F477604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 409 | 656 | 511 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100022808|Ga0070698_1000228081 |
| Length | 557 |
| Sequence | MITLSTRFYGLRMNLRSATCGRNYETRRSEAEPLWQPEDKSVRLTDYLDKGASLGAEAPCLTAGGRTLSYGDVQALSWRIARXXXXSRIRPGDKVAILSANDPVAFSCVFGISRAGAVWCPVNPRNEAAENRDLLDFFDCTCLIFQAAFAPLVTKILPDLPKLTTLVCLDGEHPSATPFGQWLADLPGEPWQAEPPDDLVMLVGTGGTTGRPKGVMLTGHNIETMSALTLMSYPFRPRPRYLALAPLTHAAGVLCFPVMTLGGEIVIMPKPDLAEFLSLIEKYKITHTFLPPTLIYLLLDHPALRAADLASLQCLWYGAAPMSAARLTEALAKIGPVMGQLFGQSEAPMMISTMAPADHFREDGSLAEERLSSAGRPTPLTTVAIMDDEGHLLGPGQRGEIVARGPLVMAGYYKNPQASAEAARYGWHHTGDIGYLDEDNYLFIVDRAKDMIITGGFNVYSAEVEQVLLAHPAVQDCAVVGLPDEKWGERVTAVVQLRPGQTVTEDEVRSFVKERLGSVKAPKQVEVWPDLPRSKVGKVLKVDVKAQLRAGESAQSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 5 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 6 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 7 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 8 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 9 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 10 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 11 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 12 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 13 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 14 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 17 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 18 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 19 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 20 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 21 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 22 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 23 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 24 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 25 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 26 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 27 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 28 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 29 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 30 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 31 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 32 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 33 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 34 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 35 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 36 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 37 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 38 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 39 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 40 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 41 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 42 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 43 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 44 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 45 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 46 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 47 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 48 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 49 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 50 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 51 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 52 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 53 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 54 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 55 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 56 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 57 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 58 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 59 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 60 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 61 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 62 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 63 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 64 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 65 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 66 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 67 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 68 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 69 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 79 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 119 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 