5152 121
121 3300046506 Ga0495583_0122490 Ga0495583_0122490_559_978 121
122 3300046513 Ga0495616_0090193 Ga0495616_0090193_479_898 121
123 3300046528 Ga0495642_0071207 Ga0495642_0071207_138_557 121
124 3300046616 Ga0495668_0000016 Ga0495668_0000016_164192_164611 121
125 3300047443 Ga0495687_000471 Ga0495687_000471_26068_26487 121
126 3300047445 Ga0495677_0002246 Ga0495677_0002246_3521_3940 121
127 3300047470 Ga0495681_0153535 Ga0495681_0153535_501_902 121
128 3300053087 Ga0500643_018551 Ga0500643_018551_135_536 121
129 3300053134 Ga0500658_0019033 Ga0500658_0019033_449_850 121
130 3300000043 ARcpr5yngRDRAFT_c009262 ARcpr5yngRDRAFT_0092622 122
131 3300003215 JGI25153J46596_10045061 JGI25153J46596_100450612 122
132 3300005262 Ga0065165_1013615 Ga0065165_10136153 122
133 3300005578 Ga0068854_100119227 Ga0068854_1001192273 122
134 3300009093 Ga0105240_10004046 Ga0105240_1000404613 122
135 3300009093 Ga0105240_10051063 Ga0105240_100510635 122
136 3300009148 Ga0105243_10619836 Ga0105243_106198361 122
137 3300009551 Ga0105238_10080044 Ga0105238_100800443 122
138 3300010375 Ga0105239_10000546 Ga0105239_1000054613 122
139 3300013100 Ga0157373_10086011 Ga0157373_100860111 122
140 3300025245 Ga0207425_1008078 Ga0207425_10080783 122
141 3300025297 Ga0209758_1018028 Ga0209758_10180282 122
142 3300025302 Ga0207426_1111532 Ga0207426_11115322 122
143 3300025913 Ga0207695_10003844 Ga0207695_1000384414 122
144 3300025913 Ga0207695_10091255 Ga0207695_100912556 122
145 3300025981 Ga0207640_10064358 Ga0207640_100643582 122
146 3300048920 Ga0496117_0151533 Ga0496117_0151533_529_942 122
147 3300048924 Ga0496121_0003357 Ga0496121_0003357_10026_10439 122
148 3300048929 Ga0496126_0010422 Ga0496126_0010422_8266_8679 122
149 3300003759 Ga0055525_1000012 Ga0055525_1000012177 123
150 3300025230 Ga0209563_100030 Ga0209563_100030271 123
151 3300039437 Ga0436365_0412715 Ga0436365_0412715_1019_1420 123
152 3300053108 Ga0500562_046930 Ga0500562_046930_657_1058 123
153 3300005841 Ga0068863_101829075 Ga0068863_1018290752 124
154 3300009148 Ga0105243_10073758 Ga0105243_100737582 124
155 3300046684 Ga0495669_0022480 Ga0495669_0022480_1877_2287 124
156 3300046684 Ga0495669_0051827 Ga0495669_0051827_1169_1579 124
157 3300046691 Ga0495670_0000015 Ga0495670_0000015_62923_63336 124
158 3300053108 Ga0500562_071691 Ga0500562_071691_454_867 124
159 3300053158 Ga0500627_0170718 Ga0500627_0170718_530_943 124
160 3300005331 Ga0070670_100025648 Ga0070670_1000256483 125
161 3300005366 Ga0070659_100048117 Ga0070659_1000481172 125
162 3300005366 Ga0070659_100427247 Ga0070659_1004272472 125
163 3300005577 Ga0068857_100004444 Ga0068857_10000444413 125
164 3300005618 Ga0068864_100380181 Ga0068864_1003801813 125
165 3300005841 Ga0068863_100058002 Ga0068863_1000580024 125
166 3300011119 Ga0105246_10054421 Ga0105246_100544213 125
167 3300013102 Ga0157371_10054006 Ga0157371_100540064 125
168 3300013102 Ga0157371_10514372 Ga0157371_105143722 125
169 3300014325 Ga0163163_10067172 Ga0163163_100671724 125
170 3300025901 Ga0207688_10274284 Ga0207688_102742842 125
171 3300025904 Ga0207647_10011528 Ga0207647_100115283 125
172 3300025925 Ga0207650_10050776 Ga0207650_100507762 125
173 3300025932 Ga0207690_10063454 Ga0207690_100634542 125
174 3300025932 Ga0207690_10420538 Ga0207690_104205382 125
175 3300025935 Ga0207709_11099301 Ga0207709_110993011 125
176 3300026088 Ga0207641_10017602 Ga0207641_100176022 125
177 3300026095 Ga0207676_10147037 Ga0207676_101470372 125
178 3300026116 Ga0207674_10000319 Ga0207674_1000031943 125
179 3300032126 Ga0307415_100887935 Ga0307415_1008879352 125
180 3300037418 Ga0395900_0411067 Ga0395900_0411067_61_471 125
181 3300037471 Ga0395905_0114530 Ga0395905_0114530_331_741 125
182 3300038443 Ga0395901_0099192 Ga0395901_0099192_1923_2333 125
183 3300046522 Ga0495643_0317560 Ga0495643_0317560_71_481 125
184 3300053144 Ga0500585_150412 Ga0500585_150412_281_700 125
185 3300005262 Ga0065165_1002705 Ga0065165_10027051 126
186 3300005328 Ga0070676_10009924 Ga0070676_100099245 126
187 3300005334 Ga0068869_100000467 Ga0068869_10000046719 126
188 3300005338 Ga0068868_100000092 Ga0068868_10000009219 126
189 3300005364 Ga0070673_100000009 Ga0070673_10000000980 126
190 3300005459 Ga0068867_100000002 Ga0068867_100000002209 126
191 3300005543 Ga0070672_100022207 Ga0070672_1000222075 126
192 3300005548 Ga0070665_100518185 Ga0070665_1005181852 126
193 3300006881 Ga0068865_100000014 Ga0068865_10000001463 126
194 3300025927 Ga0207687_10000252 Ga0207687_100002528 126
195 3300025934 Ga0207686_10001911 Ga0207686_100019115 126
196 3300025935 Ga0207709_10000066 Ga0207709_1000006658 126
197 3300025938 Ga0207704_10000002 Ga0207704_10000002140 126
198 3300025938 Ga0207704_10000007 Ga0207704_10000007140 126
