F477604

General Info

Members Datasets Scaffolds Average Seq Length
725 409 656 511

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100022808|Ga0070698_1000228081
Length 557
Sequence MITLSTRFYGLRMNLRSATCGRNYETRRSEAEPLWQPEDKSVRLTDYLDKGASLGAEAPCLTAGGRTLSYGDVQALSWRIARXXXXSRIRPGDKVAILSANDPVAFSCVFGISRAGAVWCPVNPRNEAAENRDLLDFFDCTCLIFQAAFAPLVTKILPDLPKLTTLVCLDGEHPSATPFGQWLADLPGEPWQAEPPDDLVMLVGTGGTTGRPKGVMLTGHNIETMSALTLMSYPFRPRPRYLALAPLTHAAGVLCFPVMTLGGEIVIMPKPDLAEFLSLIEKYKITHTFLPPTLIYLLLDHPALRAADLASLQCLWYGAAPMSAARLTEALAKIGPVMGQLFGQSEAPMMISTMAPADHFREDGSLAEERLSSAGRPTPLTTVAIMDDEGHLLGPGQRGEIVARGPLVMAGYYKNPQASAEAARYGWHHTGDIGYLDEDNYLFIVDRAKDMIITGGFNVYSAEVEQVLLAHPAVQDCAVVGLPDEKWGERVTAVVQLRPGQTVTEDEVRSFVKERLGSVKAPKQVEVWPDLPRSKVGKVLKVDVKAQLRAGESAQSR