122 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 123 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 124 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 125 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 131 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 132 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 133 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 134 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 137 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 138 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 139 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 140 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 141 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 172 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 173 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 233 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 234 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 237 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 238 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 241 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 242 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 243 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 244 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 268 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 269 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 271 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 272 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 273 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 274 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 275 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 276 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 277 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 280 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 362 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 365 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 366 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 367 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 368 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 395 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 397 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 399 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 405 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 406 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 407 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 408 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 409 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.07 |
| Metatranscriptomes | 0.41 |
| Isolates | 9.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 4.97 |
| Nodule | 0.97 |
| Rhizoplane | 8.41 |
| Rhizosphere | 73.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000082 | 3300001904 | Bacteria | 15646 |
| 2 | JGI24740J21852_10003927 | 3300001979 | Bacteria | 6454 |
| 3 | JGI24739J22299_10005208 | 3300001989 | Bacteria | 4956 |
| 4 | JGI24735J21928_10006642 | 3300002067 | Bacteria | 3799 |
| 5 | JGI24738J21930_10008269 | 3300002075 | Bacteria | 2369 |
| 6 | JGI25407J50210_10003955 | 3300003373 | Bacteria | 3588 |
| 7 | JGI25404J52841_10000235 | 3300003659 | Bacteria | 6918 |
| 8 | Ga0055530_10000093 | 3300003791 | Bacteria | 77624 |
| 9 | Ga0055530_10000104 | 3300003791 | Bacteria | 72163 |
| 10 | Ga0055540_1007428 | 3300003792 | Bacteria | 4136 |
| 11 | Ga0055531_10000432 | 3300003794 | Bacteria | 39735 |
| 12 | Ga0055531_10002055 | 3300003794 | Bacteria | 13881 |
| 13 | Ga0070683_100002702 | 3300005329 | Bacteria | 14166 |
| 14 | Ga0070683_100010116 | 3300005329 | Bacteria | 8093 |
| 15 | Ga0070683_100013188 | 3300005329 | Bacteria | 7198 |
| 16 | Ga0070683_100032144 | 3300005329 | Bacteria | 4776 |
| 17 | Ga0070683_100075807 | 3300005329 | Bacteria | 3143 |
| 18 | Ga0068869_100009568 | 3300005334 | Bacteria | 6293 |
| 19 | Ga0068869_100071657 | 3300005334 | Bacteria | 2566 |
| 20 | Ga0068869_100077878 | 3300005334 | Bacteria | 2468 |
| 21 | Ga0070666_10014340 | 3300005335 | Bacteria | 5045 |
| 22 | Ga0070666_10029643 | 3300005335 | Bacteria | 3599 |
| 23 | Ga0070682_100057762 | 3300005337 | Bacteria | 2446 |
| 24 | Ga0070682_100067088 | 3300005337 | Bacteria | 2284 |
| 25 | Ga0070682_100101305 | 3300005337 | Bacteria | 1902 |
| 26 | Ga0068868_100037250 | 3300005338 | Bacteria | 3769 |