199 3300025940 Ga0207691_10233886 Ga0207691_102338862 126
200 3300025942 Ga0207689_10000060 Ga0207689_100000607 126
201 3300025960 Ga0207651_10000004 Ga0207651_10000004209 126
202 3300026023 Ga0207677_10000060 Ga0207677_1000006078 126
203 3300026023 Ga0207677_11225198 Ga0207677_112251982 126
204 3300026089 Ga0207648_10000003 Ga0207648_1000000380 126
205 3300026116 Ga0207674_12187787 Ga0207674_121877871 126
206 3300028379 Ga0268266_11071695 Ga0268266_110716952 126
207 3300046616 Ga0495668_0048602 Ga0495668_0048602_744_1154 126
208 3300046660 Ga0495625_0054925 Ga0495625_0054925_1425_1835 126
209 3300046684 Ga0495669_0010231 Ga0495669_0010231_812_1222 126
210 3300046684 Ga0495669_0059502 Ga0495669_0059502_448_858 126
211 3300047323 Ga0495683_0271664 Ga0495683_0271664_116_526 126
212 3300047445 Ga0495677_0018391 Ga0495677_0018391_1475_1885 126
213 3300047447 Ga0495685_138427 Ga0495685_138427_49_459 126
214 3300048910 Ga0496107_0185584 Ga0496107_0185584_55_465 126
215 3300005353 Ga0070669_100409854 Ga0070669_1004098542 127
216 3300005543 Ga0070672_100299934 Ga0070672_1002999342 127
217 3300005834 Ga0068851_10438833 Ga0068851_104388332 127
218 3300006948 Ga0099826_10111731 Ga0099826_101117312 127
219 3300025904 Ga0207647_10144287 Ga0207647_101442871 127
220 3300025932 Ga0207690_10243567 Ga0207690_102435672 127
221 3300025940 Ga0207691_10290423 Ga0207691_102904232 127
222 3300026121 Ga0207683_10004168 Ga0207683_100041683 127
223 3300028786 Ga0307517_10107907 Ga0307517_101079073 127
224 3300025253 Ga0209677_117223 Ga0209677_1172232 128
225 3300041512 Ga0451853_2493251 Ga0451853_2493251_66_485 128
226 3300046809 Ga0495600_0024882 Ga0495600_0024882_591_1010 128
227 iso_pu_bacteria 2885429604 2885431565 128
228 3300005339 Ga0070660_100056773 Ga0070660_1000567731 129
229 3300005356 Ga0070674_100714248 Ga0070674_1007142481 129
230 3300005578 Ga0068854_100025690 Ga0068854_1000256903 129
231 3300005985 Ga0081539_10007074 Ga0081539_1000707410 129
232 3300009098 Ga0105245_10001236 Ga0105245_1000123613 129
233 3300009148 Ga0105243_10000070 Ga0105243_1000007042 129
234 3300009176 Ga0105242_10000273 Ga0105242_1000027311 129
235 3300009551 Ga0105238_10118232 Ga0105238_101182322 129
236 3300009551 Ga0105238_10558728 Ga0105238_105587282 129
237 3300010375 Ga0105239_10038762 Ga0105239_100387625 129
238 3300010375 Ga0105239_11258994 Ga0105239_112589941 129
239 3300011119 Ga0105246_10002662 Ga0105246_100026625 129
240 3300013100 Ga0157373_10043654 Ga0157373_100436542 129
241 3300013296 Ga0157374_10000831 Ga0157374_100008318 129
242 3300013296 Ga0157374_10041788 Ga0157374_100417885 129
243 3300013297 Ga0157378_10000944 Ga0157378_1000094418 129
244 3300013307 Ga0157372_10286207 Ga0157372_102862072 129
245 3300013308 Ga0157375_10002997 Ga0157375_100029974 129
246 3300014325 Ga0163163_12888084 Ga0163163_128880841 129
247 3300014745 Ga0157377_10026133 Ga0157377_100261332 129
248 3300014969 Ga0157376_10000186 Ga0157376_1000018642 129
249 3300017792 Ga0163161_10261965 Ga0163161_102619652 129
250 3300025919 Ga0207657_10016697 Ga0207657_100166977 129
251 3300025921 Ga0207652_11278017 Ga0207652_112780172 129
252 3300025937 Ga0207669_10031379 Ga0207669_100313792 129
253 3300025981 Ga0207640_10006873 Ga0207640_100068736 129
254 3300037471 Ga0395905_0215918 Ga0395905_0215918_1188_1577 129
255 3300044684 Ga0466966_0067597 Ga0466966_0067597_1715_2104 129
256 3300044693 Ga0466961_0040935 Ga0466961_0040935_2152_2541 129
257 3300045049 Ga0466959_0036850 Ga0466959_0036850_2100_2489 129
258 3300045836 Ga0466958_0022147 Ga0466958_0022147_3304_3693 129
259 3300048916 Ga0496113_0753739 Ga0496113_0753739_192_581 129
260 3300048924 Ga0496121_0330273 Ga0496121_0330273_516_905 129
261 iso_pu_bacteria 2599185359 2600228610 129
262 iso_pu_bacteria 2643221622 2644125898 129
263 iso_pu_bacteria 2818991466 2819714579 129
264 iso_pu_bacteria 2879163058 2879165613 129
265 iso_pu_bacteria 2886627955 2886633996 129
266 iso_pu_bacteria 2928526807 2928529082 129
267 iso_pu_bacteria 2928968154 2928968599 129
268 iso_pu_bacteria 8057101203 8057102116 129
269 3300001989 JGI24739J22299_10024914 JGI24739J22299_100249141 130
270 3300002077 JGI24744J21845_10002683 JGI24744J21845_100026834 130
271 3300005328 Ga0070676_10770078 Ga0070676_107700781 130
272 3300005539 Ga0068853_100550260 Ga0068853_1005502601 130
273 3300006881 Ga0068865_100195482 Ga0068865_1001954822 130
274 3300009098 Ga0105245_11816733 Ga0105245_118167332 130
275 3300025901 Ga0207688_10024275 Ga0207688_100242754 130
276 3300025907 Ga0207645_10664613 Ga0207645_106646131 130
277 3300053120 Ga0500597_001091 Ga0500597_001091_501_908 130
278 3300053157 Ga0500624_000023 Ga0500624_000023_30288_30695 130
279 3300053178 Ga0500637_0000013 Ga0500637_0000013_57726_58133 130