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
6 2643221561 Nocardioides sp. Root151 Isolate Unclassified
7 2643221576 Nocardioides sp. Root614 Isolate Unclassified
8 2643221590 Nocardioides sp. Root682 Isolate Unclassified
9 2643221604 Nocardioides sp. Root190 Isolate Unclassified
10 2643221615 Nocardioides sp. Root224 Isolate Unclassified
11 2643221617 Nocardioides sp. Root79 Isolate Unclassified
12 2643221620 Nocardioides sp. Root240 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221696 Nocardioides sp. Root140 Isolate Unclassified
17 2738541305 Nocardioides sp. CF167 Isolate Unclassified
18 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
19 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
20 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
21 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
22 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
23 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
24 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
25 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
26 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
27 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
28 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
29 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
30 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
31 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
32 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
33 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
34 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
35 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
36 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
37 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
38 2885198086 Variovorax sp. 679 Isolate Unclassified
39 2885211737 Variovorax sp. 553 Isolate Unclassified
40 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
41 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
42 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
43 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
44 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
45 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
46 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
47 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
48 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
49 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
50 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
51 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
52 2922554459 Rhodococcus sp. 66b Isolate Unclassified
53 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
54 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
55 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
56 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
57 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
58 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
59 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
60 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
61 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
62 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
63 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
64 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
65 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
66 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
67 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
68 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
69 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
78 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
79 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
80 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
83 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
84 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
85 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
86 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
87 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
90 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
91 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
92 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
93 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
94 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
95 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
96 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
97 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
98 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
99 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
100 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
101 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
102 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
103 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
104 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
105 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
108 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
109 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
110 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
122 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
123 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
124 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
125 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
126 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
127 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
130 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
131 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
132 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
140 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
148 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
150 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
169 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
229 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
230 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
233 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
234 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
235 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
236 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
237 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
238 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
239 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
240 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
241 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
242 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
243 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
244 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
268 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
280 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
286 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
298 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
302 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
305 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
317 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
327 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
362 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
365 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
366 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
367 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
378 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
379 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
391 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
392 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
395 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
396 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
397 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
398 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
399 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
400 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
401 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
402 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
405 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
406 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
407 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
408 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
409 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0.41
Isolates 9.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 4.97
Nodule 0.97
Rhizoplane 8.41
Rhizosphere 73.66
Stem 0
Stem Tuber 0
Unclassified 11.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000082 3300001904 Bacteria 15646
2 JGI24740J21852_10003927 3300001979 Bacteria 6454
3 JGI24739J22299_10005208 3300001989 Bacteria 4956
4 JGI24735J21928_10006642 3300002067 Bacteria 3799
5 JGI24738J21930_10008269 3300002075 Bacteria 2369
6 JGI25407J50210_10003955 3300003373 Bacteria 3588
7 JGI25404J52841_10000235 3300003659 Bacteria 6918
8 Ga0055530_10000093 3300003791 Bacteria 77624
9 Ga0055530_10000104 3300003791 Bacteria 72163
10 Ga0055540_1007428 3300003792 Bacteria 4136
11 Ga0055531_10000432 3300003794 Bacteria 39735
12 Ga0055531_10002055 3300003794 Bacteria 13881
13 Ga0070683_100002702 3300005329 Bacteria 14166
14 Ga0070683_100010116 3300005329 Bacteria 8093
15 Ga0070683_100013188 3300005329 Bacteria 7198
16 Ga0070683_100032144 3300005329 Bacteria 4776
17 Ga0070683_100075807 3300005329 Bacteria 3143
18 Ga0068869_100009568 3300005334 Bacteria 6293
19 Ga0068869_100071657 3300005334 Bacteria 2566
20 Ga0068869_100077878 3300005334 Bacteria 2468
21 Ga0070666_10014340 3300005335 Bacteria 5045
22 Ga0070666_10029643 3300005335 Bacteria 3599
23 Ga0070682_100057762 3300005337 Bacteria 2446
24 Ga0070682_100067088 3300005337 Bacteria 2284
25 Ga0070682_100101305 3300005337 Bacteria 1902
26 Ga0068868_100037250 3300005338 Bacteria 3769
27 Ga0070687_100019362 3300005343 Bacteria 3164
28 Ga0070661_100030912 3300005344 Bacteria 3870
29 Ga0070668_100000425 3300005347 Bacteria 27984
30 Ga0070668_100039888 3300005347 Bacteria 3591
31 Ga0070668_100071753 3300005347 Bacteria 2698
32 Ga0070675_100053540 3300005354 Bacteria 3319
33 Ga0070675_100196275 3300005354 Bacteria 1751
34 Ga0070671_100013148 3300005355 Bacteria 6668
35 Ga0070671_100050494 3300005355 Bacteria 3459
36 Ga0070674_100041183 3300005356 Bacteria 3128
37 Ga0070673_100047366 3300005364 Bacteria 3345
38 Ga0070688_100064672 3300005365 Bacteria 2322
39 Ga0070659_100004221 3300005366 Bacteria 10260
40 Ga0070659_100058748 3300005366 Bacteria 3036
41 Ga0070667_100041269 3300005367 Bacteria 3871
42 Ga0070667_100233722 3300005367 Bacteria 1640
43 Ga0070703_10010202 3300005406 Bacteria 2648
44 Ga0070709_10021541 3300005434 Bacteria 3755
45 Ga0070714_100021486 3300005435 Bacteria 5281
46 Ga0070714_100182209 3300005435 Bacteria 1912
47 Ga0070713_100057549 3300005436 Bacteria 3238
48 Ga0070710_10007207 3300005437 Bacteria 5374
49 Ga0070711_100003971 3300005439 Bacteria 8693
50 Ga0070711_100029686 3300005439 Bacteria 3611
51 Ga0070711_100076887 3300005439 Bacteria 2367
52 Ga0070705_100020353 3300005440 Bacteria 3509
53 Ga0070694_100009061 3300005444 Bacteria 6100
54 Ga0070694_100113622 3300005444 Bacteria 1932
55 Ga0070708_100016030 3300005445 Bacteria 6207
56 Ga0070708_100055574 3300005445 Bacteria 3520
57 Ga0070708_100072383 3300005445 Bacteria 3106
58 Ga0070708_100143161 3300005445 Bacteria 2218
59 Ga0070663_100005868 3300005455 Bacteria 7340
60 Ga0070678_100039449 3300005456 Bacteria 3332
61 Ga0070662_100020261 3300005457 Bacteria 4526
62 Ga0070662_100022891 3300005457 Bacteria 4285
63 Ga0070662_100042699 3300005457 Bacteria 3240
64 Ga0070685_10018383 3300005466 Bacteria 3758
65 Ga0070685_10071439 3300005466 Bacteria 2058
66 Ga0070685_10086558 3300005466 Bacteria 1890
67 Ga0070706_100001943 3300005467 Bacteria 21303
68 Ga0070706_100033486 3300005467 Bacteria 4742
69 Ga0070706_100150348 3300005467 Bacteria 2173
70 Ga0070707_100011160 3300005468 Bacteria 8372
71 Ga0070707_100015242 3300005468 Bacteria 7213
72 Ga0070707_100080783 3300005468 Bacteria 3138
73 Ga0070698_100001126 3300005471 Bacteria 29553
74 Ga0070698_100004906 3300005471 Bacteria 14675
75 Ga0070698_100005767 3300005471 Bacteria 13540
76 Ga0070698_100022808 3300005471 Bacteria 6544
77 Ga0070699_100002453 3300005518 Bacteria 16669
78 Ga0070699_100011087 3300005518 Bacteria 7792
79 Ga0070679_100024686 3300005530 Bacteria 5891
80 Ga0070679_100048194 3300005530 Bacteria 4246
81 Ga0070684_100003428 3300005535 Bacteria 11910
82 Ga0070697_100003236 3300005536 Bacteria 12501
83 Ga0070672_100041287 3300005543 Bacteria 3546
84 Ga0070672_100148817 3300005543 Bacteria 1936
85 Ga0070696_100017808 3300005546 Bacteria 4796
86 Ga0070665_100000011 3300005548 Bacteria 525539
87 Ga0070665_100000596 3300005548 Bacteria 50215
88 Ga0070665_100004605 3300005548 Bacteria 14422
89 Ga0070665_100072533 3300005548 Bacteria 3450
90 Ga0068855_100000032 3300005563 Bacteria 168335
91 Ga0070664_100001201 3300005564 Bacteria 20631
92 Ga0070664_100006782 3300005564 Bacteria 9232
93 Ga0070664_100085635 3300005564 Bacteria 2722
94 Ga0068857_100023384 3300005577 Bacteria 5441
95 Ga0068857_100028137 3300005577 Bacteria 4958
96 Ga0068857_100041684 3300005577 Bacteria 4070
97 Ga0068857_100042508 3300005577 Bacteria 4033
98 Ga0068857_100081984 3300005577 Bacteria 2881
99 Ga0068857_100127933 3300005577 Bacteria 2289