| 27 | Ga0070687_100019362 | 3300005343 | Bacteria | 3164 |
| 28 | Ga0070661_100030912 | 3300005344 | Bacteria | 3870 |
| 29 | Ga0070668_100000425 | 3300005347 | Bacteria | 27984 |
| 30 | Ga0070668_100039888 | 3300005347 | Bacteria | 3591 |
| 31 | Ga0070668_100071753 | 3300005347 | Bacteria | 2698 |
| 32 | Ga0070675_100053540 | 3300005354 | Bacteria | 3319 |
| 33 | Ga0070675_100196275 | 3300005354 | Bacteria | 1751 |
| 34 | Ga0070671_100013148 | 3300005355 | Bacteria | 6668 |
| 35 | Ga0070671_100050494 | 3300005355 | Bacteria | 3459 |
| 36 | Ga0070674_100041183 | 3300005356 | Bacteria | 3128 |
| 37 | Ga0070673_100047366 | 3300005364 | Bacteria | 3345 |
| 38 | Ga0070688_100064672 | 3300005365 | Bacteria | 2322 |
| 39 | Ga0070659_100004221 | 3300005366 | Bacteria | 10260 |
| 40 | Ga0070659_100058748 | 3300005366 | Bacteria | 3036 |
| 41 | Ga0070667_100041269 | 3300005367 | Bacteria | 3871 |
| 42 | Ga0070667_100233722 | 3300005367 | Bacteria | 1640 |
| 43 | Ga0070703_10010202 | 3300005406 | Bacteria | 2648 |
| 44 | Ga0070709_10021541 | 3300005434 | Bacteria | 3755 |
| 45 | Ga0070714_100021486 | 3300005435 | Bacteria | 5281 |
| 46 | Ga0070714_100182209 | 3300005435 | Bacteria | 1912 |
| 47 | Ga0070713_100057549 | 3300005436 | Bacteria | 3238 |
| 48 | Ga0070710_10007207 | 3300005437 | Bacteria | 5374 |
| 49 | Ga0070711_100003971 | 3300005439 | Bacteria | 8693 |
| 50 | Ga0070711_100029686 | 3300005439 | Bacteria | 3611 |
| 51 | Ga0070711_100076887 | 3300005439 | Bacteria | 2367 |
| 52 | Ga0070705_100020353 | 3300005440 | Bacteria | 3509 |
| 53 | Ga0070694_100009061 | 3300005444 | Bacteria | 6100 |
| 54 | Ga0070694_100113622 | 3300005444 | Bacteria | 1932 |
| 55 | Ga0070708_100016030 | 3300005445 | Bacteria | 6207 |
| 56 | Ga0070708_100055574 | 3300005445 | Bacteria | 3520 |
| 57 | Ga0070708_100072383 | 3300005445 | Bacteria | 3106 |
| 58 | Ga0070708_100143161 | 3300005445 | Bacteria | 2218 |
| 59 | Ga0070663_100005868 | 3300005455 | Bacteria | 7340 |
| 60 | Ga0070678_100039449 | 3300005456 | Bacteria | 3332 |
| 61 | Ga0070662_100020261 | 3300005457 | Bacteria | 4526 |
| 62 | Ga0070662_100022891 | 3300005457 | Bacteria | 4285 |
| 63 | Ga0070662_100042699 | 3300005457 | Bacteria | 3240 |
| 64 | Ga0070685_10018383 | 3300005466 | Bacteria | 3758 |
| 65 | Ga0070685_10071439 | 3300005466 | Bacteria | 2058 |
| 66 | Ga0070685_10086558 | 3300005466 | Bacteria | 1890 |
| 67 | Ga0070706_100001943 | 3300005467 | Bacteria | 21303 |
| 68 | Ga0070706_100033486 | 3300005467 | Bacteria | 4742 |
| 69 | Ga0070706_100150348 | 3300005467 | Bacteria | 2173 |
| 70 | Ga0070707_100011160 | 3300005468 | Bacteria | 8372 |
| 71 | Ga0070707_100015242 | 3300005468 | Bacteria | 7213 |
| 72 | Ga0070707_100080783 | 3300005468 | Bacteria | 3138 |
| 73 | Ga0070698_100001126 | 3300005471 | Bacteria | 29553 |
| 74 | Ga0070698_100004906 | 3300005471 | Bacteria | 14675 |
| 75 | Ga0070698_100005767 | 3300005471 | Bacteria | 13540 |
| 76 | Ga0070698_100022808 | 3300005471 | Bacteria | 6544 |
| 77 | Ga0070699_100002453 | 3300005518 | Bacteria | 16669 |
| 78 | Ga0070699_100011087 | 3300005518 | Bacteria | 7792 |
| 79 | Ga0070679_100024686 | 3300005530 | Bacteria | 5891 |
| 80 | Ga0070679_100048194 | 3300005530 | Bacteria | 4246 |
| 81 | Ga0070684_100003428 | 3300005535 | Bacteria | 11910 |
| 82 | Ga0070697_100003236 | 3300005536 | Bacteria | 12501 |
| 83 | Ga0070672_100041287 | 3300005543 | Bacteria | 3546 |
| 84 | Ga0070672_100148817 | 3300005543 | Bacteria | 1936 |
| 85 | Ga0070696_100017808 | 3300005546 | Bacteria | 4796 |
| 86 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 87 | Ga0070665_100000596 | 3300005548 | Bacteria | 50215 |
| 88 | Ga0070665_100004605 | 3300005548 | Bacteria | 14422 |
| 89 | Ga0070665_100072533 | 3300005548 | Bacteria | 3450 |
| 90 | Ga0068855_100000032 | 3300005563 | Bacteria | 168335 |
| 91 | Ga0070664_100001201 | 3300005564 | Bacteria | 20631 |
| 92 | Ga0070664_100006782 | 3300005564 | Bacteria | 9232 |
| 93 | Ga0070664_100085635 | 3300005564 | Bacteria | 2722 |
| 94 | Ga0068857_100023384 | 3300005577 | Bacteria | 5441 |
| 95 | Ga0068857_100028137 | 3300005577 | Bacteria | 4958 |
| 96 | Ga0068857_100041684 | 3300005577 | Bacteria | 4070 |
| 97 | Ga0068857_100042508 | 3300005577 | Bacteria | 4033 |
| 98 | Ga0068857_100081984 | 3300005577 | Bacteria | 2881 |
| 99 | Ga0068857_100127933 | 3300005577 | Bacteria | 2289 |
| 100 | Ga0068856_100013762 | 3300005614 | Bacteria | 7821 |
| 101 | Ga0068859_100109284 | 3300005617 | Bacteria | 2826 |