280 3300005458 Ga0070681_10587461 Ga0070681_105874612 131
281 3300005459 Ga0068867_101384863 Ga0068867_1013848632 131
282 3300005546 Ga0070696_100006792 Ga0070696_1000067927 131
283 3300013100 Ga0157373_10083098 Ga0157373_100830982 131
284 3300025907 Ga0207645_10025433 Ga0207645_100254332 131
285 3300025912 Ga0207707_10130828 Ga0207707_101308284 131
286 3300025981 Ga0207640_10213160 Ga0207640_102131603 131
287 3300026089 Ga0207648_11637483 Ga0207648_116374831 131
288 3300001990 JGI24737J22298_10000315 JGI24737J22298_100003156 132
289 3300001990 JGI24737J22298_10034423 JGI24737J22298_100344231 132
290 3300002067 JGI24735J21928_10005077 JGI24735J21928_100050772 132
291 3300002067 JGI24735J21928_10021864 JGI24735J21928_100218641 132
292 3300002067 JGI24735J21928_10051185 JGI24735J21928_100511852 132
293 3300002075 JGI24738J21930_10002201 JGI24738J21930_100022015 132
294 3300002075 JGI24738J21930_10041608 JGI24738J21930_100416082 132
295 3300003214 JGI25165J46597_1000040 JGI25165J46597_1000040127 132
296 3300003320 rootH2_10005041 rootH2_100050411 132
297 3300005290 Ga0065712_10075190 Ga0065712_100751902 132
298 3300005293 Ga0065715_10132303 Ga0065715_101323031 132
299 3300005327 Ga0070658_10000022 Ga0070658_1000002265 132
300 3300005327 Ga0070658_10005125 Ga0070658_100051257 132
301 3300005327 Ga0070658_11054536 Ga0070658_110545361 132
302 3300005328 Ga0070676_11104862 Ga0070676_111048621 132
303 3300005329 Ga0070683_100920270 Ga0070683_1009202701 132
304 3300005331 Ga0070670_100011899 Ga0070670_1000118996 132
305 3300005331 Ga0070670_100234775 Ga0070670_1002347752 132
306 3300005333 Ga0070677_10085291 Ga0070677_100852912 132
307 3300005335 Ga0070666_10054920 Ga0070666_100549203 132
308 3300005335 Ga0070666_10062800 Ga0070666_100628002 132
309 3300005339 Ga0070660_100000751 Ga0070660_1000007511 132
310 3300005339 Ga0070660_100003262 Ga0070660_1000032626 132
311 3300005339 Ga0070660_100357805 Ga0070660_1003578052 132
312 3300005339 Ga0070660_100541547 Ga0070660_1005415472 132
313 3300005344 Ga0070661_100033253 Ga0070661_1000332533 132
314 3300005344 Ga0070661_100164048 Ga0070661_1001640483 132
315 3300005347 Ga0070668_100029073 Ga0070668_1000290733 132
316 3300005353 Ga0070669_100107486 Ga0070669_1001074862 132
317 3300005354 Ga0070675_100095820 Ga0070675_1000958203 132
318 3300005354 Ga0070675_100151839 Ga0070675_1001518393 132
319 3300005355 Ga0070671_100020082 Ga0070671_1000200823 132
320 3300005364 Ga0070673_100005666 Ga0070673_1000056664 132
321 3300005366 Ga0070659_100149520 Ga0070659_1001495201 132
322 3300005366 Ga0070659_100452625 Ga0070659_1004526252 132
323 3300005366 Ga0070659_102158394 Ga0070659_1021583941 132
324 3300005367 Ga0070667_100000641 Ga0070667_10000064128 132
325 3300005367 Ga0070667_100018960 Ga0070667_1000189605 132
326 3300005367 Ga0070667_100203038 Ga0070667_1002030384 132
327 3300005367 Ga0070667_100603514 Ga0070667_1006035142 132
328 3300005455 Ga0070663_100086230 Ga0070663_1000862303 132
329 3300005455 Ga0070663_101402580 Ga0070663_1014025801 132
330 3300005456 Ga0070678_100009721 Ga0070678_1000097214 132
331 3300005457 Ga0070662_100010272 Ga0070662_1000102727 132
332 3300005457 Ga0070662_100010751 Ga0070662_1000107517 132
333 3300005457 Ga0070662_100098202 Ga0070662_1000982023 132
334 3300005457 Ga0070662_100480689 Ga0070662_1004806891 132
335 3300005458 Ga0070681_10015840 Ga0070681_1001584010 132
336 3300005530 Ga0070679_100000021 Ga0070679_10000002128 132
337 3300005535 Ga0070684_101007723 Ga0070684_1010077232 132
338 3300005539 Ga0068853_100114747 Ga0068853_1001147473 132
339 3300005539 Ga0068853_100144186 Ga0068853_1001441862 132
340 3300005543 Ga0070672_100008045 Ga0070672_1000080458 132
341 3300005548 Ga0070665_100084334 Ga0070665_1000843345 132
342 3300005563 Ga0068855_100001164 Ga0068855_1000011647 132
343 3300005563 Ga0068855_100049033 Ga0068855_1000490334 132
344 3300005563 Ga0068855_100899917 Ga0068855_1008999172 132
345 3300005564 Ga0070664_100008107 Ga0070664_1000081075 132
346 3300005564 Ga0070664_100272568 Ga0070664_1002725682 132
347 3300005578 Ga0068854_100000380 Ga0068854_10000038026 132
348 3300005578 Ga0068854_100241662 Ga0068854_1002416622 132
349 3300005614 Ga0068856_100031423 Ga0068856_1000314232 132
350 3300005616 Ga0068852_100001302 Ga0068852_1000013028 132
351 3300005617 Ga0068859_100160863 Ga0068859_1001608632 132
352 3300005617 Ga0068859_100622361 Ga0068859_1006223612 132
353 3300005617 Ga0068859_100726087 Ga0068859_1007260872 132
354 3300005618 Ga0068864_100399098 Ga0068864_1003990983 132
355 3300005841 Ga0068863_100000047 Ga0068863_100000047100 132
356 3300005841 Ga0068863_100003668 Ga0068863_1000036686 132
357 3300005841 Ga0068863_100008189 Ga0068863_1000081897 132
358 3300005841 Ga0068863_100119831 Ga0068863_1001198314 132