100 Ga0068856_100013762 3300005614 Bacteria 7821
101 Ga0068859_100109284 3300005617 Bacteria 2826
102 Ga0068864_100143672 3300005618 Bacteria 2155
103 Ga0068866_10034919 3300005718 Bacteria 2452
104 Ga0068866_10057655 3300005718 Bacteria 2002
105 Ga0068861_100021704 3300005719 Bacteria 4616
106 Ga0068851_10061692 3300005834 Bacteria 1922
107 Ga0068870_10008775 3300005840 Bacteria 4560
108 Ga0068870_10054071 3300005840 Bacteria 2134
109 Ga0068870_10097947 3300005840 Bacteria 1651
110 Ga0068863_100034139 3300005841 Bacteria 4846
111 Ga0068863_100054372 3300005841 Bacteria 3793
112 Ga0068863_100069141 3300005841 Bacteria 3339
113 Ga0068863_100071883 3300005841 Bacteria 3273
114 Ga0068858_100002113 3300005842 Bacteria 20168
115 Ga0068858_100032909 3300005842 Bacteria 4814
116 Ga0068858_100047466 3300005842 Bacteria 3980
117 Ga0068862_100022922 3300005844 Bacteria 5227
118 Ga0068862_100027619 3300005844 Bacteria 4778
119 Ga0081455_10000724 3300005937 Bacteria 42797
120 Ga0081455_10084898 3300005937 Bacteria 2583
121 Ga0081538_10004167 3300005981 Bacteria 13420
122 Ga0081540_1000528 3300005983 Bacteria 37260
123 Ga0081539_10000999 3300005985 Bacteria 52497
124 Ga0081539_10005615 3300005985 Bacteria 12628
125 Ga0081539_10007595 3300005985 Bacteria 9797
126 Ga0070717_10039004 3300006028 Bacteria 3863
127 Ga0075365_10009286 3300006038 Bacteria 5642
128 Ga0075368_10004625 3300006042 Bacteria 4680
129 Ga0075363_100035372 3300006048 Bacteria 2613
130 Ga0075364_10006473 3300006051 Bacteria 6882
131 Ga0070715_10020379 3300006163 Bacteria 2557
132 Ga0070715_10047190 3300006163 Bacteria 1835
133 Ga0070712_100005558 3300006175 Bacteria 7802
134 Ga0070712_100006558 3300006175 Bacteria 7224
135 Ga0070712_100010785 3300006175 Bacteria 5777
136 Ga0075367_10064425 3300006178 Bacteria 2192
137 Ga0068871_100020061 3300006358 Bacteria 5115
138 Ga0068871_100095675 3300006358 Bacteria 2480
139 Ga0075430_100067423 3300006846 Bacteria 3004
140 Ga0075431_100032592 3300006847 Bacteria 5369
141 Ga0075433_10053485 3300006852 Bacteria 3521
142 Ga0075429_100003204 3300006880 Bacteria 13921
143 Ga0075429_100021787 3300006880 Bacteria 5556
144 Ga0097620_100109284 3300006931 Bacteria 2826
145 Ga0075435_100026319 3300007076 Bacteria 4536
146 Ga0105240_10180463 3300009093 Bacteria 2492
147 Ga0111539_10000515 3300009094 Bacteria 49121
148 Ga0111539_10089136 3300009094 Bacteria 3625
149 Ga0105245_10000529 3300009098 Bacteria 35001
150 Ga0105245_10020906 3300009098 Bacteria 5738
151 Ga0105245_10072319 3300009098 Bacteria 3132
152 Ga0105247_10011549 3300009101 Bacteria 5319
153 Ga0114129_10028864 3300009147 Bacteria 7860
154 Ga0105243_10047640 3300009148 Bacteria 3376
155 Ga0105242_10051819 3300009176 Bacteria 3346
156 Ga0105237_10069511 3300009545 Bacteria 3517
157 Ga0105238_10080063 3300009551 Bacteria 3256
158 Ga0105238_10103866 3300009551 Bacteria 2823
159 Ga0105238_10163190 3300009551 Bacteria 2204
160 Ga0105249_10022755 3300009553 Bacteria 5617
161 Ga0105249_10170644 3300009553 Bacteria 2109
162 Ga0105239_10258978 3300010375 Bacteria 1955
163 Ga0105246_10004077 3300011119 Bacteria 8872
164 Ga0105246_10038778 3300011119 Bacteria 3205
165 Ga0157342_1001046 3300012507 Bacteria 1928
166 Ga0157370_10029089 3300013104 Bacteria 5428
167 Ga0157369_10003669 3300013105 Bacteria 18233
168 Ga0157369_10033051 3300013105 Bacteria 5686
169 Ga0157369_10071413 3300013105 Bacteria 3727
170 Ga0157374_10073628 3300013296 Bacteria 3224
171 Ga0157374_10153738 3300013296 Bacteria 2238
172 Ga0157378_10154159 3300013297 Bacteria 2143
173 Ga0163162_10112126 3300013306 Bacteria 2826
174 Ga0157372_10080788 3300013307 Bacteria 3679
175 Ga0157372_10196199 3300013307 Bacteria 2338
176 Ga0157375_10033927 3300013308 Bacteria 4856
177 Ga0157375_10037218 3300013308 Bacteria 4660
178 Ga0157375_10106674 3300013308 Bacteria 2893
179 Ga0157375_10138891 3300013308 Bacteria 2555
180 Ga0157380_10047068 3300014326 Bacteria 3390
181 Ga0157377_10011005 3300014745 Bacteria 4499
182 Ga0157377_10065040 3300014745 Bacteria 2094
183 Ga0157379_10018288 3300014968 Bacteria 6176
184 Ga0157379_10048224 3300014968 Bacteria 3802
185 Ga0157376_10020114 3300014969 Bacteria 5158
186 Ga0157376_10103403 3300014969 Bacteria 2494
187 Ga0163161_10023742 3300017792 Bacteria 4328
188 Ga0206356_11380849 3300020070 Bacteria 2669
189 Ga0206354_10770736 3300020081 Bacteria 3699
190 Ga0214544_1000056 3300021320 Bacteria 132760
191 Ga0213875_10001633 3300021388 Bacteria 14154
192 Ga0209147_100368 3300025229 Bacteria 32053
193 Ga0209675_1000132 3300025291 Bacteria 102062
194 Ga0209676_1000085 3300025292 Bacteria 273425
195 Ga0209676_1000118 3300025292 Bacteria 201939
196 Ga0209676_1001329 3300025292 Bacteria 25002
197 Ga0209050_1000115 3300025298 Bacteria 204622
198 Ga0207426_1007082 3300025302 Bacteria 4744
199 Ga0209051_1000413 3300025303 Bacteria 59027
200 Ga0209051_1011091 3300025303 Bacteria 4480
201 Ga0209257_1000160 3300025304 Bacteria 177175
202 Ga0209257_1000482 3300025304 Bacteria 72375
203 Ga0209257_1006194 3300025304 Bacteria 7853
204 Ga0207656_10053774 3300025321 Bacteria 1748
205 Ga0207653_10002294 3300025885 Bacteria 6104
206 Ga0207653_10015836 3300025885 Bacteria 2367
207 Ga0207692_10006037 3300025898 Bacteria 4897
208 Ga0207692_10008808 3300025898 Bacteria 4192
209 Ga0207692_10020664 3300025898 Bacteria 3000
210 Ga0207688_10000995 3300025901 Bacteria 14450
211 Ga0207688_10012849 3300025901 Bacteria 4552
212 Ga0207688_10014437 3300025901 Bacteria 4294
213 Ga0207688_10080432 3300025901 Bacteria 1860
214 Ga0207680_10029174 3300025903 Bacteria 3096
215 Ga0207647_10003799 3300025904 Bacteria 11286
216 Ga0207647_10030334 3300025904 Bacteria 3489
217 Ga0207699_10004882 3300025906 Bacteria 6418
218 Ga0207699_10006490 3300025906 Bacteria 5669
219 Ga0207699_10046955 3300025906 Bacteria 2529
220 Ga0207645_10032768 3300025907 Bacteria 3340
221 Ga0207643_10054170 3300025908 Bacteria 2279
222 Ga0207643_10063681 3300025908 Bacteria 2109
223 Ga0207684_10002895 3300025910 Bacteria 17010
224 Ga0207684_10096748 3300025910 Bacteria 2520
225 Ga0207671_10001110 3300025914 Bacteria 32453
226 Ga0207693_10001394 3300025915 Bacteria 21405
227 Ga0207693_10003334 3300025915 Bacteria 13739
228 Ga0207693_10008049 3300025915 Bacteria 8652
229 Ga0207693_10016153 3300025915 Bacteria 5971
230 Ga0207693_10021512 3300025915 Bacteria 5124
231 Ga0207663_10002702 3300025916 Bacteria 8555
232 Ga0207662_10012788 3300025918 Bacteria 4682
233 Ga0207662_10024763 3300025918 Bacteria 3454
234 Ga0207657_10006877 3300025919 Bacteria 11737
235 Ga0207657_10020250 3300025919 Bacteria 6293
236 Ga0207657_10056571 3300025919 Bacteria 3384
237 Ga0207657_10061524 3300025919 Bacteria 3218
238 Ga0207652_10005615 3300025921 Bacteria 10176
239 Ga0207646_10005267 3300025922 Bacteria 13639
240 Ga0207646_10006511 3300025922 Bacteria 12055
241 Ga0207659_10027441 3300025926 Bacteria 3855
242 Ga0207687_10102872 3300025927 Bacteria 2105
243 Ga0207687_10166833 3300025927 Bacteria 1695
244 Ga0207700_10013193 3300025928 Bacteria 5366
245 Ga0207700_10017788 3300025928 Bacteria 4756
246 Ga0207700_10028349 3300025928 Bacteria 3935
247 Ga0207700_10067357 3300025928 Bacteria 2740
248 Ga0207664_10010087 3300025929 Bacteria 6658
249 Ga0207664_10032123 3300025929 Bacteria 4022
250 Ga0207644_10014395 3300025931 Bacteria 5291
251 Ga0207706_10009888 3300025933 Bacteria 8748
252 Ga0207706_10017955 3300025933 Bacteria 6367
253 Ga0207706_10027818 3300025933 Bacteria 5054
254 Ga0207706_10035702 3300025933 Bacteria 4418
255 Ga0207706_10065345 3300025933 Bacteria 3203
256 Ga0207706_10145110 3300025933 Bacteria 2088
257 Ga0207709_10082687 3300025935 Bacteria 2074
258 Ga0207670_10015775 3300025936 Bacteria 4523
259 Ga0207665_10001604 3300025939 Bacteria 15248
260 Ga0207665_10002187 3300025939 Bacteria 13215
261 Ga0207665_10006158 3300025939 Bacteria 7967
262 Ga0207665_10011024 3300025939 Bacteria 5934
263 Ga0207665_10067307 3300025939 Bacteria 2439
264 Ga0207665_10111621 3300025939 Bacteria 1922
265 Ga0207691_10045389 3300025940 Bacteria 4039
266 Ga0207711_10034870 3300025941 Bacteria 4262
267 Ga0207689_10025359 3300025942 Bacteria 4969
268 Ga0207689_10088384 3300025942 Bacteria 2545
269 Ga0207661_10085376 3300025944 Bacteria 2616
270 Ga0207667_10012779 3300025949 Bacteria 9644
271 Ga0207651_10036222 3300025960 Bacteria 3219
272 Ga0207668_10001956 3300025972 Bacteria 12053
273 Ga0207658_10032959 3300025986 Bacteria 3692
274 Ga0207677_10042210 3300026023 Bacteria 3023
275 Ga0207677_10068782 3300026023 Bacteria 2487
276 Ga0207703_10001637 3300026035 Bacteria 20186
277 Ga0207639_10122657 3300026041 Bacteria 2137
278 Ga0207678_10010983 3300026067 Bacteria 7954
279 Ga0207678_10011222 3300026067 Bacteria 7870
280 Ga0207678_10015276 3300026067 Bacteria 6753
281 Ga0207678_10019597 3300026067 Bacteria 5946
282 Ga0207678_10052876 3300026067 Bacteria 3502
283 Ga0207678_10055042 3300026067 Bacteria 3426
284 Ga0207678_10069896 3300026067 Bacteria 3010
285 Ga0207678_10099774 3300026067 Bacteria 2480
286 Ga0207708_10021659 3300026075 Bacteria 4848
287 Ga0207702_10001744 3300026078 Bacteria 21387
288 Ga0207702_10011750 3300026078 Bacteria 7294
289 Ga0207641_10013183 3300026088 Bacteria 6778
290 Ga0207641_10101803 3300026088 Bacteria 2532
291 Ga0207676_10189753 3300026095 Bacteria 1807
292 Ga0207674_10034983 3300026116 Bacteria 5245
293 Ga0207674_10035385 3300026116 Bacteria 5211
294 Ga0207674_10037641 3300026116 Bacteria 5029
295 Ga0207674_10052862 3300026116 Bacteria 4142
296 Ga0207674_10056821 3300026116 Bacteria 3971
297 Ga0207674_10080075 3300026116 Bacteria 3270
298 Ga0207674_10083033 3300026116 Bacteria 3203
299 Ga0207675_100032639 3300026118 Bacteria 4850
300 Ga0207675_100043257 3300026118 Bacteria 4207
301 Ga0207675_100149280 3300026118 Bacteria 2224
302 Ga0207683_10023161 3300026121 Bacteria 5337
303 Ga0207683_10052256 3300026121 Bacteria 3580
304 Ga0207683_10090274 3300026121 Bacteria 2728
305 Ga0207683_10139381 3300026121 Bacteria 2185
306 Ga0207428_10053149 3300027907 Bacteria 3231
307 Ga0268266_10000063 3300028379 Bacteria 253339
308 Ga0268266_10005453 3300028379 Bacteria 11853
309 Ga0268266_10029429 3300028379 Bacteria 4669
310 Ga0268265_10101647 3300028380 Bacteria 2323
311 Ga0265337_1003142 3300028556 Bacteria 7273
312 Ga0265336_10003485 3300028666 Bacteria 6156
313 Ga0307515_10000456 3300028794 Bacteria 97538
314 Ga0307515_10036149 3300028794 Bacteria 8004
315 Ga0307515_10046075 3300028794 Bacteria 6678
316 Ga0307515_10103950 3300028794 Bacteria 3399
317 Ga0265338_10004224 3300028800 Bacteria 19552
318 Ga0265338_10005162 3300028800 Bacteria 17168
319 Ga0265324_10002929 3300029957 Bacteria 8367
320 Ga0307512_10007181 3300030522 Bacteria 11085
321 Ga0307512_10008020 3300030522 Bacteria 10360
322 Ga0265332_10014040 3300031238 Bacteria 3543
323 Ga0265320_10000584 3300031240 Bacteria 28109
324 Ga0265320_10000631 3300031240 Bacteria 26946
325 Ga0265320_10023782 3300031240 Bacteria 3253
326 Ga0265325_10079709 3300031241 Bacteria 1629
327 Ga0307513_10001838 3300031456 Bacteria 30130
328 Ga0307513_10004469 3300031456 Bacteria 18672
329 Ga0307509_10047050 3300031507 Bacteria 4641
330 Ga0265313_10020736 3300031595 Bacteria 3617
331 Ga0307508_10002212 3300031616 Bacteria 20747
332 Ga0307508_10019006 3300031616 Bacteria 6243
333 Ga0307508_10026744 3300031616 Bacteria 5229
334 Ga0316579_10011725 3300031691 Bacteria 3733
335 Ga0265314_10001042 3300031711 Bacteria 32320
336 Ga0265342_10013750 3300031712 Bacteria 5406
337 Ga0307518_10002915 3300031838 Bacteria 12420
338 Ga0307412_10013256 3300031911 Bacteria 4826
339 Ga0307409_100011709 3300031995 Bacteria 5548
340 Ga0307409_100105678 3300031995 Bacteria 2348
341 Ga0307409_100141808 3300031995 Bacteria 2072
342 Ga0307409_100159216 3300031995 Bacteria 1972
343 Ga0307414_10003714 3300032004 Bacteria 8186
344 Ga0307414_10182977 3300032004 Bacteria 1687
345 Ga0307415_100003630 3300032126 Bacteria 7889
346 Ga0307415_100161534 3300032126 Bacteria 1737
347 Ga0307507_10004675 3300033179 Bacteria 23774
348 Ga0307507_10047549 3300033179 Bacteria 4187
349 Ga0307510_10003235 3300033180 Bacteria 18933
350 Ga0307510_10025725 3300033180 Bacteria 6782
351 Ga0307510_10040826 3300033180 Bacteria 5084
352 Ga0373926_0001284 3300035083 Bacteria 7557
353 Ga0373923_0014478 3300035111 Bacteria 2963
354 Ga0373936_0002046 3300035113 Bacteria 7472
355 Ga0373936_0011727 3300035113 Bacteria 3324
356 Ga0373945_0000375 3300035116 Bacteria 12851
357 Ga0373953_0015437 3300035117 Bacteria 2768
358 Ga0373953_0022533 3300035117 Bacteria 2376
359 Ga0373953_0031235 3300035117 Bacteria 2070
360 Ga0373956_0000970 3300035119 Bacteria 11908
361 Ga0373956_0009086 3300035119 Bacteria 4030
362 Ga0373957_0014511 3300035120 Bacteria 2694
363 Ga0373960_0013726 3300035121 Bacteria 2039
364 Ga0373943_0000129 3300035170 Bacteria 28679
365 Ga0373943_0001180 3300035170 Bacteria 11664
366 Ga0373946_0000242 3300035171 Bacteria 17204
367 Ga0373946_0002798 3300035171 Bacteria 6168
368 Ga0373955_0005820 3300035172 Bacteria 5567
369 Ga0373955_0050635 3300035172 Bacteria 2259
370 Ga0373924_0000750 3300035410 Bacteria 10109
371 Ga0373924_0004493 3300035410 Bacteria 4877
372 Ga0373924_0021296 3300035410 Bacteria 2527
373 Ga0373935_0014178 3300035692 Unclassified 4809
374 Ga0373935_0014651 3300035692 Bacteria 4731
375 Ga0373935_0021142 3300035692 Bacteria 3983
376 Ga0373927_0003873 3300035695 Bacteria 10609