| 102 | Ga0068864_100143672 | 3300005618 | Bacteria | 2155 |
| 103 | Ga0068866_10034919 | 3300005718 | Bacteria | 2452 |
| 104 | Ga0068866_10057655 | 3300005718 | Bacteria | 2002 |
| 105 | Ga0068861_100021704 | 3300005719 | Bacteria | 4616 |
| 106 | Ga0068851_10061692 | 3300005834 | Bacteria | 1922 |
| 107 | Ga0068870_10008775 | 3300005840 | Bacteria | 4560 |
| 108 | Ga0068870_10054071 | 3300005840 | Bacteria | 2134 |
| 109 | Ga0068870_10097947 | 3300005840 | Bacteria | 1651 |
| 110 | Ga0068863_100034139 | 3300005841 | Bacteria | 4846 |
| 111 | Ga0068863_100054372 | 3300005841 | Bacteria | 3793 |
| 112 | Ga0068863_100069141 | 3300005841 | Bacteria | 3339 |
| 113 | Ga0068863_100071883 | 3300005841 | Bacteria | 3273 |
| 114 | Ga0068858_100002113 | 3300005842 | Bacteria | 20168 |
| 115 | Ga0068858_100032909 | 3300005842 | Bacteria | 4814 |
| 116 | Ga0068858_100047466 | 3300005842 | Bacteria | 3980 |
| 117 | Ga0068862_100022922 | 3300005844 | Bacteria | 5227 |
| 118 | Ga0068862_100027619 | 3300005844 | Bacteria | 4778 |
| 119 | Ga0081455_10000724 | 3300005937 | Bacteria | 42797 |
| 120 | Ga0081455_10084898 | 3300005937 | Bacteria | 2583 |
| 121 | Ga0081538_10004167 | 3300005981 | Bacteria | 13420 |
| 122 | Ga0081540_1000528 | 3300005983 | Bacteria | 37260 |
| 123 | Ga0081539_10000999 | 3300005985 | Bacteria | 52497 |
| 124 | Ga0081539_10005615 | 3300005985 | Bacteria | 12628 |
| 125 | Ga0081539_10007595 | 3300005985 | Bacteria | 9797 |
| 126 | Ga0070717_10039004 | 3300006028 | Bacteria | 3863 |
| 127 | Ga0075365_10009286 | 3300006038 | Bacteria | 5642 |
| 128 | Ga0075368_10004625 | 3300006042 | Bacteria | 4680 |
| 129 | Ga0075363_100035372 | 3300006048 | Bacteria | 2613 |
| 130 | Ga0075364_10006473 | 3300006051 | Bacteria | 6882 |
| 131 | Ga0070715_10020379 | 3300006163 | Bacteria | 2557 |
| 132 | Ga0070715_10047190 | 3300006163 | Bacteria | 1835 |
| 133 | Ga0070712_100005558 | 3300006175 | Bacteria | 7802 |
| 134 | Ga0070712_100006558 | 3300006175 | Bacteria | 7224 |
| 135 | Ga0070712_100010785 | 3300006175 | Bacteria | 5777 |
| 136 | Ga0075367_10064425 | 3300006178 | Bacteria | 2192 |
| 137 | Ga0068871_100020061 | 3300006358 | Bacteria | 5115 |
| 138 | Ga0068871_100095675 | 3300006358 | Bacteria | 2480 |
| 139 | Ga0075430_100067423 | 3300006846 | Bacteria | 3004 |
| 140 | Ga0075431_100032592 | 3300006847 | Bacteria | 5369 |
| 141 | Ga0075433_10053485 | 3300006852 | Bacteria | 3521 |
| 142 | Ga0075429_100003204 | 3300006880 | Bacteria | 13921 |
| 143 | Ga0075429_100021787 | 3300006880 | Bacteria | 5556 |
| 144 | Ga0097620_100109284 | 3300006931 | Bacteria | 2826 |
| 145 | Ga0075435_100026319 | 3300007076 | Bacteria | 4536 |
| 146 | Ga0105240_10180463 | 3300009093 | Bacteria | 2492 |
| 147 | Ga0111539_10000515 | 3300009094 | Bacteria | 49121 |
| 148 | Ga0111539_10089136 | 3300009094 | Bacteria | 3625 |
| 149 | Ga0105245_10000529 | 3300009098 | Bacteria | 35001 |
| 150 | Ga0105245_10020906 | 3300009098 | Bacteria | 5738 |
| 151 | Ga0105245_10072319 | 3300009098 | Bacteria | 3132 |
| 152 | Ga0105247_10011549 | 3300009101 | Bacteria | 5319 |
| 153 | Ga0114129_10028864 | 3300009147 | Bacteria | 7860 |
| 154 | Ga0105243_10047640 | 3300009148 | Bacteria | 3376 |
| 155 | Ga0105242_10051819 | 3300009176 | Bacteria | 3346 |
| 156 | Ga0105237_10069511 | 3300009545 | Bacteria | 3517 |
| 157 | Ga0105238_10080063 | 3300009551 | Bacteria | 3256 |
| 158 | Ga0105238_10103866 | 3300009551 | Bacteria | 2823 |
| 159 | Ga0105238_10163190 | 3300009551 | Bacteria | 2204 |
| 160 | Ga0105249_10022755 | 3300009553 | Bacteria | 5617 |
| 161 | Ga0105249_10170644 | 3300009553 | Bacteria | 2109 |
| 162 | Ga0105239_10258978 | 3300010375 | Bacteria | 1955 |
| 163 | Ga0105246_10004077 | 3300011119 | Bacteria | 8872 |
| 164 | Ga0105246_10038778 | 3300011119 | Bacteria | 3205 |
| 165 | Ga0157342_1001046 | 3300012507 | Bacteria | 1928 |
| 166 | Ga0157370_10029089 | 3300013104 | Bacteria | 5428 |
| 167 | Ga0157369_10003669 | 3300013105 | Bacteria | 18233 |
| 168 | Ga0157369_10033051 | 3300013105 | Bacteria | 5686 |
| 169 | Ga0157369_10071413 | 3300013105 | Bacteria | 3727 |
| 170 | Ga0157374_10073628 | 3300013296 | Bacteria | 3224 |
| 171 | Ga0157374_10153738 | 3300013296 | Bacteria | 2238 |
| 172 | Ga0157378_10154159 | 3300013297 | Bacteria | 2143 |
| 173 | Ga0163162_10112126 | 3300013306 | Bacteria | 2826 |
| 174 | Ga0157372_10080788 | 3300013307 | Bacteria | 3679 |
| 175 | Ga0157372_10196199 | 3300013307 | Bacteria | 2338 |