359 3300005842 Ga0068858_100008945 Ga0068858_1000089459 132
360 3300005843 Ga0068860_100001603 Ga0068860_1000016037 132
361 3300005843 Ga0068860_100148772 Ga0068860_1001487723 132
362 3300005843 Ga0068860_100315051 Ga0068860_1003150512 132
363 3300005844 Ga0068862_100000986 Ga0068862_10000098621 132
364 3300006237 Ga0097621_100021424 Ga0097621_1000214244 132
365 3300006358 Ga0068871_100004655 Ga0068871_1000046559 132
366 3300006358 Ga0068871_100285428 Ga0068871_1002854282 132
367 3300006881 Ga0068865_100459451 Ga0068865_1004594512 132
368 3300006931 Ga0097620_100160860 Ga0097620_1001608602 132
369 3300006931 Ga0097620_100622359 Ga0097620_1006223592 132
370 3300006931 Ga0097620_100726105 Ga0097620_1007261052 132
371 3300009093 Ga0105240_10038634 Ga0105240_100386343 132
372 3300009101 Ga0105247_10000985 Ga0105247_1000098513 132
373 3300009177 Ga0105248_10018071 Ga0105248_100180714 132
374 3300009545 Ga0105237_10004611 Ga0105237_1000461117 132
375 3300009545 Ga0105237_10078880 Ga0105237_100788803 132
376 3300009553 Ga0105249_10000017 Ga0105249_10000017100 132
377 3300009553 Ga0105249_10001584 Ga0105249_100015845 132
378 3300009553 Ga0105249_12757113 Ga0105249_127571132 132
379 3300009553 Ga0105249_13212122 Ga0105249_132121222 132
380 3300013102 Ga0157371_10073640 Ga0157371_100736402 132
381 3300013102 Ga0157371_10554301 Ga0157371_105543012 132
382 3300013102 Ga0157371_10863917 Ga0157371_108639171 132
383 3300013104 Ga0157370_10000117 Ga0157370_1000011791 132
384 3300013104 Ga0157370_10853360 Ga0157370_108533602 132
385 3300013105 Ga0157369_10030477 Ga0157369_100304775 132
386 3300013296 Ga0157374_10005135 Ga0157374_100051354 132
387 3300013306 Ga0163162_10011469 Ga0163162_100114694 132
388 3300013307 Ga0157372_10182260 Ga0157372_101822602 132
389 3300013307 Ga0157372_10275339 Ga0157372_102753391 132
390 3300013307 Ga0157372_10337359 Ga0157372_103373593 132
391 3300013308 Ga0157375_10111021 Ga0157375_101110214 132
392 3300013308 Ga0157375_10141594 Ga0157375_101415943 132
393 3300014325 Ga0163163_10013700 Ga0163163_100137008 132
394 3300021388 Ga0213875_10419316 Ga0213875_104193162 132
395 3300025231 Ga0207427_100441 Ga0207427_1004416 132
396 3300025250 Ga0209026_1000675 Ga0209026_10006759 132
397 3300025261 Ga0209233_1000003 Ga0209233_1000003356 132
398 3300025321 Ga0207656_10348198 Ga0207656_103481982 132
399 3300025903 Ga0207680_10202815 Ga0207680_102028153 132
400 3300025904 Ga0207647_10009257 Ga0207647_100092577 132
401 3300025904 Ga0207647_10018802 Ga0207647_100188023 132
402 3300025904 Ga0207647_10358421 Ga0207647_103584211 132
403 3300025907 Ga0207645_10509924 Ga0207645_105099242 132
404 3300025909 Ga0207705_10000042 Ga0207705_1000004270 132
405 3300025909 Ga0207705_10000188 Ga0207705_1000018855 132
406 3300025909 Ga0207705_10661603 Ga0207705_106616031 132
407 3300025909 Ga0207705_10955698 Ga0207705_109556982 132
408 3300025912 Ga0207707_10013301 Ga0207707_1001330110 132
409 3300025913 Ga0207695_10083252 Ga0207695_100832523 132
410 3300025914 Ga0207671_10004049 Ga0207671_100040496 132
411 3300025914 Ga0207671_10044525 Ga0207671_100445253 132
412 3300025917 Ga0207660_10003328 Ga0207660_1000332813 132
413 3300025918 Ga0207662_10355880 Ga0207662_103558803 132
414 3300025919 Ga0207657_10000900 Ga0207657_100009007 132
415 3300025919 Ga0207657_10001555 Ga0207657_100015559 132
416 3300025919 Ga0207657_10048500 Ga0207657_100485004 132
417 3300025919 Ga0207657_10322123 Ga0207657_103221232 132
418 3300025920 Ga0207649_10032880 Ga0207649_100328804 132
419 3300025921 Ga0207652_10000047 Ga0207652_1000004728 132
420 3300025923 Ga0207681_10146964 Ga0207681_101469642 132
421 3300025925 Ga0207650_10003451 Ga0207650_100034514 132
422 3300025925 Ga0207650_10740809 Ga0207650_107408092 132
423 3300025926 Ga0207659_10112865 Ga0207659_101128652 132
424 3300025931 Ga0207644_10006505 Ga0207644_100065053 132
425 3300025933 Ga0207706_10004012 Ga0207706_100040123 132
426 3300025933 Ga0207706_10059349 Ga0207706_100593493 132
427 3300025933 Ga0207706_10101956 Ga0207706_101019562 132
428 3300025933 Ga0207706_10737468 Ga0207706_107374682 132
429 3300025940 Ga0207691_10008730 Ga0207691_100087308 132
430 3300025941 Ga0207711_10020383 Ga0207711_100203834 132
431 3300025941 Ga0207711_10429445 Ga0207711_104294452 132
432 3300025945 Ga0207679_10038837 Ga0207679_100388373 132
433 3300025945 Ga0207679_10042339 Ga0207679_100423393 132
434 3300025949 Ga0207667_10000017 Ga0207667_10000017268 132
435 3300025949 Ga0207667_10038294 Ga0207667_100382942 132
436 3300025960 Ga0207651_10023484 Ga0207651_100234845 132
437 3300025961 Ga0207712_10000012 Ga0207712_10000012249 132
438 3300025961 Ga0207712_11105837 Ga0207712_111058372 132
439 3300025961 Ga0207712_12001469 Ga0207712_120014692 132