377 Ga0373933_0015835 3300035724 Bacteria 4208
378 Ga0373933_0020652 3300035724 Bacteria 3733
379 Ga0373947_0001856 3300035725 Bacteria 12880
380 Ga0373947_0015165 3300035725 Bacteria 4424
381 Ga0373947_0068144 3300035725 Bacteria 2175
382 Ga0372808_002217 3300036459 Bacteria 2200
383 Ga0316584_0022151 3300036712 Unclassified 4631
384 Ga0373925_0000177 3300037068 Bacteria 69605
385 Ga0373925_0003615 3300037068 Bacteria 11916
386 Ga0373925_0032872 3300037068 Bacteria 3820
387 Ga0373925_0082139 3300037068 Bacteria 2452
388 Ga0373925_0142407 3300037068 Bacteria 1877
389 Ga0395899_0000091 3300037312 Bacteria 154780
390 Ga0395900_0000008 3300037418 Bacteria 480459
391 Ga0395898_0002459 3300037466 Bacteria 21851
392 Ga0395898_0017952 3300037466 Bacteria 7218
393 Ga0395898_0058182 3300037466 Bacteria 3764
394 Ga0395898_0074973 3300037466 Bacteria 3268
395 Ga0395905_0046457 3300037471 Bacteria 4071
396 Ga0436364_0103177 3300037853 Bacteria 67977
397 Ga0436364_0764299 3300037853 Bacteria 2189
398 Ga0436364_1261928 3300037853 Bacteria 13312
399 Ga0395901_0000008 3300038443 Bacteria 495962
400 Ga0436365_1238059 3300039437 Bacteria 1804
401 Ga0436365_1885236 3300039437 Bacteria 5379
402 Ga0451833_1162688 3300041491 Bacteria 4749
403 Ga0451853_0323525 3300041512 Bacteria 6063
404 Ga0439445_0004315 3300042004 Bacteria 3218
405 Ga0450911_000124 3300042115 Bacteria 30673
406 Ga0451577_0083155 3300042876 Bacteria 2855
407 Ga0466972_0001395 3300044658 Bacteria 11710
408 Ga0466972_0033019 3300044658 Bacteria 2539
409 Ga0466960_0012342 3300044901 Bacteria 3602
410 Ga0466967_0018193 3300045976 Bacteria 5606
411 Ga0495627_000078 3300046453 Bacteria 119920
412 Ga0495627_000939 3300046453 Bacteria 20046
413 Ga0495592_0003588 3300046454 Bacteria 11156
414 Ga0495592_0033654 3300046454 Bacteria 3865
415 Ga0495603_0004389 3300046455 Bacteria 8406
416 Ga0495641_0011856 3300046461 Bacteria 4925
417 Ga0495651_0000950 3300046462 Bacteria 22399
418 Ga0495651_0032332 3300046462 Bacteria 4081
419 Ga0495651_0090440 3300046462 Bacteria 2296
420 Ga0495653_0008312 3300046463 Bacteria 8506
421 Ga0495653_0012779 3300046463 Bacteria 6854
422 Ga0495653_0062980 3300046463 Bacteria 2801
423 Ga0495653_0104813 3300046463 Bacteria 2043
424 Ga0495580_0011006 3300046472 Bacteria 7011
425 Ga0495580_0016612 3300046472 Bacteria 5520
426 Ga0495582_0002565 3300046473 Bacteria 10112
427 Ga0495662_0000938 3300046476 Bacteria 14281
428 Ga0495594_0023142 3300046499 Unclassified 3326
429 Ga0495583_0004588 3300046506 Bacteria 9796
430 Ga0495608_0002908 3300046511 Bacteria 12260
431 Ga0495608_0034479 3300046511 Bacteria 3415
432 Ga0495608_0055321 3300046511 Bacteria 2622
433 Ga0495608_0059385 3300046511 Bacteria 2520
434 Ga0495610_0001502 3300046512 Bacteria 20504
435 Ga0495618_0011128 3300046514 Bacteria 5452
436 Ga0495618_0012264 3300046514 Bacteria 5203
437 Ga0495618_0171047 3300046514 Bacteria 1382
438 Ga0495628_0039393 3300046516 Bacteria 3780
439 Ga0495628_0057808 3300046516 Bacteria 3050
440 Ga0495630_0001927 3300046517 Bacteria 14476
441 Ga0495630_0051296 3300046517 Bacteria 3088
442 Ga0495631_0046322 3300046518 Bacteria 1912
443 Ga0495632_0000001 3300046519 Bacteria 873295
444 Ga0495637_0000088 3300046520 Bacteria 71915
445 Ga0495637_0004718 3300046520 Bacteria 7035
446 Ga0495643_0000006 3300046522 Bacteria 419524
447 Ga0495648_0002964 3300046524 Bacteria 15231
448 Ga0495648_0025371 3300046524 Bacteria 4014
449 Ga0495663_0000001 3300046525 Bacteria 595264
450 Ga0495666_0021076 3300046526 Bacteria 3227
451 Ga0495666_0061266 3300046526 Bacteria 1798
452 Ga0495652_0005862 3300046529 Bacteria 11496
453 Ga0495652_0008046 3300046529 Bacteria 9660
454 Ga0495652_0016357 3300046529 Bacteria 6636
455 Ga0495652_0042844 3300046529 Bacteria 3902
456 Ga0495665_0001964 3300046531 Bacteria 11105
457 Ga0495640_0009996 3300046533 Bacteria 7356
458 Ga0495640_0065988 3300046533 Bacteria 2441
459 Ga0495586_0002352 3300046535 Bacteria 10291
460 Ga0495587_0000345 3300046536 Bacteria 33064
461 Ga0495587_0023240 3300046536 Unclassified 3810
462 Ga0495587_0030726 3300046536 Bacteria 3257
463 Ga0495645_0053901 3300046543 Bacteria 2922
464 Ga0495633_0000053 3300046558 Bacteria 152374
465 Ga0495633_0000424 3300046558 Bacteria 43906
466 Ga0495667_0003206 3300046559 Bacteria 10968
467 Ga0495667_0004058 3300046559 Bacteria 9838
468 Ga0495667_0033563 3300046559 Bacteria 3434
469 Ga0495668_0062364 3300046616 Bacteria 2054
470 Ga0495634_0011880 3300046642 Bacteria 6327
471 Ga0495625_0000014 3300046660 Bacteria 323486
472 Ga0495625_0000373 3300046660 Bacteria 68625
473 Ga0495635_0001305 3300046663 Bacteria 16644
474 Ga0495635_0006403 3300046663 Bacteria 8206
475 Ga0495635_0012165 3300046663 Bacteria 6034
476 Ga0495635_0028428 3300046663 Bacteria 3886
477 Ga0495588_0008813 3300046674 Bacteria 4637
478 Ga0495657_0003044 3300046675 Bacteria 13872
479 Ga0495657_0009809 3300046675 Bacteria 7229
480 Ga0495657_0015303 3300046675 Bacteria 5616
481 Ga0495599_0010916 3300046678 Bacteria 5568
482 Ga0495599_0021657 3300046678 Bacteria 4010
483 Ga0495599_0050948 3300046678 Bacteria 2594
484 Ga0495623_0008957 3300046679 Bacteria 6499
485 Ga0495623_0026268 3300046679 Bacteria 3749
486 Ga0495646_0025300 3300046680 Bacteria 3734
487 Ga0495646_0029906 3300046680 Bacteria 3402
488 Ga0495624_0000989 3300046690 Bacteria 22470
489 Ga0495624_0002326 3300046690 Bacteria 14470
490 Ga0495624_0002760 3300046690 Bacteria 13187
491 Ga0495670_0001666 3300046691 Bacteria 10897
492 Ga0495671_0000008 3300046692 Bacteria 419524
493 Ga0495671_0006971 3300046692 Bacteria 6480
494 Ga0495671_0029544 3300046692 Bacteria 2814
495 Ga0495600_0019097 3300046809 Bacteria 4373
496 Ga0495600_0026610 3300046809 Bacteria 3734
497 Ga0495600_0036267 3300046809 Bacteria 3204
498 Ga0495581_0000510 3300047315 Bacteria 19910
499 Ga0495581_0020951 3300047315 Bacteria 3793
500 Ga0495604_0000884 3300047317 Bacteria 24919
501 Ga0495604_0006999 3300047317 Bacteria 8937
502 Ga0495604_0084086 3300047317 Bacteria 2377
503 Ga0495674_0003043 3300047319 Bacteria 16312
504 Ga0495674_0012615 3300047319 Bacteria 7962
505 Ga0495674_0018553 3300047319 Bacteria 6475
506 Ga0495674_0040366 3300047319 Bacteria 4175
507 Ga0495674_0102978 3300047319 Bacteria 2427
508 Ga0495672_0006713 3300047320 Bacteria 8834
509 Ga0495672_0015785 3300047320 Bacteria 5115
510 Ga0495676_0002502 3300047321 Bacteria 16361
511 Ga0495676_0021417 3300047321 Bacteria 5645
512 Ga0495680_0008897 3300047322 Bacteria 9077
513 Ga0495680_0018754 3300047322 Bacteria 5864
514 Ga0495680_0022567 3300047322 Bacteria 5242
515 Ga0495680_0051412 3300047322 Bacteria 3217
516 Ga0495680_0052464 3300047322 Bacteria 3178
517 Ga0495675_0009340 3300047444 Bacteria 6099
518 Ga0495675_0023179 3300047444 Bacteria 3956
519 Ga0495675_0026882 3300047444 Bacteria 3668
520 Ga0495677_0001245 3300047445 Bacteria 10197
521 Ga0495681_0000022 3300047470 Bacteria 165281
522 Ga0495681_0002045 3300047470 Bacteria 14697
523 Ga0495684_0007992 3300047471 Bacteria 8176
524 Ga0495684_0008048 3300047471 Bacteria 8152
525 Ga0495684_0013394 3300047471 Bacteria 6312
526 Ga0495684_0039063 3300047471 Bacteria 3638
527 Ga0495684_0042567 3300047471 Bacteria 3478
528 Ga0495686_0008331 3300047472 Bacteria 7620
529 Ga0495686_0036614 3300047472 Bacteria 3149
530 Ga0495686_0039467 3300047472 Bacteria 3015
531 Ga0495593_0051201 3300047673 Bacteria 2185
532 Ga0495602_0009207 3300048088 Bacteria 10278
533 Ga0495602_0045787 3300048088 Bacteria 3956
534 Ga0495602_0072763 3300048088 Bacteria 2929
535 Ga0495602_0110417 3300048088 Bacteria 2235
536 Ga0495602_0114340 3300048088 Bacteria 2185
537 Ga0496100_0001545 3300048903 Bacteria 11304
538 Ga0496101_0006501 3300048904 Bacteria 7525
539 Ga0496101_0031887 3300048904 Bacteria 3706
540 Ga0496101_0080995 3300048904 Bacteria 2400
541 Ga0496102_0000286 3300048905 Bacteria 64518
542 Ga0496102_0000597 3300048905 Bacteria 37872
543 Ga0496102_0006754 3300048905 Bacteria 9795
544 Ga0496102_0032587 3300048905 Bacteria 4681
545 Ga0496102_0051173 3300048905 Bacteria 3763
546 Ga0496102_0116117 3300048905 Bacteria 2498
547 Ga0496103_0000490 3300048906 Bacteria 32894
548 Ga0496104_0001473 3300048907 Bacteria 20326
549 Ga0496104_0003060 3300048907 Bacteria 14414
550 Ga0496104_0003963 3300048907 Bacteria 12814
551 Ga0496104_0008437 3300048907 Bacteria 9162
552 Ga0496104_0024032 3300048907 Bacteria 5607
553 Ga0496104_0198845 3300048907 Bacteria 1916
554 Ga0496104_0241722 3300048907 Bacteria 1718
555 Ga0496105_0002023 3300048908 Bacteria 14649
556 Ga0496105_0011879 3300048908 Bacteria 6896
557 Ga0496105_0012595 3300048908 Bacteria 6697
558 Ga0496105_0014155 3300048908 Bacteria 6347
559 Ga0496105_0102504 3300048908 Bacteria 2363
560 Ga0496106_0027628 3300048909 Bacteria 4227
561 Ga0496106_0122083 3300048909 Bacteria 2037
562 Ga0496107_0079383 3300048910 Bacteria 2392
563 Ga0496107_0083010 3300048910 Bacteria 2336
564 Ga0496107_0135991 3300048910 Bacteria 1815
565 Ga0496108_0010632 3300048911 Bacteria 7465
566 Ga0496108_0017998 3300048911 Bacteria 5780
567 Ga0496108_0039650 3300048911 Bacteria 3925
568 Ga0496108_0051720 3300048911 Bacteria 3441
569 Ga0496108_0114705 3300048911 Bacteria 2307
570 Ga0496109_0011608 3300048912 Bacteria 7576
571 Ga0496109_0031161 3300048912 Bacteria 4783
572 Ga0496109_0032929 3300048912 Bacteria 4663
573 Ga0496109_0045004 3300048912 Bacteria 4005
574 Ga0496109_0073903 3300048912 Bacteria 3133
575 Ga0496110_0001000 3300048913 Bacteria 19881
576 Ga0496110_0004537 3300048913 Bacteria 10778
577 Ga0496110_0066517 3300048913 Bacteria 3187
578 Ga0496111_0013741 3300048914 Bacteria 5515
579 Ga0496111_0017504 3300048914 Bacteria 4956
580 Ga0496111_0021375 3300048914 Bacteria 4517
581 Ga0496112_0018227 3300048915 Bacteria 6608
582 Ga0496112_0035818 3300048915 Bacteria 4837
583 Ga0496112_0208399 3300048915 Bacteria 1912
584 Ga0496113_0028398 3300048916 Bacteria 4023
585 Ga0496113_0063145 3300048916 Bacteria 2799
586 Ga0496113_0111440 3300048916 Bacteria 2130
587 Ga0496114_0008354 3300048917 Bacteria 8200
588 Ga0496114_0014087 3300048917 Bacteria 6411
589 Ga0496114_0027090 3300048917 Bacteria 4695
590 Ga0496114_0048288 3300048917 Bacteria 3540
591 Ga0496114_0065841 3300048917 Bacteria 3036
592 Ga0496114_0110278 3300048917 Bacteria 2357
593 Ga0496114_0152875 3300048917 Bacteria 2002
594 Ga0496114_0181426 3300048917 Bacteria 1839
595 Ga0496115_0012725 3300048918 Bacteria 6341
596 Ga0496115_0030072 3300048918 Bacteria 4270
597 Ga0496115_0279334 3300048918 Bacteria 1371
598 Ga0496116_0000716 3300048919 Bacteria 42501
599 Ga0496117_0000579 3300048920 Bacteria 60223
600 Ga0496118_0000587 3300048921 Bacteria 60205
601 Ga0496119_0001329 3300048922 Bacteria 30377
602 Ga0496120_0002815 3300048923 Bacteria 16800
603 Ga0496121_0016612 3300048924 Bacteria 7585
604 Ga0496123_0010794 3300048926 Bacteria 8015
605 Ga0496124_0063030 3300048927 Bacteria 3099
606 Ga0496125_0003687 3300048928 Bacteria 18296
607 Ga0496125_0004511 3300048928 Bacteria 16008
608 Ga0496126_0000272 3300048929 Bacteria 110072
609 Ga0496126_0000588 3300048929 Bacteria 68756
610 Ga0496126_0000649 3300048929 Bacteria 64480
611 Ga0496126_0020830 3300048929 Bacteria 6418
612 Ga0496126_0025832 3300048929 Bacteria 5643
613 Ga0496126_0088657 3300048929 Bacteria 2725
614 Ga0501033_0065851 3300049570 Bacteria 2665
615 Ga0501034_0020094 3300049571 Bacteria 6820
616 Ga0501036_0005090 3300049572 Bacteria 10639
617 Ga0501038_0038142 3300049574 Bacteria 4209
618 Ga0501038_0038679 3300049574 Bacteria 4176
619 Ga0501039_0061030 3300049575 Bacteria 2920
620 Ga0501043_0017475 3300049579 Bacteria 5623
621 Ga0501046_0035807 3300049580 Bacteria 3998
622 Ga0501047_0000514 3300049581 Bacteria 41781
623 Ga0501047_0012506 3300049581 Bacteria 8038
624 Ga0501048_0073434 3300049582 Bacteria 2414
625 Ga0501067_0016723 3300049583 Bacteria 4053
626 Ga0501067_0051568 3300049583 Bacteria 2280
627 Ga0501067_0054191 3300049583 Bacteria 2222
628 Ga0501071_0018860 3300049587 Bacteria 4784
629 Ga0501072_0004592 3300049588 Bacteria 10510
630 nmdc:mga00v17_3991_c1 3300050491 Bacteria 7618
631 nmdc:mga0yw44_11116_c1 3300050492 Bacteria 4628
632 nmdc:mga0yw44_15782_c1 3300050492 Bacteria 4059
633 nmdc:mga07m45_21284_c1 3300050496 Bacteria 3529
634 nmdc:mga05p37_6701_c1 3300050507 Bacteria 13571
635 nmdc:mga09592_71_c1 3300050508 Bacteria 57332
636 nmdc:mga0qj67_6384_c1 3300050509 Bacteria 8660
637 nmdc:mga06r32_31467_c1 3300050510 Bacteria 4984
638 nmdc:mga08y16_55524_c1 3300050511 Bacteria 4138
639 nmdc:mga0rr50_109703_c1 3300050513 Bacteria 2182
640 nmdc:mga0a205_86348_c1 3300050515 Bacteria 3030
641 Ga0495601_0043059 3300053077 Bacteria 2835
642 Ga0495612_0026850 3300053078 Bacteria 2313
643 Ga0495595_0019955 3300053084 Bacteria 2912
644 Ga0495619_0012890 3300053085 Bacteria 5265
645 Ga0495619_0099843 3300053085 Bacteria 1974
646 Ga0500643_000221 3300053087 Bacteria 53085
647 Ga0500566_0006585 3300053094 Bacteria 6885
648 Ga0500641_0020714 3300053096 Bacteria 2498
649 Ga0500556_0000532 3300053104 Bacteria 26053
650 Ga0500594_0006883 3300053118 Bacteria 2563
651 Ga0500568_0001089 3300053139 Bacteria 18282
652 Ga0500568_0030813 3300053139 Bacteria 2218
653 Ga0500604_0000011 3300053151 Bacteria 104892
654 Ga0500616_0000123 3300053153 Bacteria 140214
655 Ga0500627_0000001 3300053158 Bacteria 251552
656 Ga0501084_0006171 3300054114 Bacteria 9857