| 176 | Ga0157375_10033927 | 3300013308 | Bacteria | 4856 |
| 177 | Ga0157375_10037218 | 3300013308 | Bacteria | 4660 |
| 178 | Ga0157375_10106674 | 3300013308 | Bacteria | 2893 |
| 179 | Ga0157375_10138891 | 3300013308 | Bacteria | 2555 |
| 180 | Ga0157380_10047068 | 3300014326 | Bacteria | 3390 |
| 181 | Ga0157377_10011005 | 3300014745 | Bacteria | 4499 |
| 182 | Ga0157377_10065040 | 3300014745 | Bacteria | 2094 |
| 183 | Ga0157379_10018288 | 3300014968 | Bacteria | 6176 |
| 184 | Ga0157379_10048224 | 3300014968 | Bacteria | 3802 |
| 185 | Ga0157376_10020114 | 3300014969 | Bacteria | 5158 |
| 186 | Ga0157376_10103403 | 3300014969 | Bacteria | 2494 |
| 187 | Ga0163161_10023742 | 3300017792 | Bacteria | 4328 |
| 188 | Ga0206356_11380849 | 3300020070 | Bacteria | 2669 |
| 189 | Ga0206354_10770736 | 3300020081 | Bacteria | 3699 |
| 190 | Ga0214544_1000056 | 3300021320 | Bacteria | 132760 |
| 191 | Ga0213875_10001633 | 3300021388 | Bacteria | 14154 |
| 192 | Ga0209147_100368 | 3300025229 | Bacteria | 32053 |
| 193 | Ga0209675_1000132 | 3300025291 | Bacteria | 102062 |
| 194 | Ga0209676_1000085 | 3300025292 | Bacteria | 273425 |
| 195 | Ga0209676_1000118 | 3300025292 | Bacteria | 201939 |
| 196 | Ga0209676_1001329 | 3300025292 | Bacteria | 25002 |
| 197 | Ga0209050_1000115 | 3300025298 | Bacteria | 204622 |
| 198 | Ga0207426_1007082 | 3300025302 | Bacteria | 4744 |
| 199 | Ga0209051_1000413 | 3300025303 | Bacteria | 59027 |
| 200 | Ga0209051_1011091 | 3300025303 | Bacteria | 4480 |
| 201 | Ga0209257_1000160 | 3300025304 | Bacteria | 177175 |
| 202 | Ga0209257_1000482 | 3300025304 | Bacteria | 72375 |
| 203 | Ga0209257_1006194 | 3300025304 | Bacteria | 7853 |
| 204 | Ga0207656_10053774 | 3300025321 | Bacteria | 1748 |
| 205 | Ga0207653_10002294 | 3300025885 | Bacteria | 6104 |
| 206 | Ga0207653_10015836 | 3300025885 | Bacteria | 2367 |
| 207 | Ga0207692_10006037 | 3300025898 | Bacteria | 4897 |
| 208 | Ga0207692_10008808 | 3300025898 | Bacteria | 4192 |
| 209 | Ga0207692_10020664 | 3300025898 | Bacteria | 3000 |
| 210 | Ga0207688_10000995 | 3300025901 | Bacteria | 14450 |
| 211 | Ga0207688_10012849 | 3300025901 | Bacteria | 4552 |
| 212 | Ga0207688_10014437 | 3300025901 | Bacteria | 4294 |
| 213 | Ga0207688_10080432 | 3300025901 | Bacteria | 1860 |
| 214 | Ga0207680_10029174 | 3300025903 | Bacteria | 3096 |
| 215 | Ga0207647_10003799 | 3300025904 | Bacteria | 11286 |
| 216 | Ga0207647_10030334 | 3300025904 | Bacteria | 3489 |
| 217 | Ga0207699_10004882 | 3300025906 | Bacteria | 6418 |
| 218 | Ga0207699_10006490 | 3300025906 | Bacteria | 5669 |
| 219 | Ga0207699_10046955 | 3300025906 | Bacteria | 2529 |
| 220 | Ga0207645_10032768 | 3300025907 | Bacteria | 3340 |
| 221 | Ga0207643_10054170 | 3300025908 | Bacteria | 2279 |
| 222 | Ga0207643_10063681 | 3300025908 | Bacteria | 2109 |
| 223 | Ga0207684_10002895 | 3300025910 | Bacteria | 17010 |
| 224 | Ga0207684_10096748 | 3300025910 | Bacteria | 2520 |
| 225 | Ga0207671_10001110 | 3300025914 | Bacteria | 32453 |
| 226 | Ga0207693_10001394 | 3300025915 | Bacteria | 21405 |
| 227 | Ga0207693_10003334 | 3300025915 | Bacteria | 13739 |
| 228 | Ga0207693_10008049 | 3300025915 | Bacteria | 8652 |
| 229 | Ga0207693_10016153 | 3300025915 | Bacteria | 5971 |
| 230 | Ga0207693_10021512 | 3300025915 | Bacteria | 5124 |
| 231 | Ga0207663_10002702 | 3300025916 | Bacteria | 8555 |
| 232 | Ga0207662_10012788 | 3300025918 | Bacteria | 4682 |
| 233 | Ga0207662_10024763 | 3300025918 | Bacteria | 3454 |
| 234 | Ga0207657_10006877 | 3300025919 | Bacteria | 11737 |
| 235 | Ga0207657_10020250 | 3300025919 | Bacteria | 6293 |
| 236 | Ga0207657_10056571 | 3300025919 | Bacteria | 3384 |
| 237 | Ga0207657_10061524 | 3300025919 | Bacteria | 3218 |
| 238 | Ga0207652_10005615 | 3300025921 | Bacteria | 10176 |
| 239 | Ga0207646_10005267 | 3300025922 | Bacteria | 13639 |
| 240 | Ga0207646_10006511 | 3300025922 | Bacteria | 12055 |
| 241 | Ga0207659_10027441 | 3300025926 | Bacteria | 3855 |
| 242 | Ga0207687_10102872 | 3300025927 | Bacteria | 2105 |
| 243 | Ga0207687_10166833 | 3300025927 | Bacteria | 1695 |
| 244 | Ga0207700_10013193 | 3300025928 | Bacteria | 5366 |
| 245 | Ga0207700_10017788 | 3300025928 | Bacteria | 4756 |
| 246 | Ga0207700_10028349 | 3300025928 | Bacteria | 3935 |
| 247 | Ga0207700_10067357 | 3300025928 | Bacteria | 2740 |
| 248 | Ga0207664_10010087 | 3300025929 | Bacteria | 6658 |
| 249 | Ga0207664_10032123 | 3300025929 | Bacteria | 4022 |
| 250 | Ga0207644_10014395 | 3300025931 | Bacteria | 5291 |