440 3300025972 Ga0207668_10000459 Ga0207668_1000045922 132
441 3300025981 Ga0207640_10000406 Ga0207640_1000040612 132
442 3300025986 Ga0207658_10000539 Ga0207658_100005398 132
443 3300025986 Ga0207658_10006472 Ga0207658_100064728 132
444 3300026035 Ga0207703_10105168 Ga0207703_101051682 132
445 3300026041 Ga0207639_10453273 Ga0207639_104532732 132
446 3300026067 Ga0207678_10020196 Ga0207678_100201965 132
447 3300026078 Ga0207702_10009078 Ga0207702_100090783 132
448 3300026078 Ga0207702_10077668 Ga0207702_100776683 132
449 3300026088 Ga0207641_10000079 Ga0207641_1000007999 132
450 3300026088 Ga0207641_10002442 Ga0207641_1000244216 132
451 3300026088 Ga0207641_10009618 Ga0207641_100096189 132
452 3300026088 Ga0207641_10174726 Ga0207641_101747263 132
453 3300026095 Ga0207676_10198802 Ga0207676_101988023 132
454 3300026116 Ga0207674_10234835 Ga0207674_102348352 132
455 3300026121 Ga0207683_10015350 Ga0207683_100153507 132
456 3300026142 Ga0207698_10001449 Ga0207698_1000144912 132
457 3300026142 Ga0207698_10737960 Ga0207698_107379602 132
458 3300028379 Ga0268266_10378178 Ga0268266_103781782 132
459 3300028380 Ga0268265_10000125 Ga0268265_1000012526 132
460 3300028381 Ga0268264_10000347 Ga0268264_1000034751 132
461 3300028381 Ga0268264_10100845 Ga0268264_101008454 132
462 3300028381 Ga0268264_10398544 Ga0268264_103985443 132
463 3300028381 Ga0268264_11215153 Ga0268264_112151532 132
464 3300031456 Ga0307513_10016361 Ga0307513_100163617 132
465 3300031548 Ga0307408_100006783 Ga0307408_10000678310 132
466 3300031548 Ga0307408_100006926 Ga0307408_1000069266 132
467 3300031731 Ga0307405_10058399 Ga0307405_100583994 132
468 3300031731 Ga0307405_10073616 Ga0307405_100736164 132
469 3300031824 Ga0307413_10006988 Ga0307413_100069883 132
470 3300031824 Ga0307413_10052817 Ga0307413_100528173 132
471 3300031824 Ga0307413_10775505 Ga0307413_107755052 132
472 3300031852 Ga0307410_10017150 Ga0307410_100171502 132
473 3300031852 Ga0307410_10064810 Ga0307410_100648103 132
474 3300031901 Ga0307406_10037403 Ga0307406_100374033 132
475 3300031901 Ga0307406_10065133 Ga0307406_100651333 132
476 3300031903 Ga0307407_10016684 Ga0307407_100166846 132
477 3300031903 Ga0307407_10110075 Ga0307407_101100752 132
478 3300031911 Ga0307412_10005086 Ga0307412_100050869 132
479 3300031911 Ga0307412_10017698 Ga0307412_100176984 132
480 3300031911 Ga0307412_11697139 Ga0307412_116971392 132
481 3300031995 Ga0307409_100015440 Ga0307409_1000154406 132
482 3300031995 Ga0307409_100102052 Ga0307409_1001020522 132
483 3300032002 Ga0307416_100002628 Ga0307416_1000026287 132
484 3300032002 Ga0307416_100611774 Ga0307416_1006117742 132
485 3300032002 Ga0307416_103033277 Ga0307416_1030332771 132
486 3300032004 Ga0307414_10007367 Ga0307414_100073674 132
487 3300032004 Ga0307414_10354398 Ga0307414_103543982 132
488 3300032005 Ga0307411_10005662 Ga0307411_100056623 132
489 3300032005 Ga0307411_10009772 Ga0307411_100097722 132
490 3300032126 Ga0307415_100052521 Ga0307415_1000525214 132
491 3300032126 Ga0307415_100100170 Ga0307415_1001001703 132
492 3300037312 Ga0395899_0002738 Ga0395899_0002738_2135_2548 132
493 3300037466 Ga0395898_0637887 Ga0395898_0637887_544_957 132
494 3300037471 Ga0395905_0382755 Ga0395905_0382755_628_1041 132
495 3300037853 Ga0436364_1302975 Ga0436364_1302975_417_830 132
496 3300038443 Ga0395901_0309646 Ga0395901_0309646_306_719 132
497 3300044719 Ga0466971_0199951 Ga0466971_0199951_465_878 132
498 3300044765 Ga0466970_0411923 Ga0466970_0411923_277_690 132
499 3300044842 Ga0466957_0128384 Ga0466957_0128384_539_952 132
500 3300044842 Ga0466957_0169830 Ga0466957_0169830_682_1095 132
501 3300046471 Ga0495650_0006744 Ga0495650_0006744_432_836 132
502 3300046691 Ga0495670_0221147 Ga0495670_0221147_556_969 132
503 3300048903 Ga0496100_0464024 Ga0496100_0464024_115_525 132
504 3300048905 Ga0496102_0634626 Ga0496102_0634626_458_868 132
505 3300048911 Ga0496108_0006377 Ga0496108_0006377_2860_3270 132
506 3300048912 Ga0496109_0043625 Ga0496109_0043625_574_984 132
507 3300048913 Ga0496110_0007061 Ga0496110_0007061_6471_6881 132
508 3300048914 Ga0496111_0003030 Ga0496111_0003030_2868_3278 132
509 3300048915 Ga0496112_0043596 Ga0496112_0043596_3057_3467 132
510 3300048916 Ga0496113_0006174 Ga0496113_0006174_2316_2726 132
511 3300048924 Ga0496121_0000105 Ga0496121_0000105_79527_79925 132
512 3300048924 Ga0496121_0014603 Ga0496121_0014603_1375_1803 132
513 3300048927 Ga0496124_0380187 Ga0496124_0380187_12_428 132
514 3300049586 Ga0501070_0636980 Ga0501070_0636980_348_749 132
515 3300053104 Ga0500556_0231231 Ga0500556_0231231_150_563 132
516 3300053146 Ga0500588_0037695 Ga0500588_0037695_26_424 132
517 3300000041 ARcpr5oldR_c011761 ARcpr5oldR_0117612 133
518 3300001979 JGI24740J21852_10003761 JGI24740J21852_100037616 133