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0079383 Ga0496107_0079383_1046_2341 399
2 3300013306 Ga0163162_10112126 Ga0163162_101121263 405
3 3300049570 Ga0501033_0065851 Ga0501033_0065851_307_1638 405
4 3300048918 Ga0496115_0279334 Ga0496115_0279334_34_1359 409
5 3300046514 Ga0495618_0171047 Ga0495618_0171047_12_1358 413
6 3300048917 Ga0496114_0152875 Ga0496114_0152875_540_1964 423
7 3300046518 Ga0495631_0046322 Ga0495631_0046322_530_1897 424
8 3300047322 Ga0495680_0022567 Ga0495680_0022567_1196_2632 429
9 3300048910 Ga0496107_0135991 Ga0496107_0135991_390_1802 438
10 3300035119 Ga0373956_0000970 Ga0373956_0000970_5281_6834 451
11 3300048903 Ga0496100_0001545 Ga0496100_0001545_3378_4997 451
12 3300048904 Ga0496101_0006501 Ga0496101_0006501_3194_4813 451
13 3300048908 Ga0496105_0012595 Ga0496105_0012595_1488_3110 451
14 3300048922 Ga0496119_0001329 Ga0496119_0001329_6339_7961 451
15 3300048923 Ga0496120_0002815 Ga0496120_0002815_2858_4480 451
16 3300048927 Ga0496124_0063030 Ga0496124_0063030_149_1771 451
17 3300033179 Ga0307507_10047549 Ga0307507_100475493 453
18 3300053085 Ga0495619_0012890 Ga0495619_0012890_2538_4001 453
19 3300031995 Ga0307409_100141808 Ga0307409_1001418082 457
20 3300046463 Ga0495653_0104813 Ga0495653_0104813_15_1478 457
21 3300025928 Ga0207700_10028349 Ga0207700_100283493 460
22 3300048912 Ga0496109_0073903 Ga0496109_0073903_552_2102 460
23 3300005841 Ga0068863_100034139 Ga0068863_1000341394 462
24 3300005985 Ga0081539_10000999 Ga0081539_1000099958 462
25 3300026088 Ga0207641_10013183 Ga0207641_100131831 462
26 3300028800 Ga0265338_10005162 Ga0265338_1000516210 462
27 3300048905 Ga0496102_0000286 Ga0496102_0000286_6300_7922 462
28 3300048906 Ga0496103_0000490 Ga0496103_0000490_6301_7923 462
29 3300048919 Ga0496116_0000716 Ga0496116_0000716_6301_7923 462
30 3300048920 Ga0496117_0000579 Ga0496117_0000579_24008_25630 462
31 3300048921 Ga0496118_0000587 Ga0496118_0000587_34576_36198 462
32 3300048929 Ga0496126_0000649 Ga0496126_0000649_56588_58210 462
33 3300005577 Ga0068857_100081984 Ga0068857_1000819842 463
34 3300026116 Ga0207674_10080075 Ga0207674_100800752 463
35 3300048917 Ga0496114_0014087 Ga0496114_0014087_3681_5216 464
36 3300035113 Ga0373936_0002046 Ga0373936_0002046_2711_4261 465
37 3300035116 Ga0373945_0000375 Ga0373945_0000375_1508_3058 465
38 3300035170 Ga0373943_0000129 Ga0373943_0000129_5188_6738 465
39 3300035171 Ga0373946_0000242 Ga0373946_0000242_7602_9152 465
40 3300035692 Ga0373935_0014651 Ga0373935_0014651_1578_3128 465
41 3300035695 Ga0373927_0003873 Ga0373927_0003873_4285_5835 465
42 3300035725 Ga0373947_0001856 Ga0373947_0001856_7959_9509 465
43 3300037068 Ga0373925_0003615 Ga0373925_0003615_2404_3954 465
44 3300046461 Ga0495641_0011856 Ga0495641_0011856_1941_3491 465
45 3300046462 Ga0495651_0090440 Ga0495651_0090440_474_2024 465
46 3300046463 Ga0495653_0062980 Ga0495653_0062980_339_1889 465
47 3300046517 Ga0495630_0051296 Ga0495630_0051296_909_2459 465
48 3300046529 Ga0495652_0016357 Ga0495652_0016357_4150_5700 465
49 3300046559 Ga0495667_0003206 Ga0495667_0003206_4465_6015 465
50 3300046663 Ga0495635_0001305 Ga0495635_0001305_11918_13468 465
51 3300046690 Ga0495624_0002760 Ga0495624_0002760_903_2453 465
52 3300047319 Ga0495674_0018553 Ga0495674_0018553_3783_5333 465
53 3300047471 Ga0495684_0008048 Ga0495684_0008048_5750_7300 465
54 iso_pu_bacteria 2643221654 2644303094 465
55 iso_pu_bacteria 2915358134 2915363004 465
56 3300013105 Ga0157369_10033051 Ga0157369_100330514 466
57 3300046472 Ga0495580_0016612 Ga0495580_0016612_1254_2855 466
58 3300046526 Ga0495666_0021076 Ga0495666_0021076_1604_3205 466
59 3300046690 Ga0495624_0000989 Ga0495624_0000989_17698_19299 466
60 3300047317 Ga0495604_0084086 Ga0495604_0084086_228_1829 466
61 3300047322 Ga0495680_0018754 Ga0495680_0018754_3379_4980 466
62 3300025302 Ga0207426_1007082 Ga0207426_10070822 467
63 3300049587 Ga0501071_0018860 Ga0501071_0018860_1799_3289 467
64 3300045976 Ga0466967_0018193 Ga0466967_0018193_2753_4240 468
65 3300046511 Ga0495608_0059385 Ga0495608_0059385_181_1785 468
66 3300005329 Ga0070683_100013188 Ga0070683_1000131885 469
67 3300005334 Ga0068869_100009568 Ga0068869_1000095685 469
68 3300005337 Ga0070682_100101305 Ga0070682_1001013051 469
69 3300005356 Ga0070674_100041183 Ga0070674_1000411833 469
70 3300005466 Ga0070685_10086558 Ga0070685_100865582 469
71 3300005617 Ga0068859_100109284 Ga0068859_1001092843 469
72 3300006931 Ga0097620_100109284 Ga0097620_1001092843 469
73 3300009094 Ga0111539_10089136 Ga0111539_100891363 469
74 3300025901 Ga0207688_10000995 Ga0207688_1000099512 469
75 3300026067 Ga0207678_10019597 Ga0207678_100195974 469
76 3300026118 Ga0207675_100149280 Ga0207675_1001492802 469
77 3300046678 Ga0495599_0050948 Ga0495599_0050948_536_2137 469
78 3300047444 Ga0495675_0009340 Ga0495675_0009340_1528_3129 469
79 3300049574 Ga0501038_0038679 Ga0501038_0038679_1769_3259 469
80 iso_pu_bacteria 2565956761 2566995155 469
81 iso_pu_bacteria 2643221561 2643827547 469
82 iso_pu_bacteria 2643221696 2644533622 469
83 iso_pu_bacteria 2738541308 2738889451 469
84 iso_pu_bacteria 2904535858 2904537321 469
85 iso_pu_bacteria 2922554459 2922559064 469
86 3300005543 Ga0070672_100148817 Ga0070672_1001488171 470
87 3300049579 Ga0501043_0017475 Ga0501043_0017475_2314_3831 470
88 3300049581 Ga0501047_0000514 Ga0501047_0000514_36801_38318 470
89 3300049582 Ga0501048_0073434 Ga0501048_0073434_107_1615 470
90 3300049588 Ga0501072_0004592 Ga0501072_0004592_2867_4375 470
91 iso_pu_bacteria 2824704595 2824709430 470
92 iso_pu_bacteria 2824753945 2824757730 470
93 iso_pu_bacteria 2824763712 2824768758 470
94 iso_pu_bacteria 2904711408 2904713068 470
95 3300005347 Ga0070668_100039888 Ga0070668_1000398882 471
96 3300005354 Ga0070675_100196275 Ga0070675_1001962751 471
97 3300005366 Ga0070659_100058748 Ga0070659_1000587482 471
98 3300005457 Ga0070662_100042699 Ga0070662_1000426993 471
99 3300005719 Ga0068861_100021704 Ga0068861_1000217043 471
100 3300009553 Ga0105249_10170644 Ga0105249_101706442 471
101 3300014745 Ga0157377_10065040 Ga0157377_100650402 471
102 3300025321 Ga0207656_10053774 Ga0207656_100537742 471
103 3300025919 Ga0207657_10056571 Ga0207657_100565712 471
104 3300025927 Ga0207687_10166833 Ga0207687_101668331 471
105 3300025933 Ga0207706_10145110 Ga0207706_101451102 471
106 3300026023 Ga0207677_10068782 Ga0207677_100687822 471
107 3300032126 Ga0307415_100003630 Ga0307415_1000036304 471
108 3300033180 Ga0307510_10040826 Ga0307510_100408263 471
109 3300036459 Ga0372808_002217 Ga0372808_002217_617_2185 471
110 3300048909 Ga0496106_0122083 Ga0496106_0122083_213_1721 471
111 3300048929 Ga0496126_0000272 Ga0496126_0000272_22929_24497 471
112 iso_pu_bacteria 2513237104 2513718960 471
113 iso_pu_bacteria 2513237141 2513891068 471
114 3300005337 Ga0070682_100057762 Ga0070682_1000577622 472
115 3300005466 Ga0070685_10071439 Ga0070685_100714392 472
116 3300005548 Ga0070665_100072533 Ga0070665_1000725333 472
117 3300005834 Ga0068851_10061692 Ga0068851_100616922 472
118 3300005844 Ga0068862_100022922 Ga0068862_1000229222 472
119 3300005937 Ga0081455_10084898 Ga0081455_100848982 472
120 3300009551 Ga0105238_10163190 Ga0105238_101631901 472
121 3300025907 Ga0207645_10032768 Ga0207645_100327683 472
122 3300025933 Ga0207706_10009888 Ga0207706_100098888 472
123 3300026067 Ga0207678_10069896 Ga0207678_100698962 472
124 3300026121 Ga0207683_10139381 Ga0207683_101393812 472
125 3300050496 nmdc:mga07m45_21284_c1 nmdc:mga07m45_21284_c1_411_1922 472
126 3300053104 Ga0500556_0000532 Ga0500556_0000532_12173_13738 472
127 3300054114 Ga0501084_0006171 Ga0501084_0006171_8136_9644 472
128 iso_pu_bacteria 2585427649 2586061796 472
129 iso_pu_bacteria 2643221615 2644090252 472
130 iso_pu_bacteria 2643221657 2644320097 472
131 iso_pu_bacteria 8047710418 8047720425 472
132 3300031456 Ga0307513_10004469 Ga0307513_1000446911 473
133 3300031691 Ga0316579_10011725 Ga0316579_100117252 473
134 3300036712 Ga0316584_0022151 Ga0316584_0022151_2050_3639 473
135 3300046616 Ga0495668_0062364 Ga0495668_0062364_99_1619 473
136 3300047315 Ga0495581_0020951 Ga0495581_0020951_649_2169 473
137 3300048905 Ga0496102_0051173 Ga0496102_0051173_1748_3271 473
138 3300048907 Ga0496104_0003963 Ga0496104_0003963_10317_11840 473
139 3300048908 Ga0496105_0011879 Ga0496105_0011879_4955_6478 473
140 3300048911 Ga0496108_0114705 Ga0496108_0114705_369_1961 473
141 3300048917 Ga0496114_0008354 Ga0496114_0008354_1956_3479 473
142 iso_pu_bacteria 2738543034 2739362509 473
143 iso_pu_bacteria 2818991472 2819745855 473
144 iso_pu_bacteria 2974315732 2974319439 473
145 iso_pu_bacteria 2984523437 2984527645 473
146 iso_pu_bacteria 8003314358 8003317686 473
147 iso_pu_bacteria 8054472261 8054475976 473
148 3300005329 Ga0070683_100075807 Ga0070683_1000758073 474
149 3300005471 Ga0070698_100001126 Ga0070698_1000011265 474
150 3300005840 Ga0068870_10054071 Ga0068870_100540712 474
151 3300026067 Ga0207678_10099774 Ga0207678_100997742 474
152 3300048905 Ga0496102_0006754 Ga0496102_0006754_7546_9072 474
153 3300048909 Ga0496106_0027628 Ga0496106_0027628_2677_4203 474
154 3300048912 Ga0496109_0032929 Ga0496109_0032929_2807_4333 474
155 3300048916 Ga0496113_0063145 Ga0496113_0063145_1219_2745 474
156 3300048917 Ga0496114_0065841 Ga0496114_0065841_1481_3007 474
157 3300048917 Ga0496114_0181426 Ga0496114_0181426_182_1711 474
158 iso_pu_bacteria 2643221576 2643891134 474
159 iso_pu_bacteria 2643221590 2643960190 474
160 iso_pu_bacteria 2808606522 2809590471 474
161 iso_pu_bacteria 2811994874 2812330364 474
162 iso_pu_bacteria 2811994878 2812350933 474
163 3300005335 Ga0070666_10029643 Ga0070666_100296433 475
164 3300005343 Ga0070687_100019362 Ga0070687_1000193622 475
165 3300005344 Ga0070661_100030912 Ga0070661_1000309121 475
166 3300005347 Ga0070668_100071753 Ga0070668_1000717532 475
167 3300005440 Ga0070705_100020353 Ga0070705_1000203532 475
168 3300005444 Ga0070694_100113622 Ga0070694_1001136222 475
169 3300005445 Ga0070708_100055574 Ga0070708_1000555742 475
170 3300005445 Ga0070708_100143161 Ga0070708_1001431613 475
171 3300005466 Ga0070685_10018383 Ga0070685_100183831 475
172 3300005518 Ga0070699_100002453 Ga0070699_1000024533 475
173 3300005530 Ga0070679_100024686 Ga0070679_1000246866 475
174 3300005536 Ga0070697_100003236 Ga0070697_10000323612 475
175 3300005543 Ga0070672_100041287 Ga0070672_1000412872 475
176 3300005577 Ga0068857_100041684 Ga0068857_1000416843 475
177 3300005718 Ga0068866_10034919 Ga0068866_100349192 475
178 3300005840 Ga0068870_10008775 Ga0068870_100087751 475
179 3300005841 Ga0068863_100054372 Ga0068863_1000543723 475
180 3300005842 Ga0068858_100047466 Ga0068858_1000474662 475
181 3300005983 Ga0081540_1000528 Ga0081540_100052811 475
182 3300006358 Ga0068871_100095675 Ga0068871_1000956752 475
183 3300009093 Ga0105240_10180463 Ga0105240_101804631 475
184 3300011119 Ga0105246_10038778 Ga0105246_100387783 475
185 3300012507 Ga0157342_1001046 Ga0157342_10010461 475
186 3300020070 Ga0206356_11380849 Ga0206356_113808492 475
187 3300020081 Ga0206354_10770736 Ga0206354_107707363 475
188 3300025885 Ga0207653_10002294 Ga0207653_100022946 475
189 3300025901 Ga0207688_10014437 Ga0207688_100144372 475
190 3300025906 Ga0207699_10004882 Ga0207699_100048824 475
191 3300025906 Ga0207699_10046955 Ga0207699_100469552 475
192 3300025908 Ga0207643_10063681 Ga0207643_100636812 475
193 3300025918 Ga0207662_10012788 Ga0207662_100127883 475
194 3300025919 Ga0207657_10020250 Ga0207657_100202505 475
195 3300025922 Ga0207646_10006511 Ga0207646_1000651110 475
196 3300025933 Ga0207706_10027818 Ga0207706_100278183 475
197 3300025939 Ga0207665_10006158 Ga0207665_1000615810 475
198 3300025940 Ga0207691_10045389 Ga0207691_100453892 475
199 3300026067 Ga0207678_10010983 Ga0207678_100109837 475
200 3300026078 Ga0207702_10011750 Ga0207702_100117506 475
201 3300026116 Ga0207674_10037641 Ga0207674_100376414 475
202 3300026118 Ga0207675_100043257 Ga0207675_1000432572 475
203 3300026121 Ga0207683_10023161 Ga0207683_100231615 475
204 3300031456 Ga0307513_10001838 Ga0307513_1000183827 475
205 3300031616 Ga0307508_10019006 Ga0307508_100190064 475
206 3300035083 Ga0373926_0001284 Ga0373926_0001284_5119_6645 475
207 3300035111 Ga0373923_0014478 Ga0373923_0014478_1303_2829 475
208 3300035117 Ga0373953_0015437 Ga0373953_0015437_1154_2680 475
209 3300035170 Ga0373943_0001180 Ga0373943_0001180_2165_3691 475
210 3300035171 Ga0373946_0002798 Ga0373946_0002798_4322_5848 475
211 3300035410 Ga0373924_0000750 Ga0373924_0000750_2372_3898 475
212 3300035692 Ga0373935_0014178 Ga0373935_0014178_1464_2990 475
213 3300035725 Ga0373947_0068144 Ga0373947_0068144_224_1750 475
214 3300037068 Ga0373925_0032872 Ga0373925_0032872_310_1836 475
215 3300046454 Ga0495592_0033654 Ga0495592_0033654_2116_3642 475
216 3300046463 Ga0495653_0012779 Ga0495653_0012779_3344_4870 475
217 3300046472 Ga0495580_0011006 Ga0495580_0011006_224_1750 475
218 3300046473 Ga0495582_0002565 Ga0495582_0002565_6989_8515 475
219 3300046476 Ga0495662_0000938 Ga0495662_0000938_4853_6379 475
220 3300046499 Ga0495594_0023142 Ga0495594_0023142_426_1952 475
221 3300046511 Ga0495608_0034479 Ga0495608_0034479_224_1750 475
222 3300046516 Ga0495628_0039393 Ga0495628_0039393_1782_3308 475
223 3300046516 Ga0495628_0057808 Ga0495628_0057808_224_1750 475
224 3300046517 Ga0495630_0001927 Ga0495630_0001927_6682_8208 475
225 3300046531 Ga0495665_0001964 Ga0495665_0001964_2691_4217 475
226 3300046533 Ga0495640_0065988 Ga0495640_0065988_564_2090 475
227 3300046535 Ga0495586_0002352 Ga0495586_0002352_2369_3895 475
228 3300046536 Ga0495587_0023240 Ga0495587_0023240_1147_2673 475
229 3300046543 Ga0495645_0053901 Ga0495645_0053901_224_1750 475
230 3300046559 Ga0495667_0033563 Ga0495667_0033563_1557_3083 475
231 3300046642 Ga0495634_0011880 Ga0495634_0011880_4578_6104 475
232 3300046663 Ga0495635_0006403 Ga0495635_0006403_6329_7855 475
233 3300046675 Ga0495657_0003044 Ga0495657_0003044_1429_2955 475
234 3300046680 Ga0495646_0025300 Ga0495646_0025300_224_1750 475
235 3300046690 Ga0495624_0002326 Ga0495624_0002326_4954_6480 475
236 3300046809 Ga0495600_0026610 Ga0495600_0026610_224_1750 475
237 3300047315 Ga0495581_0000510 Ga0495581_0000510_352_1878 475
238 3300047317 Ga0495604_0006999 Ga0495604_0006999_6479_8005 475
239 3300047319 Ga0495674_0003043 Ga0495674_0003043_12802_14328 475
240 3300047319 Ga0495674_0102978 Ga0495674_0102978_130_1656 475
241 3300047321 Ga0495676_0021417 Ga0495676_0021417_1557_3083 475
242 3300047322 Ga0495680_0052464 Ga0495680_0052464_224_1750 475
243 3300047444 Ga0495675_0026882 Ga0495675_0026882_153_1679 475