| 251 | Ga0207706_10009888 | 3300025933 | Bacteria | 8748 |
| 252 | Ga0207706_10017955 | 3300025933 | Bacteria | 6367 |
| 253 | Ga0207706_10027818 | 3300025933 | Bacteria | 5054 |
| 254 | Ga0207706_10035702 | 3300025933 | Bacteria | 4418 |
| 255 | Ga0207706_10065345 | 3300025933 | Bacteria | 3203 |
| 256 | Ga0207706_10145110 | 3300025933 | Bacteria | 2088 |
| 257 | Ga0207709_10082687 | 3300025935 | Bacteria | 2074 |
| 258 | Ga0207670_10015775 | 3300025936 | Bacteria | 4523 |
| 259 | Ga0207665_10001604 | 3300025939 | Bacteria | 15248 |
| 260 | Ga0207665_10002187 | 3300025939 | Bacteria | 13215 |
| 261 | Ga0207665_10006158 | 3300025939 | Bacteria | 7967 |
| 262 | Ga0207665_10011024 | 3300025939 | Bacteria | 5934 |
| 263 | Ga0207665_10067307 | 3300025939 | Bacteria | 2439 |
| 264 | Ga0207665_10111621 | 3300025939 | Bacteria | 1922 |
| 265 | Ga0207691_10045389 | 3300025940 | Bacteria | 4039 |
| 266 | Ga0207711_10034870 | 3300025941 | Bacteria | 4262 |
| 267 | Ga0207689_10025359 | 3300025942 | Bacteria | 4969 |
| 268 | Ga0207689_10088384 | 3300025942 | Bacteria | 2545 |
| 269 | Ga0207661_10085376 | 3300025944 | Bacteria | 2616 |
| 270 | Ga0207667_10012779 | 3300025949 | Bacteria | 9644 |
| 271 | Ga0207651_10036222 | 3300025960 | Bacteria | 3219 |
| 272 | Ga0207668_10001956 | 3300025972 | Bacteria | 12053 |
| 273 | Ga0207658_10032959 | 3300025986 | Bacteria | 3692 |
| 274 | Ga0207677_10042210 | 3300026023 | Bacteria | 3023 |
| 275 | Ga0207677_10068782 | 3300026023 | Bacteria | 2487 |
| 276 | Ga0207703_10001637 | 3300026035 | Bacteria | 20186 |
| 277 | Ga0207639_10122657 | 3300026041 | Bacteria | 2137 |
| 278 | Ga0207678_10010983 | 3300026067 | Bacteria | 7954 |
| 279 | Ga0207678_10011222 | 3300026067 | Bacteria | 7870 |
| 280 | Ga0207678_10015276 | 3300026067 | Bacteria | 6753 |
| 281 | Ga0207678_10019597 | 3300026067 | Bacteria | 5946 |
| 282 | Ga0207678_10052876 | 3300026067 | Bacteria | 3502 |
| 283 | Ga0207678_10055042 | 3300026067 | Bacteria | 3426 |
| 284 | Ga0207678_10069896 | 3300026067 | Bacteria | 3010 |
| 285 | Ga0207678_10099774 | 3300026067 | Bacteria | 2480 |
| 286 | Ga0207708_10021659 | 3300026075 | Bacteria | 4848 |
| 287 | Ga0207702_10001744 | 3300026078 | Bacteria | 21387 |
| 288 | Ga0207702_10011750 | 3300026078 | Bacteria | 7294 |
| 289 | Ga0207641_10013183 | 3300026088 | Bacteria | 6778 |
| 290 | Ga0207641_10101803 | 3300026088 | Bacteria | 2532 |
| 291 | Ga0207676_10189753 | 3300026095 | Bacteria | 1807 |
| 292 | Ga0207674_10034983 | 3300026116 | Bacteria | 5245 |
| 293 | Ga0207674_10035385 | 3300026116 | Bacteria | 5211 |
| 294 | Ga0207674_10037641 | 3300026116 | Bacteria | 5029 |
| 295 | Ga0207674_10052862 | 3300026116 | Bacteria | 4142 |
| 296 | Ga0207674_10056821 | 3300026116 | Bacteria | 3971 |
| 297 | Ga0207674_10080075 | 3300026116 | Bacteria | 3270 |
| 298 | Ga0207674_10083033 | 3300026116 | Bacteria | 3203 |
| 299 | Ga0207675_100032639 | 3300026118 | Bacteria | 4850 |
| 300 | Ga0207675_100043257 | 3300026118 | Bacteria | 4207 |
| 301 | Ga0207675_100149280 | 3300026118 | Bacteria | 2224 |
| 302 | Ga0207683_10023161 | 3300026121 | Bacteria | 5337 |
| 303 | Ga0207683_10052256 | 3300026121 | Bacteria | 3580 |
| 304 | Ga0207683_10090274 | 3300026121 | Bacteria | 2728 |
| 305 | Ga0207683_10139381 | 3300026121 | Bacteria | 2185 |
| 306 | Ga0207428_10053149 | 3300027907 | Bacteria | 3231 |
| 307 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 308 | Ga0268266_10005453 | 3300028379 | Bacteria | 11853 |
| 309 | Ga0268266_10029429 | 3300028379 | Bacteria | 4669 |
| 310 | Ga0268265_10101647 | 3300028380 | Bacteria | 2323 |
| 311 | Ga0265337_1003142 | 3300028556 | Bacteria | 7273 |
| 312 | Ga0265336_10003485 | 3300028666 | Bacteria | 6156 |
| 313 | Ga0307515_10000456 | 3300028794 | Bacteria | 97538 |
| 314 | Ga0307515_10036149 | 3300028794 | Bacteria | 8004 |
| 315 | Ga0307515_10046075 | 3300028794 | Bacteria | 6678 |
| 316 | Ga0307515_10103950 | 3300028794 | Bacteria | 3399 |
| 317 | Ga0265338_10004224 | 3300028800 | Bacteria | 19552 |
| 318 | Ga0265338_10005162 | 3300028800 | Bacteria | 17168 |
| 319 | Ga0265324_10002929 | 3300029957 | Bacteria | 8367 |
| 320 | Ga0307512_10007181 | 3300030522 | Bacteria | 11085 |
| 321 | Ga0307512_10008020 | 3300030522 | Bacteria | 10360 |
| 322 | Ga0265332_10014040 | 3300031238 | Bacteria | 3543 |
| 323 | Ga0265320_10000584 | 3300031240 | Bacteria | 28109 |
| 324 | Ga0265320_10000631 | 3300031240 | Bacteria | 26946 |