519 3300001990 JGI24737J22298_10004866 JGI24737J22298_100048662 133
520 3300001990 JGI24737J22298_10005025 JGI24737J22298_100050256 133
521 3300003187 JGI25151J46595_10139345 JGI25151J46595_101393451 133
522 3300003215 JGI25153J46596_10000031 JGI25153J46596_10000031160 133
523 3300003215 JGI25153J46596_10000091 JGI25153J46596_1000009174 133
524 3300003762 Ga0055542_1000322 Ga0055542_100032230 133
525 3300003763 Ga0055529_1000014 Ga0055529_1000014296 133
526 3300003771 Ga0055526_1003569 Ga0055526_100356911 133
527 3300003773 Ga0055537_1001470 Ga0055537_10014705 133
528 3300003773 Ga0055537_1001547 Ga0055537_100154711 133
529 3300003775 Ga0055524_1001171 Ga0055524_100117114 133
530 3300003781 Ga0055536_1026317 Ga0055536_10263172 133
531 3300003791 Ga0055530_10009450 Ga0055530_100094504 133
532 3300003791 Ga0055530_10022076 Ga0055530_100220762 133
533 3300003791 Ga0055530_10075464 Ga0055530_100754641 133
534 3300003792 Ga0055540_1004562 Ga0055540_10045623 133
535 3300003794 Ga0055531_10013567 Ga0055531_100135674 133
536 3300003794 Ga0055531_10029632 Ga0055531_100296322 133
537 3300005262 Ga0065165_1003177 Ga0065165_100317713 133
538 3300005327 Ga0070658_10010467 Ga0070658_100104676 133
539 3300005328 Ga0070676_10223767 Ga0070676_102237672 133
540 3300005331 Ga0070670_100466931 Ga0070670_1004669312 133
541 3300005338 Ga0068868_100442712 Ga0068868_1004427122 133
542 3300005344 Ga0070661_100236900 Ga0070661_1002369002 133
543 3300005347 Ga0070668_101124712 Ga0070668_1011247121 133
544 3300005356 Ga0070674_100000035 Ga0070674_10000003514 133
545 3300005356 Ga0070674_100000329 Ga0070674_10000032913 133
546 3300005366 Ga0070659_100140735 Ga0070659_1001407352 133
547 3300005455 Ga0070663_100009984 Ga0070663_1000099843 133
548 3300005456 Ga0070678_100000060 Ga0070678_10000006021 133
549 3300005456 Ga0070678_100480004 Ga0070678_1004800042 133
550 3300005457 Ga0070662_100397579 Ga0070662_1003975792 133
551 3300005539 Ga0068853_100089389 Ga0068853_1000893892 133
552 3300005548 Ga0070665_100000115 Ga0070665_100000115139 133
553 3300005563 Ga0068855_100095443 Ga0068855_1000954431 133
554 3300005564 Ga0070664_100105053 Ga0070664_1001050533 133
555 3300005616 Ga0068852_100347958 Ga0068852_1003479581 133
556 3300005834 Ga0068851_10012325 Ga0068851_100123254 133
557 3300006186 Ga0075369_10038377 Ga0075369_100383772 133
558 3300006358 Ga0068871_100171913 Ga0068871_1001719132 133
559 3300006881 Ga0068865_100384205 Ga0068865_1003842052 133
560 3300009148 Ga0105243_10001791 Ga0105243_1000179121 133
561 3300009174 Ga0105241_10004388 Ga0105241_100043885 133
562 3300009176 Ga0105242_11443763 Ga0105242_114437632 133
563 3300009545 Ga0105237_10017550 Ga0105237_100175502 133
564 3300009545 Ga0105237_10032273 Ga0105237_100322733 133
565 3300010375 Ga0105239_10686070 Ga0105239_106860701 133
566 3300012513 Ga0157326_1001062 Ga0157326_10010622 133
567 3300013102 Ga0157371_10000193 Ga0157371_1000019375 133
568 3300013105 Ga0157369_10170694 Ga0157369_101706941 133
569 3300013296 Ga0157374_10335658 Ga0157374_103356583 133
570 3300017792 Ga0163161_10308905 Ga0163161_103089052 133
571 3300025245 Ga0207425_1000049 Ga0207425_1000049145 133
572 3300025254 Ga0209148_1000011 Ga0209148_1000011301 133
573 3300025258 Ga0209129_1001668 Ga0209129_10016684 133
574 3300025263 Ga0209565_1000007 Ga0209565_100000744 133
575 3300025263 Ga0209565_1000170 Ga0209565_10001705 133
576 3300025272 Ga0209455_1000006 Ga0209455_1000006893 133
577 3300025272 Ga0209455_1024217 Ga0209455_10242172 133
578 3300025273 Ga0209673_1007604 Ga0209673_10076044 133
579 3300025273 Ga0209673_1032519 Ga0209673_10325192 133
580 3300025291 Ga0209675_1004240 Ga0209675_10042401 133
581 3300025292 Ga0209676_1010374 Ga0209676_10103742 133
582 3300025292 Ga0209676_1023070 Ga0209676_10230703 133
583 3300025294 Ga0209025_1000068 Ga0209025_1000068117 133
584 3300025295 Ga0209564_1000335 Ga0209564_100033557 133
585 3300025295 Ga0209564_1026133 Ga0209564_10261333 133
586 3300025297 Ga0209758_1000001 Ga0209758_1000001593 133
587 3300025297 Ga0209758_1000004 Ga0209758_100000416 133
588 3300025297 Ga0209758_1054268 Ga0209758_10542681 133
589 3300025298 Ga0209050_1000001 Ga0209050_10000011945 133
590 3300025298 Ga0209050_1006899 Ga0209050_10068998 133
591 3300025298 Ga0209050_1021069 Ga0209050_10210693 133
592 3300025299 Ga0209256_1000009 Ga0209256_1000009114 133
593 3300025299 Ga0209256_1000010 Ga0209256_100001038 133
594 3300025302 Ga0207426_1032149 Ga0207426_10321492 133
595 3300025303 Ga0209051_1000191 Ga0209051_1000191124 133
596 3300025303 Ga0209051_1071930 Ga0209051_10719302 133
597 3300025304 Ga0209257_1003180 Ga0209257_10031807 133
598 3300025304 Ga0209257_1003572 Ga0209257_100357211 133
599 3300025304 Ga0209257_1003678 Ga0209257_10036785 133