244 3300047471 Ga0495684_0042567 Ga0495684_0042567_352_1878 475
245 3300047673 Ga0495593_0051201 Ga0495593_0051201_224_1750 475
246 3300048088 Ga0495602_0072763 Ga0495602_0072763_1283_2809 475
247 3300048088 Ga0495602_0114340 Ga0495602_0114340_224_1750 475
248 3300048904 Ga0496101_0031887 Ga0496101_0031887_858_2384 475
249 3300048904 Ga0496101_0080995 Ga0496101_0080995_288_1826 475
250 3300048907 Ga0496104_0024032 Ga0496104_0024032_2798_4324 475
251 3300048907 Ga0496104_0198845 Ga0496104_0198845_262_1800 475
252 3300048908 Ga0496105_0102504 Ga0496105_0102504_432_1958 475
253 3300048911 Ga0496108_0051720 Ga0496108_0051720_1799_3325 475
254 3300048914 Ga0496111_0021375 Ga0496111_0021375_1798_3324 475
255 3300048916 Ga0496113_0111440 Ga0496113_0111440_190_1716 475
256 3300048917 Ga0496114_0048288 Ga0496114_0048288_1385_2923 475
257 3300048918 Ga0496115_0030072 Ga0496115_0030072_1997_3535 475
258 3300049575 Ga0501039_0061030 Ga0501039_0061030_1383_2906 475
259 3300053078 Ga0495612_0026850 Ga0495612_0026850_564_2090 475
260 3300053085 Ga0495619_0099843 Ga0495619_0099843_426_1952 475
261 iso_pu_bacteria 2824679649 2824682654 475
262 iso_pu_bacteria 2857481737 2857485266 475
263 iso_pu_bacteria 2891968417 2891971477 475
264 iso_pu_bacteria 2915768154 2915770696 475
265 iso_pu_bacteria 2917736166 2917739937 475
266 iso_pu_bacteria 2922393267 2922396334 475
267 iso_pu_bacteria 2932801729 2932806705 475
268 iso_pu_bacteria 2941531003 2941535615 475
269 iso_pu_bacteria 8006926726 8006928545 475
270 3300005347 Ga0070668_100000425 Ga0070668_10000042526 476
271 3300005844 Ga0068862_100027619 Ga0068862_1000276194 476
272 3300006042 Ga0075368_10004625 Ga0075368_100046255 476
273 3300013308 Ga0157375_10106674 Ga0157375_101066742 476
274 3300025928 Ga0207700_10013193 Ga0207700_100131933 476
275 3300025972 Ga0207668_10001956 Ga0207668_100019566 476
276 3300028794 Ga0307515_10046075 Ga0307515_100460754 476
277 3300031507 Ga0307509_10047050 Ga0307509_100470502 476
278 3300031838 Ga0307518_10002915 Ga0307518_100029153 476
279 3300035113 Ga0373936_0011727 Ga0373936_0011727_494_2023 476
280 3300035172 Ga0373955_0005820 Ga0373955_0005820_1410_2939 476
281 3300035172 Ga0373955_0050635 Ga0373955_0050635_63_1592 476
282 3300035724 Ga0373933_0015835 Ga0373933_0015835_440_1969 476
283 3300037466 Ga0395898_0074973 Ga0395898_0074973_170_1699 476
284 3300046559 Ga0495667_0004058 Ga0495667_0004058_5630_7159 476
285 3300046663 Ga0495635_0012165 Ga0495635_0012165_62_1591 476
286 3300046675 Ga0495657_0009809 Ga0495657_0009809_197_1726 476
287 3300047320 Ga0495672_0006713 Ga0495672_0006713_1725_3254 476
288 3300047322 Ga0495680_0051412 Ga0495680_0051412_1501_3030 476
289 3300048088 Ga0495602_0110417 Ga0495602_0110417_315_1844 476
290 3300048926 Ga0496123_0010794 Ga0496123_0010794_3025_4554 476
291 3300050492 nmdc:mga0yw44_15782_c1 nmdc:mga0yw44_15782_c1_1876_3405 476
292 3300053096 Ga0500641_0020714 Ga0500641_0020714_219_1748 476
293 iso_pu_bacteria 2643221604 2644035139 476
294 iso_pu_bacteria 2773857762 2774393064 476
295 iso_pu_bacteria 2818991318 2819426109 476
296 iso_pu_bacteria 2818991463 2819696995 476
297 iso_pu_bacteria 2966598605 2966605567 476
298 iso_pu_bacteria 3006493962 3006497949 476
299 3300005355 Ga0070671_100013148 Ga0070671_1000131484 477
300 3300005365 Ga0070688_100064672 Ga0070688_1000646722 477
301 3300005439 Ga0070711_100029686 Ga0070711_1000296862 477
302 3300005445 Ga0070708_100072383 Ga0070708_1000723833 477
303 3300005467 Ga0070706_100150348 Ga0070706_1001503482 477
304 3300005468 Ga0070707_100011160 Ga0070707_1000111604 477
305 3300005468 Ga0070707_100080783 Ga0070707_1000807832 477
306 3300005471 Ga0070698_100005767 Ga0070698_1000057677 477
307 3300005548 Ga0070665_100004605 Ga0070665_10000460517 477
308 3300005937 Ga0081455_10000724 Ga0081455_1000072414 477
309 3300006038 Ga0075365_10009286 Ga0075365_100092863 477
310 3300006048 Ga0075363_100035372 Ga0075363_1000353721 477
311 3300006178 Ga0075367_10064425 Ga0075367_100644252 477
312 3300025908 Ga0207643_10054170 Ga0207643_100541702 477
313 3300025915 Ga0207693_10016153 Ga0207693_100161534 477
314 3300025931 Ga0207644_10014395 Ga0207644_100143954 477
315 3300025939 Ga0207665_10002187 Ga0207665_100021877 477
316 3300028379 Ga0268266_10029429 Ga0268266_100294291 477
317 3300028556 Ga0265337_1003142 Ga0265337_10031427 477
318 3300028666 Ga0265336_10003485 Ga0265336_100034856 477
319 3300031238 Ga0265332_10014040 Ga0265332_100140404 477
320 3300033179 Ga0307507_10004675 Ga0307507_100046756 477
321 3300035117 Ga0373953_0031235 Ga0373953_0031235_402_1934 477
322 3300035119 Ga0373956_0009086 Ga0373956_0009086_2466_3998 477
323 3300035410 Ga0373924_0021296 Ga0373924_0021296_214_1746 477
324 3300035692 Ga0373935_0021142 Ga0373935_0021142_1486_3018 477
325 3300035724 Ga0373933_0020652 Ga0373933_0020652_1013_2545 477
326 3300037853 Ga0436364_0764299 Ga0436364_0764299_524_2056 477
327 3300044658 Ga0466972_0001395 Ga0466972_0001395_3361_4914 477
328 3300044658 Ga0466972_0033019 Ga0466972_0033019_883_2442 477
329 3300044901 Ga0466960_0012342 Ga0466960_0012342_101_1654 477
330 3300046462 Ga0495651_0032332 Ga0495651_0032332_1167_2699 477
331 3300046511 Ga0495608_0055321 Ga0495608_0055321_111_1643 477
332 3300046514 Ga0495618_0011128 Ga0495618_0011128_1406_2938 477
333 3300046529 Ga0495652_0042844 Ga0495652_0042844_1676_3208 477
334 3300046533 Ga0495640_0009996 Ga0495640_0009996_2637_4169 477
335 3300046663 Ga0495635_0028428 Ga0495635_0028428_692_2224 477
336 3300046675 Ga0495657_0015303 Ga0495657_0015303_1086_2618 477
337 3300046680 Ga0495646_0029906 Ga0495646_0029906_1535_3067 477
338 3300046809 Ga0495600_0019097 Ga0495600_0019097_2655_4187 477
339 3300047471 Ga0495684_0013394 Ga0495684_0013394_3992_5524 477
340 3300048088 Ga0495602_0045787 Ga0495602_0045787_899_2431 477
341 3300048929 Ga0496126_0000588 Ga0496126_0000588_10086_11621 477
342 3300050492 nmdc:mga0yw44_11116_c1 nmdc:mga0yw44_11116_c1_1362_2894 477
343 3300053077 Ga0495601_0043059 Ga0495601_0043059_841_2373 477
344 iso_pu_bacteria 2738541305 2738868914 477
345 iso_pu_bacteria 2984576629 2984580520 477
346 iso_pu_bacteria 2990256926 2990258212 477
347 3300002067 JGI24735J21928_10006642 JGI24735J21928_100066422 478
348 3300005367 Ga0070667_100041269 Ga0070667_1000412692 478
349 3300005467 Ga0070706_100033486 Ga0070706_1000334864 478
350 3300005471 Ga0070698_100004906 Ga0070698_10000490614 478
351 3300025304 Ga0209257_1006194 Ga0209257_10061944 478
352 3300025986 Ga0207658_10032959 Ga0207658_100329592 478
353 3300026116 Ga0207674_10052862 Ga0207674_100528622 478
354 3300028794 Ga0307515_10036149 Ga0307515_100361498 478
355 3300028800 Ga0265338_10004224 Ga0265338_1000422411 478
356 3300029957 Ga0265324_10002929 Ga0265324_100029292 478
357 3300030522 Ga0307512_10008020 Ga0307512_100080208 478
358 3300031240 Ga0265320_10023782 Ga0265320_100237822 478
359 3300031241 Ga0265325_10079709 Ga0265325_100797091 478
360 3300031595 Ga0265313_10020736 Ga0265313_100207364 478
361 3300031712 Ga0265342_10013750 Ga0265342_100137505 478
362 3300035120 Ga0373957_0014511 Ga0373957_0014511_1090_2637 478
363 3300037068 Ga0373925_0082139 Ga0373925_0082139_23_1570 478
364 3300037068 Ga0373925_0142407 Ga0373925_0142407_165_1721 478
365 3300046463 Ga0495653_0008312 Ga0495653_0008312_2344_3891 478
366 3300046511 Ga0495608_0002908 Ga0495608_0002908_3043_4590 478
367 3300046529 Ga0495652_0005862 Ga0495652_0005862_4954_6501 478
368 3300046536 Ga0495587_0030726 Ga0495587_0030726_776_2323 478
369 3300046678 Ga0495599_0021657 Ga0495599_0021657_2422_3969 478
370 3300046679 Ga0495623_0008957 Ga0495623_0008957_3997_5544 478
371 3300046809 Ga0495600_0036267 Ga0495600_0036267_38_1609 478
372 3300047317 Ga0495604_0000884 Ga0495604_0000884_18248_19795 478
373 3300047319 Ga0495674_0012615 Ga0495674_0012615_592_2139 478
374 3300047322 Ga0495680_0008897 Ga0495680_0008897_4975_6522 478
375 3300047444 Ga0495675_0023179 Ga0495675_0023179_192_1739 478
376 3300047471 Ga0495684_0039063 Ga0495684_0039063_1046_2617 478
377 3300048917 Ga0496114_0110278 Ga0496114_0110278_188_1771 478
378 3300048924 Ga0496121_0016612 Ga0496121_0016612_4761_6320 478
379 3300049572 Ga0501036_0005090 Ga0501036_0005090_2371_3927 478
380 iso_pu_bacteria 2643221617 2644101288 478
381 iso_pu_bacteria 2643221620 2644119306 478
382 iso_pu_bacteria 2643221683 2644464723 478
383 iso_pu_bacteria 2873151551 2873158729 478
384 iso_pu_bacteria 2904765812 2904767144 478
385 iso_pu_bacteria 2904770941 2904773896 478
386 iso_pu_bacteria 2908811453 2908814782 478
387 iso_pu_bacteria 2919420072 2919420417 478
388 iso_pu_bacteria 2919432681 2919433825 478
389 iso_pu_bacteria 3006321560 3006322908 478
390 3300003659 JGI25404J52841_10000235 JGI25404J52841_100002356 479
391 3300003791 Ga0055530_10000093 Ga0055530_1000009321 479
392 3300003791 Ga0055530_10000104 Ga0055530_1000010427 479
393 3300003794 Ga0055531_10000432 Ga0055531_1000043235 479
394 3300003794 Ga0055531_10002055 Ga0055531_1000205512 479
395 3300005329 Ga0070683_100002702 Ga0070683_1000027022 479
396 3300005329 Ga0070683_100010116 Ga0070683_1000101169 479
397 3300005334 Ga0068869_100077878 Ga0068869_1000778782 479
398 3300005338 Ga0068868_100037250 Ga0068868_1000372504 479
399 3300005355 Ga0070671_100050494 Ga0070671_1000504942 479
400 3300005445 Ga0070708_100016030 Ga0070708_1000160305 479
401 3300005468 Ga0070707_100015242 Ga0070707_1000152428 479
402 3300005518 Ga0070699_100011087 Ga0070699_1000110876 479
403 3300005535 Ga0070684_100003428 Ga0070684_1000034287 479
404 3300005564 Ga0070664_100001201 Ga0070664_10000120118 479
405 3300005841 Ga0068863_100069141 Ga0068863_1000691412 479
406 3300006358 Ga0068871_100020061 Ga0068871_1000200614 479
407 3300009094 Ga0111539_10000515 Ga0111539_1000051544 479
408 3300009098 Ga0105245_10020906 Ga0105245_100209063 479
409 3300010375 Ga0105239_10258978 Ga0105239_102589782 479
410 3300013296 Ga0157374_10073628 Ga0157374_100736281 479
411 3300013308 Ga0157375_10033927 Ga0157375_100339275 479
412 3300013308 Ga0157375_10138891 Ga0157375_101388912 479
413 3300014745 Ga0157377_10011005 Ga0157377_100110051 479
414 3300014968 Ga0157379_10018288 Ga0157379_100182887 479
415 3300014969 Ga0157376_10103403 Ga0157376_101034033 479
416 3300021320 Ga0214544_1000056 Ga0214544_1000056115 479
417 3300025291 Ga0209675_1000132 Ga0209675_100013266 479
418 3300025292 Ga0209676_1000085 Ga0209676_100008528 479
419 3300025292 Ga0209676_1000118 Ga0209676_100011810 479
420 3300025298 Ga0209050_1000115 Ga0209050_1000115112 479
421 3300025304 Ga0209257_1000160 Ga0209257_100016086 479
422 3300025304 Ga0209257_1000482 Ga0209257_100048228 479
423 3300025898 Ga0207692_10020664 Ga0207692_100206642 479
424 3300025901 Ga0207688_10080432 Ga0207688_100804322 479
425 3300025922 Ga0207646_10005267 Ga0207646_100052674 479
426 3300025926 Ga0207659_10027441 Ga0207659_100274413 479
427 3300025933 Ga0207706_10035702 Ga0207706_100357023 479
428 3300025939 Ga0207665_10111621 Ga0207665_101116212 479
429 3300025942 Ga0207689_10025359 Ga0207689_100253594 479
430 3300026023 Ga0207677_10042210 Ga0207677_100422103 479
431 3300026067 Ga0207678_10052876 Ga0207678_100528763 479
432 3300026075 Ga0207708_10021659 Ga0207708_100216592 479
433 3300026116 Ga0207674_10034983 Ga0207674_100349835 479
434 3300026116 Ga0207674_10035385 Ga0207674_100353853 479
435 3300027907 Ga0207428_10053149 Ga0207428_100531492 479
436 3300028380 Ga0268265_10101647 Ga0268265_101016471 479
437 3300031995 Ga0307409_100011709 Ga0307409_1000117092 479
438 3300032126 Ga0307415_100161534 Ga0307415_1001615342 479
439 3300035117 Ga0373953_0022533 Ga0373953_0022533_596_2122 479
440 3300035725 Ga0373947_0015165 Ga0373947_0015165_2685_4211 479
441 3300046454 Ga0495592_0003588 Ga0495592_0003588_2943_4469 479
442 3300046455 Ga0495603_0004389 Ga0495603_0004389_607_2172 479
443 3300046462 Ga0495651_0000950 Ga0495651_0000950_4680_6206 479
444 3300046514 Ga0495618_0012264 Ga0495618_0012264_1854_3380 479
445 3300046526 Ga0495666_0061266 Ga0495666_0061266_150_1676 479
446 3300046529 Ga0495652_0008046 Ga0495652_0008046_7648_9174 479
447 3300046536 Ga0495587_0000345 Ga0495587_0000345_27075_28601 479
448 3300046660 Ga0495625_0000373 Ga0495625_0000373_20084_21622 479
449 3300046674 Ga0495588_0008813 Ga0495588_0008813_2243_3781 479
450 3300046678 Ga0495599_0010916 Ga0495599_0010916_1622_3148 479
451 3300046679 Ga0495623_0026268 Ga0495623_0026268_1222_2748 479
452 3300047321 Ga0495676_0002502 Ga0495676_0002502_410_1975 479
453 3300047471 Ga0495684_0007992 Ga0495684_0007992_4536_6062 479
454 3300048088 Ga0495602_0009207 Ga0495602_0009207_1110_2636 479
455 3300048907 Ga0496104_0008437 Ga0496104_0008437_6713_8239 479
456 3300048913 Ga0496110_0004537 Ga0496110_0004537_7188_8714 479
457 3300048914 Ga0496111_0013741 Ga0496111_0013741_2935_4461 479
458 3300048915 Ga0496112_0035818 Ga0496112_0035818_2864_4390 479
459 3300050511 nmdc:mga08y16_55524_c1 nmdc:mga08y16_55524_c1_1137_2663 479
460 3300053084 Ga0495595_0019955 Ga0495595_0019955_1256_2782 479
461 3300053094 Ga0500566_0006585 Ga0500566_0006585_468_2006 479
462 iso_pu_bacteria 2808606439 2809196908 479
463 3300003373 JGI25407J50210_10003955 JGI25407J50210_100039552 480
464 3300005329 Ga0070683_100032144 Ga0070683_1000321443 480
465 3300005334 Ga0068869_100071657 Ga0068869_1000716572 480
466 3300005335 Ga0070666_10014340 Ga0070666_100143402 480
467 3300005337 Ga0070682_100067088 Ga0070682_1000670882 480
468 3300005364 Ga0070673_100047366 Ga0070673_1000473663 480
469 3300005367 Ga0070667_100233722 Ga0070667_1002337221 480
470 3300005406 Ga0070703_10010202 Ga0070703_100102022 480
471 3300005434 Ga0070709_10021541 Ga0070709_100215414 480
472 3300005435 Ga0070714_100021486 Ga0070714_1000214863 480
473 3300005436 Ga0070713_100057549 Ga0070713_1000575492 480
474 3300005437 Ga0070710_10007207 Ga0070710_100072073 480
475 3300005439 Ga0070711_100003971 Ga0070711_1000039718 480
476 3300005439 Ga0070711_100076887 Ga0070711_1000768872 480
477 3300005444 Ga0070694_100009061 Ga0070694_1000090614 480
478 3300005456 Ga0070678_100039449 Ga0070678_1000394493 480
479 3300005457 Ga0070662_100020261 Ga0070662_1000202613 480
480 3300005467 Ga0070706_100001943 Ga0070706_10000194319 480
481 3300005530 Ga0070679_100048194 Ga0070679_1000481944 480
482 3300005546 Ga0070696_100017808 Ga0070696_1000178082 480
483 3300005577 Ga0068857_100127933 Ga0068857_1001279332 480
484 3300005618 Ga0068864_100143672 Ga0068864_1001436722 480
485 3300005718 Ga0068866_10057655 Ga0068866_100576552 480
486 3300005840 Ga0068870_10097947 Ga0068870_100979471 480