| 325 | Ga0265320_10023782 | 3300031240 | Bacteria | 3253 |
| 326 | Ga0265325_10079709 | 3300031241 | Bacteria | 1629 |
| 327 | Ga0307513_10001838 | 3300031456 | Bacteria | 30130 |
| 328 | Ga0307513_10004469 | 3300031456 | Bacteria | 18672 |
| 329 | Ga0307509_10047050 | 3300031507 | Bacteria | 4641 |
| 330 | Ga0265313_10020736 | 3300031595 | Bacteria | 3617 |
| 331 | Ga0307508_10002212 | 3300031616 | Bacteria | 20747 |
| 332 | Ga0307508_10019006 | 3300031616 | Bacteria | 6243 |
| 333 | Ga0307508_10026744 | 3300031616 | Bacteria | 5229 |
| 334 | Ga0316579_10011725 | 3300031691 | Bacteria | 3733 |
| 335 | Ga0265314_10001042 | 3300031711 | Bacteria | 32320 |
| 336 | Ga0265342_10013750 | 3300031712 | Bacteria | 5406 |
| 337 | Ga0307518_10002915 | 3300031838 | Bacteria | 12420 |
| 338 | Ga0307412_10013256 | 3300031911 | Bacteria | 4826 |
| 339 | Ga0307409_100011709 | 3300031995 | Bacteria | 5548 |
| 340 | Ga0307409_100105678 | 3300031995 | Bacteria | 2348 |
| 341 | Ga0307409_100141808 | 3300031995 | Bacteria | 2072 |
| 342 | Ga0307409_100159216 | 3300031995 | Bacteria | 1972 |
| 343 | Ga0307414_10003714 | 3300032004 | Bacteria | 8186 |
| 344 | Ga0307414_10182977 | 3300032004 | Bacteria | 1687 |
| 345 | Ga0307415_100003630 | 3300032126 | Bacteria | 7889 |
| 346 | Ga0307415_100161534 | 3300032126 | Bacteria | 1737 |
| 347 | Ga0307507_10004675 | 3300033179 | Bacteria | 23774 |
| 348 | Ga0307507_10047549 | 3300033179 | Bacteria | 4187 |
| 349 | Ga0307510_10003235 | 3300033180 | Bacteria | 18933 |
| 350 | Ga0307510_10025725 | 3300033180 | Bacteria | 6782 |
| 351 | Ga0307510_10040826 | 3300033180 | Bacteria | 5084 |
| 352 | Ga0373926_0001284 | 3300035083 | Bacteria | 7557 |
| 353 | Ga0373923_0014478 | 3300035111 | Bacteria | 2963 |
| 354 | Ga0373936_0002046 | 3300035113 | Bacteria | 7472 |
| 355 | Ga0373936_0011727 | 3300035113 | Bacteria | 3324 |
| 356 | Ga0373945_0000375 | 3300035116 | Bacteria | 12851 |
| 357 | Ga0373953_0015437 | 3300035117 | Bacteria | 2768 |
| 358 | Ga0373953_0022533 | 3300035117 | Bacteria | 2376 |
| 359 | Ga0373953_0031235 | 3300035117 | Bacteria | 2070 |
| 360 | Ga0373956_0000970 | 3300035119 | Bacteria | 11908 |
| 361 | Ga0373956_0009086 | 3300035119 | Bacteria | 4030 |
| 362 | Ga0373957_0014511 | 3300035120 | Bacteria | 2694 |
| 363 | Ga0373960_0013726 | 3300035121 | Bacteria | 2039 |
| 364 | Ga0373943_0000129 | 3300035170 | Bacteria | 28679 |
| 365 | Ga0373943_0001180 | 3300035170 | Bacteria | 11664 |
| 366 | Ga0373946_0000242 | 3300035171 | Bacteria | 17204 |
| 367 | Ga0373946_0002798 | 3300035171 | Bacteria | 6168 |
| 368 | Ga0373955_0005820 | 3300035172 | Bacteria | 5567 |
| 369 | Ga0373955_0050635 | 3300035172 | Bacteria | 2259 |
| 370 | Ga0373924_0000750 | 3300035410 | Bacteria | 10109 |
| 371 | Ga0373924_0004493 | 3300035410 | Bacteria | 4877 |
| 372 | Ga0373924_0021296 | 3300035410 | Bacteria | 2527 |
| 373 | Ga0373935_0014178 | 3300035692 | Unclassified | 4809 |
| 374 | Ga0373935_0014651 | 3300035692 | Bacteria | 4731 |
| 375 | Ga0373935_0021142 | 3300035692 | Bacteria | 3983 |
| 376 | Ga0373927_0003873 | 3300035695 | Bacteria | 10609 |
| 377 | Ga0373933_0015835 | 3300035724 | Bacteria | 4208 |
| 378 | Ga0373933_0020652 | 3300035724 | Bacteria | 3733 |
| 379 | Ga0373947_0001856 | 3300035725 | Bacteria | 12880 |
| 380 | Ga0373947_0015165 | 3300035725 | Bacteria | 4424 |
| 381 | Ga0373947_0068144 | 3300035725 | Bacteria | 2175 |
| 382 | Ga0372808_002217 | 3300036459 | Bacteria | 2200 |
| 383 | Ga0316584_0022151 | 3300036712 | Unclassified | 4631 |
| 384 | Ga0373925_0000177 | 3300037068 | Bacteria | 69605 |
| 385 | Ga0373925_0003615 | 3300037068 | Bacteria | 11916 |
| 386 | Ga0373925_0032872 | 3300037068 | Bacteria | 3820 |
| 387 | Ga0373925_0082139 | 3300037068 | Bacteria | 2452 |
| 388 | Ga0373925_0142407 | 3300037068 | Bacteria | 1877 |
| 389 | Ga0395899_0000091 | 3300037312 | Bacteria | 154780 |
| 390 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 391 | Ga0395898_0002459 | 3300037466 | Bacteria | 21851 |
| 392 | Ga0395898_0017952 | 3300037466 | Bacteria | 7218 |
| 393 | Ga0395898_0058182 | 3300037466 | Bacteria | 3764 |
| 394 | Ga0395898_0074973 | 3300037466 | Bacteria | 3268 |
| 395 | Ga0395905_0046457 | 3300037471 | Bacteria | 4071 |
| 396 | Ga0436364_0103177 | 3300037853 | Bacteria | 67977 |
| 397 | Ga0436364_0764299 | 3300037853 | Bacteria | 2189 |
| 398 | Ga0436364_1261928 | 3300037853 | Bacteria | 13312 |
| 399 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 400 | Ga0436365_1238059 | 3300039437 | Bacteria | 1804 |