600 3300025321 Ga0207656_10084319 Ga0207656_100843192 133
601 3300025904 Ga0207647_10018578 Ga0207647_100185786 133
602 3300025904 Ga0207647_10160000 Ga0207647_101600001 133
603 3300025909 Ga0207705_10021287 Ga0207705_100212873 133
604 3300025911 Ga0207654_10000227 Ga0207654_1000022718 133
605 3300025913 Ga0207695_10028168 Ga0207695_100281684 133
606 3300025914 Ga0207671_10012108 Ga0207671_100121085 133
607 3300025914 Ga0207671_10036679 Ga0207671_100366792 133
608 3300025919 Ga0207657_10001241 Ga0207657_1000124121 133
609 3300025919 Ga0207657_10136202 Ga0207657_101362022 133
610 3300025919 Ga0207657_10440642 Ga0207657_104406422 133
611 3300025920 Ga0207649_10002240 Ga0207649_1000224011 133
612 3300025920 Ga0207649_10202905 Ga0207649_102029052 133
613 3300025924 Ga0207694_10000683 Ga0207694_1000068330 133
614 3300025925 Ga0207650_10216175 Ga0207650_102161753 133
615 3300025926 Ga0207659_11431214 Ga0207659_114312141 133
616 3300025932 Ga0207690_10001286 Ga0207690_100012865 133
617 3300025932 Ga0207690_10432323 Ga0207690_104323232 133
618 3300025933 Ga0207706_10167689 Ga0207706_101676892 133
619 3300025933 Ga0207706_10893307 Ga0207706_108933072 133
620 3300025935 Ga0207709_10000246 Ga0207709_1000024637 133
621 3300025937 Ga0207669_10000030 Ga0207669_1000003073 133
622 3300025937 Ga0207669_10000615 Ga0207669_1000061512 133
623 3300025940 Ga0207691_10087107 Ga0207691_100871072 133
624 3300025949 Ga0207667_10000002 Ga0207667_10000002182 133
625 3300025949 Ga0207667_10016552 Ga0207667_100165524 133
626 3300025981 Ga0207640_10001048 Ga0207640_1000104811 133
627 3300026023 Ga0207677_10402104 Ga0207677_104021042 133
628 3300026041 Ga0207639_10007346 Ga0207639_100073466 133
629 3300026067 Ga0207678_10001389 Ga0207678_1000138922 133
630 3300026078 Ga0207702_10007341 Ga0207702_100073416 133
631 3300026116 Ga0207674_10069420 Ga0207674_100694204 133
632 3300026121 Ga0207683_10000075 Ga0207683_1000007526 133
633 3300026121 Ga0207683_10233772 Ga0207683_102337722 133
634 3300026142 Ga0207698_10006501 Ga0207698_100065016 133
635 3300028379 Ga0268266_10000015 Ga0268266_10000015585 133
636 3300031456 Ga0307513_10026396 Ga0307513_100263968 133
637 3300037312 Ga0395899_0067795 Ga0395899_0067795_1450_1869 133
638 3300038443 Ga0395901_0328606 Ga0395901_0328606_769_1188 133
639 3300041452 Ga0451793_0255256 Ga0451793_0255256_34_453 133
640 3300046452 Ga0495617_125856 Ga0495617_125856_149_568 133
641 3300046454 Ga0495592_0786948 Ga0495592_0786948_47_466 133
642 3300046460 Ga0495638_0309533 Ga0495638_0309533_89_508 133
643 3300046471 Ga0495650_0000259 Ga0495650_0000259_78019_78438 133
644 3300046491 Ga0495584_0005639 Ga0495584_0005639_3368_3787 133
645 3300046500 Ga0495596_0018840 Ga0495596_0018840_562_981 133
646 3300046506 Ga0495583_0033072 Ga0495583_0033072_1640_2059 133
647 3300046506 Ga0495583_0042526 Ga0495583_0042526_289_708 133
648 3300046507 Ga0495606_0000029 Ga0495606_0000029_226496_226915 133
649 3300046507 Ga0495606_0066199 Ga0495606_0066199_30_449 133
650 3300046513 Ga0495616_0183023 Ga0495616_0183023_95_514 133
651 3300046518 Ga0495631_0009935 Ga0495631_0009935_374_793 133
652 3300046518 Ga0495631_0332613 Ga0495631_0332613_82_501 133
653 3300046520 Ga0495637_0038137 Ga0495637_0038137_587_1006 133
654 3300046520 Ga0495637_0135631 Ga0495637_0135631_384_803 133
655 3300046522 Ga0495643_0006968 Ga0495643_0006968_6173_6592 133
656 3300046522 Ga0495643_0007751 Ga0495643_0007751_5794_6213 133
657 3300046524 Ga0495648_0000291 Ga0495648_0000291_158_577 133
658 3300046525 Ga0495663_0000756 Ga0495663_0000756_6847_7266 133
659 3300046536 Ga0495587_0468400 Ga0495587_0468400_232_651 133
660 3300046542 Ga0495597_0097196 Ga0495597_0097196_691_1110 133
661 3300046557 Ga0495622_0006792 Ga0495622_0006792_3471_3890 133
662 3300046558 Ga0495633_0002070 Ga0495633_0002070_10136_10555 133
663 3300046558 Ga0495633_0027359 Ga0495633_0027359_959_1378 133
664 3300046648 Ga0495611_0143960 Ga0495611_0143960_572_991 133
665 3300046648 Ga0495611_0558796 Ga0495611_0558796_82_501 133
666 3300046660 Ga0495625_0000092 Ga0495625_0000092_21702_22121 133
667 3300046660 Ga0495625_0004356 Ga0495625_0004356_2431_2850 133
668 3300046660 Ga0495625_0010250 Ga0495625_0010250_3876_4295 133
669 3300046660 Ga0495625_0014866 Ga0495625_0014866_747_1166 133
670 3300046665 Ga0495661_0064241 Ga0495661_0064241_660_1079 133
671 3300046684 Ga0495669_0000039 Ga0495669_0000039_69627_70046 133
672 3300046691 Ga0495670_0720909 Ga0495670_0720909_29_448 133
673 3300046694 Ga0495649_0058382 Ga0495649_0058382_603_1022 133
674 3300046809 Ga0495600_0110165 Ga0495600_0110165_1023_1442 133
675 3300046810 Ga0495660_0196273 Ga0495660_0196273_495_914 133
676 3300047318 Ga0495636_0235789 Ga0495636_0235789_68_487 133