487 3300005842 Ga0068858_100032909 Ga0068858_1000329092 480
488 3300005981 Ga0081538_10004167 Ga0081538_100041677 480
489 3300005985 Ga0081539_10007595 Ga0081539_100075954 480
490 3300006028 Ga0070717_10039004 Ga0070717_100390042 480
491 3300006163 Ga0070715_10020379 Ga0070715_100203792 480
492 3300006163 Ga0070715_10047190 Ga0070715_100471902 480
493 3300006175 Ga0070712_100005558 Ga0070712_1000055582 480
494 3300006175 Ga0070712_100006558 Ga0070712_1000065584 480
495 3300006175 Ga0070712_100010785 Ga0070712_1000107855 480
496 3300006852 Ga0075433_10053485 Ga0075433_100534854 480
497 3300007076 Ga0075435_100026319 Ga0075435_1000263192 480
498 3300009101 Ga0105247_10011549 Ga0105247_100115493 480
499 3300009176 Ga0105242_10051819 Ga0105242_100518192 480
500 3300009545 Ga0105237_10069511 Ga0105237_100695112 480
501 3300009551 Ga0105238_10103866 Ga0105238_101038662 480
502 3300009553 Ga0105249_10022755 Ga0105249_100227554 480
503 3300011119 Ga0105246_10004077 Ga0105246_100040775 480
504 3300013104 Ga0157370_10029089 Ga0157370_100290893 480
505 3300013105 Ga0157369_10071413 Ga0157369_100714133 480
506 3300013297 Ga0157378_10154159 Ga0157378_101541592 480
507 3300014326 Ga0157380_10047068 Ga0157380_100470684 480
508 3300014968 Ga0157379_10048224 Ga0157379_100482241 480
509 3300014969 Ga0157376_10020114 Ga0157376_100201142 480
510 3300017792 Ga0163161_10023742 Ga0163161_100237423 480
511 3300025885 Ga0207653_10015836 Ga0207653_100158362 480
512 3300025898 Ga0207692_10006037 Ga0207692_100060374 480
513 3300025898 Ga0207692_10008808 Ga0207692_100088082 480
514 3300025901 Ga0207688_10012849 Ga0207688_100128494 480
515 3300025903 Ga0207680_10029174 Ga0207680_100291743 480
516 3300025906 Ga0207699_10006490 Ga0207699_100064902 480
517 3300025910 Ga0207684_10002895 Ga0207684_100028954 480
518 3300025910 Ga0207684_10096748 Ga0207684_100967482 480
519 3300025915 Ga0207693_10001394 Ga0207693_100013947 480
520 3300025915 Ga0207693_10003334 Ga0207693_100033345 480
521 3300025915 Ga0207693_10008049 Ga0207693_100080493 480
522 3300025915 Ga0207693_10021512 Ga0207693_100215123 480
523 3300025916 Ga0207663_10002702 Ga0207663_100027023 480
524 3300025918 Ga0207662_10024763 Ga0207662_100247632 480
525 3300025919 Ga0207657_10006877 Ga0207657_1000687712 480
526 3300025921 Ga0207652_10005615 Ga0207652_100056154 480
527 3300025928 Ga0207700_10017788 Ga0207700_100177883 480
528 3300025928 Ga0207700_10067357 Ga0207700_100673572 480
529 3300025929 Ga0207664_10010087 Ga0207664_100100873 480
530 3300025929 Ga0207664_10032123 Ga0207664_100321234 480
531 3300025933 Ga0207706_10017955 Ga0207706_100179554 480
532 3300025935 Ga0207709_10082687 Ga0207709_100826872 480
533 3300025936 Ga0207670_10015775 Ga0207670_100157753 480
534 3300025939 Ga0207665_10001604 Ga0207665_100016049 480
535 3300025939 Ga0207665_10011024 Ga0207665_100110245 480
536 3300025939 Ga0207665_10067307 Ga0207665_100673072 480
537 3300025941 Ga0207711_10034870 Ga0207711_100348703 480
538 3300025942 Ga0207689_10088384 Ga0207689_100883842 480
539 3300025944 Ga0207661_10085376 Ga0207661_100853762 480
540 3300025960 Ga0207651_10036222 Ga0207651_100362221 480
541 3300026041 Ga0207639_10122657 Ga0207639_101226572 480
542 3300026067 Ga0207678_10011222 Ga0207678_100112224 480
543 3300026067 Ga0207678_10055042 Ga0207678_100550423 480
544 3300026095 Ga0207676_10189753 Ga0207676_101897532 480
545 3300026118 Ga0207675_100032639 Ga0207675_1000326393 480
546 3300026121 Ga0207683_10052256 Ga0207683_100522564 480
547 3300026121 Ga0207683_10090274 Ga0207683_100902742 480
548 3300028794 Ga0307515_10103950 Ga0307515_101039502 480
549 3300030522 Ga0307512_10007181 Ga0307512_100071814 480
550 3300031240 Ga0265320_10000584 Ga0265320_1000058412 480
551 3300035121 Ga0373960_0013726 Ga0373960_0013726_44_1573 480
552 3300037466 Ga0395898_0002459 Ga0395898_0002459_10644_12194 480
553 3300037466 Ga0395898_0058182 Ga0395898_0058182_505_2067 480
554 3300037853 Ga0436364_1261928 Ga0436364_1261928_1805_3349 480
555 3300041491 Ga0451833_1162688 Ga0451833_1162688_170_1699 480
556 3300041512 Ga0451853_0323525 Ga0451853_0323525_4201_5754 480
557 3300042004 Ga0439445_0004315 Ga0439445_0004315_289_1830 480
558 3300042115 Ga0450911_000124 Ga0450911_000124_2007_3548 480
559 3300047319 Ga0495674_0040366 Ga0495674_0040366_853_2430 480
560 3300048905 Ga0496102_0032587 Ga0496102_0032587_1589_3118 480
561 3300048907 Ga0496104_0001473 Ga0496104_0001473_1620_3170 480
562 3300048907 Ga0496104_0241722 Ga0496104_0241722_67_1617 480
563 3300048908 Ga0496105_0014155 Ga0496105_0014155_4031_5581 480
564 3300048910 Ga0496107_0083010 Ga0496107_0083010_103_1632 480
565 3300048911 Ga0496108_0017998 Ga0496108_0017998_2960_4510 480
566 3300048911 Ga0496108_0039650 Ga0496108_0039650_89_1651 480
567 3300048912 Ga0496109_0011608 Ga0496109_0011608_1808_3337 480
568 3300048912 Ga0496109_0045004 Ga0496109_0045004_1279_2829 480
569 3300048913 Ga0496110_0066517 Ga0496110_0066517_1378_2907 480
570 3300048914 Ga0496111_0017504 Ga0496111_0017504_827_2356 480
571 3300048915 Ga0496112_0018227 Ga0496112_0018227_3764_5314 480
572 3300048915 Ga0496112_0208399 Ga0496112_0208399_68_1597 480
573 3300048918 Ga0496115_0012725 Ga0496115_0012725_3917_5446 480
574 3300048928 Ga0496125_0004511 Ga0496125_0004511_12084_13625 480
575 3300048929 Ga0496126_0088657 Ga0496126_0088657_640_2181 480
576 3300049583 Ga0501067_0016723 Ga0501067_0016723_2160_3701 480
577 3300050513 nmdc:mga0rr50_109703_c1 nmdc:mga0rr50_109703_c1_157_1686 480
578 3300050515 nmdc:mga0a205_86348_c1 nmdc:mga0a205_86348_c1_414_1943 480
579 3300053158 Ga0500627_0000001 Ga0500627_0000001_185588_187144 480
580 3300005548 Ga0070665_100000596 Ga0070665_10000059612 481
581 3300005577 Ga0068857_100042508 Ga0068857_1000425084 481
582 3300009098 Ga0105245_10072319 Ga0105245_100723192 481
583 3300013307 Ga0157372_10196199 Ga0157372_101961992 481
584 3300025904 Ga0207647_10030334 Ga0207647_100303343 481
585 3300026116 Ga0207674_10056821 Ga0207674_100568213 481
586 3300028379 Ga0268266_10005453 Ga0268266_100054533 481
587 3300028794 Ga0307515_10000456 Ga0307515_1000045659 481
588 3300031995 Ga0307409_100105678 Ga0307409_1001056781 481
589 3300037068 Ga0373925_0000177 Ga0373925_0000177_11706_13313 481
590 3300039437 Ga0436365_1238059 Ga0436365_1238059_152_1705 481
591 3300048905 Ga0496102_0116117 Ga0496102_0116117_311_1855 481
592 3300048907 Ga0496104_0003060 Ga0496104_0003060_7540_9195 481
593 3300048908 Ga0496105_0002023 Ga0496105_0002023_1215_2870 481
594 3300048911 Ga0496108_0010632 Ga0496108_0010632_1794_3449 481
595 3300048912 Ga0496109_0031161 Ga0496109_0031161_2356_4011 481
596 3300048913 Ga0496110_0001000 Ga0496110_0001000_9772_11427 481
597 3300048916 Ga0496113_0028398 Ga0496113_0028398_536_2191 481
598 3300048917 Ga0496114_0027090 Ga0496114_0027090_72_1616 481
599 3300048929 Ga0496126_0020830 Ga0496126_0020830_4175_5740 481
600 3300049571 Ga0501034_0020094 Ga0501034_0020094_3009_4640 481
601 3300049574 Ga0501038_0038142 Ga0501038_0038142_1311_2942 481
602 3300049581 Ga0501047_0012506 Ga0501047_0012506_6349_7980 481
603 iso_pu_bacteria 2808606401 2809063805 481
604 iso_pu_bacteria 2808606404 2809079773 481
605 iso_pu_bacteria 2808606405 2809084138 481
606 iso_pu_bacteria 2880518877 2880523510 481
607 3300006051 Ga0075364_10006473 Ga0075364_100064733 482
608 3300033180 Ga0307510_10025725 Ga0307510_100257252 482
609 3300042876 Ga0451577_0083155 Ga0451577_0083155_380_1933 482
610 3300049580 Ga0501046_0035807 Ga0501046_0035807_1738_3297 482
611 3300050491 nmdc:mga00v17_3991_c1 nmdc:mga00v17_3991_c1_1957_3516 482
612 iso_pu_bacteria 2945909444 2945914593 482
613 iso_pu_bacteria 2945984333 2945990006 482
614 iso_pu_bacteria 8057101203 8057102815 482
615 3300006847 Ga0075431_100032592 Ga0075431_1000325923 483
616 3300006880 Ga0075429_100021787 Ga0075429_1000217873 483
617 3300009147 Ga0114129_10028864 Ga0114129_100288646 483
618 3300031616 Ga0307508_10026744 Ga0307508_100267445 483
619 3300048928 Ga0496125_0003687 Ga0496125_0003687_92_1672 483
620 3300048929 Ga0496126_0025832 Ga0496126_0025832_2811_4391 483
621 3300049583 Ga0501067_0051568 Ga0501067_0051568_459_2018 483
622 3300050507 nmdc:mga05p37_6701_c1 nmdc:mga05p37_6701_c1_10602_12161 483
623 3300050510 nmdc:mga06r32_31467_c1 nmdc:mga06r32_31467_c1_1091_2650 483
624 3300005985 Ga0081539_10005615 Ga0081539_100056157 484
625 3300021388 Ga0213875_10001633 Ga0213875_100016338 484
626 3300037312 Ga0395899_0000091 Ga0395899_0000091_150914_152455 484
627 3300037418 Ga0395900_0000008 Ga0395900_0000008_476593_478134 484
628 3300037466 Ga0395898_0017952 Ga0395898_0017952_2326_3867 484
629 3300037471 Ga0395905_0046457 Ga0395905_0046457_1225_2766 484
630 3300037853 Ga0436364_0103177 Ga0436364_0103177_52144_53793 484
631 3300038443 Ga0395901_0000008 Ga0395901_0000008_2326_3867 484
632 3300048905 Ga0496102_0000597 Ga0496102_0000597_4359_5924 484
633 3300049583 Ga0501067_0054191 Ga0501067_0054191_131_1720 484
634 iso_pu_bacteria 2513237165 2514045617 484
635 iso_pu_bacteria 2885198086 2885201522 484
636 iso_pu_bacteria 2885211737 2885215767 484
637 iso_pu_bacteria 8011350971 8011353305 484
638 3300005471 Ga0070698_100022808 Ga0070698_1000228081 485
639 3300005842 Ga0068858_100002113 Ga0068858_10000211311 485
640 3300009098 Ga0105245_10000529 Ga0105245_1000052921 485
641 3300009148 Ga0105243_10047640 Ga0105243_100476402 485
642 3300013296 Ga0157374_10153738 Ga0157374_101537381 485
643 3300013308 Ga0157375_10037218 Ga0157375_100372185 485
644 3300025229 Ga0209147_100368 Ga0209147_10036816 485
645 3300025927 Ga0207687_10102872 Ga0207687_101028721 485
646 3300026035 Ga0207703_10001637 Ga0207703_100016379 485
647 3300031616 Ga0307508_10002212 Ga0307508_1000221214 485
648 3300033180 Ga0307510_10003235 Ga0307510_100032359 485
649 3300046453 Ga0495627_000078 Ga0495627_000078_68973_70535 485
650 3300046453 Ga0495627_000939 Ga0495627_000939_3132_4694 485
651 3300046506 Ga0495583_0004588 Ga0495583_0004588_3025_4587 485
652 3300046512 Ga0495610_0001502 Ga0495610_0001502_15847_17409 485
653 3300046519 Ga0495632_0000001 Ga0495632_0000001_508104_509666 485
654 3300046520 Ga0495637_0000088 Ga0495637_0000088_26315_27877 485
655 3300046520 Ga0495637_0004718 Ga0495637_0004718_2874_4436 485
656 3300046522 Ga0495643_0000006 Ga0495643_0000006_198501_200063 485
657 3300046524 Ga0495648_0002964 Ga0495648_0002964_1415_2977 485
658 3300046524 Ga0495648_0025371 Ga0495648_0025371_353_1915 485
659 3300046525 Ga0495663_0000001 Ga0495663_0000001_363630_365192 485
660 3300046558 Ga0495633_0000053 Ga0495633_0000053_58744_60306 485
661 3300046558 Ga0495633_0000424 Ga0495633_0000424_15764_17326 485
662 3300046660 Ga0495625_0000014 Ga0495625_0000014_191795_193357 485
663 3300046691 Ga0495670_0001666 Ga0495670_0001666_7753_9315 485
664 3300046692 Ga0495671_0000008 Ga0495671_0000008_198501_200063 485
665 3300047320 Ga0495672_0015785 Ga0495672_0015785_2684_4246 485
666 3300047445 Ga0495677_0001245 Ga0495677_0001245_4416_5978 485
667 3300047470 Ga0495681_0000022 Ga0495681_0000022_147957_149519 485
668 3300047470 Ga0495681_0002045 Ga0495681_0002045_2055_3617 485
669 3300047472 Ga0495686_0008331 Ga0495686_0008331_3127_4689 485
670 3300047472 Ga0495686_0036614 Ga0495686_0036614_69_1631 485
671 3300047472 Ga0495686_0039467 Ga0495686_0039467_1275_2837 485
672 3300053087 Ga0500643_000221 Ga0500643_000221_12421_13983 485
673 3300053139 Ga0500568_0030813 Ga0500568_0030813_228_1790 485
674 3300005354 Ga0070675_100053540 Ga0070675_1000535402 486
675 3300005435 Ga0070714_100182209 Ga0070714_1001822091 486
676 3300005548 Ga0070665_100000011 Ga0070665_10000001156 486
677 3300005563 Ga0068855_100000032 Ga0068855_10000003257 486
678 3300005564 Ga0070664_100085635 Ga0070664_1000856352 486
679 3300005577 Ga0068857_100023384 Ga0068857_1000233845 486
680 3300005614 Ga0068856_100013762 Ga0068856_1000137622 486
681 3300005841 Ga0068863_100071883 Ga0068863_1000718832 486
682 3300009551 Ga0105238_10080063 Ga0105238_100800632 486
683 3300013105 Ga0157369_10003669 Ga0157369_1000366918 486
684 3300013307 Ga0157372_10080788 Ga0157372_100807883 486
685 3300026088 Ga0207641_10101803 Ga0207641_101018032 486
686 3300028379 Ga0268266_10000063 Ga0268266_1000006353 486
687 3300031240 Ga0265320_10000631 Ga0265320_1000063113 486
688 3300031711 Ga0265314_10001042 Ga0265314_1000104211 486
689 3300031995 Ga0307409_100159216 Ga0307409_1001592161 486
690 3300039437 Ga0436365_1885236 Ga0436365_1885236_1173_2735 486
691 3300046692 Ga0495671_0029544 Ga0495671_0029544_348_1913 486
692 3300053118 Ga0500594_0006883 Ga0500594_0006883_180_1745 486
693 3300053139 Ga0500568_0001089 Ga0500568_0001089_3427_4986 486
694 3300053151 Ga0500604_0000011 Ga0500604_0000011_47685_49244 486
695 3300053153 Ga0500616_0000123 Ga0500616_0000123_68566_70125 486
696 3300003792 Ga0055540_1007428 Ga0055540_10074282 488
697 3300025292 Ga0209676_1001329 Ga0209676_10013293 488
698 3300025303 Ga0209051_1000413 Ga0209051_100041310 488
699 3300025303 Ga0209051_1011091 Ga0209051_10110915 488
700 3300046692 Ga0495671_0006971 Ga0495671_0006971_3850_5406 488
701 3300006846 Ga0075430_100067423 Ga0075430_1000674233 489
702 3300006880 Ga0075429_100003204 Ga0075429_1000032042 489
703 3300035410 Ga0373924_0004493 Ga0373924_0004493_126_1685 489
704 3300050508 nmdc:mga09592_71_c1 nmdc:mga09592_71_c1_21310_22869 489
705 3300050509 nmdc:mga0qj67_6384_c1 nmdc:mga0qj67_6384_c1_4707_6266 489
706 3300032004 Ga0307414_10182977 Ga0307414_101829771 490
707 3300001904 JGI24736J21556_1000082 JGI24736J21556_100008217 512
708 3300001979 JGI24740J21852_10003927 JGI24740J21852_100039276 512
709 3300001989 JGI24739J22299_10005208 JGI24739J22299_100052082 512
710 3300002075 JGI24738J21930_10008269 JGI24738J21930_100082692 512
711 3300005366 Ga0070659_100004221 Ga0070659_1000042215 512
712 3300005455 Ga0070663_100005868 Ga0070663_1000058684 512
713 3300005457 Ga0070662_100022891 Ga0070662_1000228912 512
714 3300005564 Ga0070664_100006782 Ga0070664_1000067826 512
715 3300005577 Ga0068857_100028137 Ga0068857_1000281373 512
716 3300025904 Ga0207647_10003799 Ga0207647_100037996 512
717 3300025914 Ga0207671_10001110 Ga0207671_1000111026 512
718 3300025919 Ga0207657_10061524 Ga0207657_100615242 512
719 3300025933 Ga0207706_10065345 Ga0207706_100653452 512
720 3300025949 Ga0207667_10012779 Ga0207667_100127796 512
721 3300026067 Ga0207678_10015276 Ga0207678_100152765 512
722 3300026078 Ga0207702_10001744 Ga0207702_1000174412 512
723 3300026116 Ga0207674_10083033 Ga0207674_100830332 512
724 3300031911 Ga0307412_10013256 Ga0307412_100132563 512
725 3300032004 Ga0307414_10003714 Ga0307414_100037144 512