677 3300047323 Ga0495683_0000947 Ga0495683_0000947_14024_14443 133
678 3300047323 Ga0495683_0047570 Ga0495683_0047570_345_764 133
679 3300047443 Ga0495687_000098 Ga0495687_000098_4467_4886 133
680 3300047445 Ga0495677_0013510 Ga0495677_0013510_1824_2243 133
681 3300047470 Ga0495681_0007945 Ga0495681_0007945_4123_4542 133
682 3300047472 Ga0495686_0000486 Ga0495686_0000486_37682_38110 133
683 3300047472 Ga0495686_0040153 Ga0495686_0040153_1991_2398 133
684 3300048903 Ga0496100_0562510 Ga0496100_0562510_193_609 133
685 3300048905 Ga0496102_0000961 Ga0496102_0000961_23849_24268 133
686 3300048906 Ga0496103_0000145 Ga0496103_0000145_17969_18388 133
687 3300048906 Ga0496103_0299526 Ga0496103_0299526_254_670 133
688 3300048907 Ga0496104_0003941 Ga0496104_0003941_3623_4042 133
689 3300048908 Ga0496105_0000218 Ga0496105_0000218_13304_13723 133
690 3300048917 Ga0496114_0026742 Ga0496114_0026742_3988_4407 133
691 3300048918 Ga0496115_0000195 Ga0496115_0000195_56021_56440 133
692 3300048918 Ga0496115_0001359 Ga0496115_0001359_13920_14336 133
693 3300048919 Ga0496116_0010920 Ga0496116_0010920_6987_7406 133
694 3300048920 Ga0496117_0000910 Ga0496117_0000910_24884_25303 133
695 3300048921 Ga0496118_0000091 Ga0496118_0000091_147873_148292 133
696 3300048922 Ga0496119_0010325 Ga0496119_0010325_370_789 133
697 3300048923 Ga0496120_0059756 Ga0496120_0059756_508_927 133
698 3300048923 Ga0496120_0074129 Ga0496120_0074129_1336_1737 133
699 3300048924 Ga0496121_0000429 Ga0496121_0000429_65792_66211 133
700 3300048925 Ga0496122_0128770 Ga0496122_0128770_1123_1542 133
701 3300048925 Ga0496122_0219332 Ga0496122_0219332_662_1063 133
702 3300048926 Ga0496123_0042673 Ga0496123_0042673_662_1063 133
703 3300048926 Ga0496123_0070886 Ga0496123_0070886_354_773 133
704 3300048926 Ga0496123_0170339 Ga0496123_0170339_72_473 133
705 3300048926 Ga0496123_0292996 Ga0496123_0292996_290_691 133
706 3300048927 Ga0496124_0000129 Ga0496124_0000129_144766_145221 133
707 3300048927 Ga0496124_0000375 Ga0496124_0000375_56030_56449 133
708 3300048927 Ga0496124_0018814 Ga0496124_0018814_4464_4865 133
709 3300048927 Ga0496124_0050792 Ga0496124_0050792_466_867 133
710 3300048927 Ga0496124_0178404 Ga0496124_0178404_10_411 133
711 3300048928 Ga0496125_0052345 Ga0496125_0052345_527_946 133
712 3300048929 Ga0496126_0000443 Ga0496126_0000443_55972_56391 133
713 3300048929 Ga0496126_0038558 Ga0496126_0038558_3001_3402 133
714 3300049460 Ga0495682_0374199 Ga0495682_0374199_46_465 133
715 3300050516 nmdc:mga0sz30_48265_c1 nmdc:mga0sz30_48265_c1_813_1232 133
716 3300053079 Ga0500610_0000063 Ga0500610_0000063_28045_28464 133
717 3300053091 Ga0500647_0117418 Ga0500647_0117418_587_1006 133
718 3300053119 Ga0500595_000475 Ga0500595_000475_15125_15544 133
719 3300053121 Ga0500607_155702 Ga0500607_155702_50_469 133
720 3300053130 Ga0500642_0004242 Ga0500642_0004242_2651_3070 133
721 3300053154 Ga0500619_083722 Ga0500619_083722_477_896 133
722 3300053177 Ga0500636_0000462 Ga0500636_0000462_4210_4629 133
723 3300053730 Ga0500645_000002 Ga0500645_000002_176330_176749 133
724 3300053730 Ga0500645_031256 Ga0500645_031256_344_760 133
725 3300053731 Ga0500609_015863 Ga0500609_015863_209_628 133
726 3300053735 Ga0500596_000052 Ga0500596_000052_5366_5785 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

17

149

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8374 5 93
7a5g-assembly1.cif.gz_b6 structure of the elongating human mitoribosome bound to mtef-tu.gmppcp and a/t mt-trna 0.8062 11 93
7oi6-assembly1.cif.gz_p cryo-em structure of late human 39s mitoribosome assembly intermediates, state 1 0.8009 1 93
7jt1-assembly1.cif.gz_9 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.7956 30 93
1l4s-assembly1.cif.gz_A solution structure of ribosome associated factor y 0.7956 31 95
ID Description Score Start End Superfamily
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8649 35 92 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8374 5 93 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8164 35 92 3.30.160.20
af_Q7XD96_1552_1629_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8154 31 91 3.30.160.20
af_Q5AI30_155_260_3.30.1460.20 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8066 6 98 3.30.1460.20
ID Description Score Start End GO Terms
AF-A0A352HBL5-F1-model_v4 deleted 0.8699 11 95
AF-A0A3D2PIA2-F1-model_v4 deleted 0.8593 11 94
AF-A0A7S2IT84-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.8567 4 93 GO:0004045
GO:0005762
GO:0016150
GO:0070126
AF-A0A2E7U4D1-F1-model_v4 deleted 0.8552 4 96
AF-A0A7Z9SFB3-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8527 1 97 GO:0003747
GO:0004045
GO:0043022
GO:0072344

Feature Viewer

pLDDT pTM Quality
82.74 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map