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

463

538

0.98

PF00501

AMP-binding

AMP-binding enzyme

48

413

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.9219 5 412
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.9129 5 412
5zrn-assembly1.cif.gz_A inhibitor bound crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis 0.9101 5 412
3t5c-assembly2.cif.gz_B crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis in different space group c2 0.9084 5 411
3t5c-assembly2.cif.gz_B crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis in different space group c2 0.9061 5 411
ID Description Score Start End Superfamily
5u95D03 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9419 340 412 2.30.38.10
af_O05819_776_852_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9419 344 410 2.30.38.10
2d1qA01 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9363 338 412 2.30.38.10
af_Q2G1H9_722_797_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9278 340 410 2.30.38.10
3ivrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9219 5 412 3.40.50.12780
ID Description Score Start End GO Terms
AF-X0Y3T5-F1-model_v4 AMP-dependent synthetase/ligase domain-containing protein 0.9449 338 410
AF-A0A538IHP9-F1-model_v4 Fatty acid--CoA ligase family protein 0.9402 7 107 GO:0016874
AF-A0A1M5BJV3-F1-model_v4 AMP-binding enzyme 0.9273 6 116
AF-A0A0F4IVL8-F1-model_v4 deleted 0.9148 1 107
AF-A0A533VPQ0-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9071 6 413 GO:0016874

Feature Viewer

pLDDT pTM Quality
89.96 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map