| 401 | Ga0436365_1885236 | 3300039437 | Bacteria | 5379 |
| 402 | Ga0451833_1162688 | 3300041491 | Bacteria | 4749 |
| 403 | Ga0451853_0323525 | 3300041512 | Bacteria | 6063 |
| 404 | Ga0439445_0004315 | 3300042004 | Bacteria | 3218 |
| 405 | Ga0450911_000124 | 3300042115 | Bacteria | 30673 |
| 406 | Ga0451577_0083155 | 3300042876 | Bacteria | 2855 |
| 407 | Ga0466972_0001395 | 3300044658 | Bacteria | 11710 |
| 408 | Ga0466972_0033019 | 3300044658 | Bacteria | 2539 |
| 409 | Ga0466960_0012342 | 3300044901 | Bacteria | 3602 |
| 410 | Ga0466967_0018193 | 3300045976 | Bacteria | 5606 |
| 411 | Ga0495627_000078 | 3300046453 | Bacteria | 119920 |
| 412 | Ga0495627_000939 | 3300046453 | Bacteria | 20046 |
| 413 | Ga0495592_0003588 | 3300046454 | Bacteria | 11156 |
| 414 | Ga0495592_0033654 | 3300046454 | Bacteria | 3865 |
| 415 | Ga0495603_0004389 | 3300046455 | Bacteria | 8406 |
| 416 | Ga0495641_0011856 | 3300046461 | Bacteria | 4925 |
| 417 | Ga0495651_0000950 | 3300046462 | Bacteria | 22399 |
| 418 | Ga0495651_0032332 | 3300046462 | Bacteria | 4081 |
| 419 | Ga0495651_0090440 | 3300046462 | Bacteria | 2296 |
| 420 | Ga0495653_0008312 | 3300046463 | Bacteria | 8506 |
| 421 | Ga0495653_0012779 | 3300046463 | Bacteria | 6854 |
| 422 | Ga0495653_0062980 | 3300046463 | Bacteria | 2801 |
| 423 | Ga0495653_0104813 | 3300046463 | Bacteria | 2043 |
| 424 | Ga0495580_0011006 | 3300046472 | Bacteria | 7011 |
| 425 | Ga0495580_0016612 | 3300046472 | Bacteria | 5520 |
| 426 | Ga0495582_0002565 | 3300046473 | Bacteria | 10112 |
| 427 | Ga0495662_0000938 | 3300046476 | Bacteria | 14281 |
| 428 | Ga0495594_0023142 | 3300046499 | Unclassified | 3326 |
| 429 | Ga0495583_0004588 | 3300046506 | Bacteria | 9796 |
| 430 | Ga0495608_0002908 | 3300046511 | Bacteria | 12260 |
| 431 | Ga0495608_0034479 | 3300046511 | Bacteria | 3415 |
| 432 | Ga0495608_0055321 | 3300046511 | Bacteria | 2622 |
| 433 | Ga0495608_0059385 | 3300046511 | Bacteria | 2520 |
| 434 | Ga0495610_0001502 | 3300046512 | Bacteria | 20504 |
| 435 | Ga0495618_0011128 | 3300046514 | Bacteria | 5452 |
| 436 | Ga0495618_0012264 | 3300046514 | Bacteria | 5203 |
| 437 | Ga0495618_0171047 | 3300046514 | Bacteria | 1382 |
| 438 | Ga0495628_0039393 | 3300046516 | Bacteria | 3780 |
| 439 | Ga0495628_0057808 | 3300046516 | Bacteria | 3050 |
| 440 | Ga0495630_0001927 | 3300046517 | Bacteria | 14476 |
| 441 | Ga0495630_0051296 | 3300046517 | Bacteria | 3088 |
| 442 | Ga0495631_0046322 | 3300046518 | Bacteria | 1912 |
| 443 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 444 | Ga0495637_0000088 | 3300046520 | Bacteria | 71915 |
| 445 | Ga0495637_0004718 | 3300046520 | Bacteria | 7035 |
| 446 | Ga0495643_0000006 | 3300046522 | Bacteria | 419524 |
| 447 | Ga0495648_0002964 | 3300046524 | Bacteria | 15231 |
| 448 | Ga0495648_0025371 | 3300046524 | Bacteria | 4014 |
| 449 | Ga0495663_0000001 | 3300046525 | Bacteria | 595264 |
| 450 | Ga0495666_0021076 | 3300046526 | Bacteria | 3227 |
| 451 | Ga0495666_0061266 | 3300046526 | Bacteria | 1798 |
| 452 | Ga0495652_0005862 | 3300046529 | Bacteria | 11496 |
| 453 | Ga0495652_0008046 | 3300046529 | Bacteria | 9660 |
| 454 | Ga0495652_0016357 | 3300046529 | Bacteria | 6636 |
| 455 | Ga0495652_0042844 | 3300046529 | Bacteria | 3902 |
| 456 | Ga0495665_0001964 | 3300046531 | Bacteria | 11105 |
| 457 | Ga0495640_0009996 | 3300046533 | Bacteria | 7356 |
| 458 | Ga0495640_0065988 | 3300046533 | Bacteria | 2441 |
| 459 | Ga0495586_0002352 | 3300046535 | Bacteria | 10291 |
| 460 | Ga0495587_0000345 | 3300046536 | Bacteria | 33064 |
| 461 | Ga0495587_0023240 | 3300046536 | Unclassified | 3810 |
| 462 | Ga0495587_0030726 | 3300046536 | Bacteria | 3257 |
| 463 | Ga0495645_0053901 | 3300046543 | Bacteria | 2922 |
| 464 | Ga0495633_0000053 | 3300046558 | Bacteria | 152374 |
| 465 | Ga0495633_0000424 | 3300046558 | Bacteria | 43906 |
| 466 | Ga0495667_0003206 | 3300046559 | Bacteria | 10968 |
| 467 | Ga0495667_0004058 | 3300046559 | Bacteria | 9838 |
| 468 | Ga0495667_0033563 | 3300046559 | Bacteria | 3434 |
| 469 | Ga0495668_0062364 | 3300046616 | Bacteria | 2054 |
| 470 | Ga0495634_0011880 | 3300046642 | Bacteria | 6327 |
| 471 | Ga0495625_0000014 | 3300046660 | Bacteria | 323486 |
| 472 | Ga0495625_0000373 | 3300046660 | Bacteria | 68625 |
| 473 | Ga0495635_0001305 | 3300046663 | Bacteria | 16644 |
| 474 | Ga0495635_0006403 | 3300046663 | Bacteria | 8206 |
| 475 | Ga0495635_0012165 | 3300046663 | Bacteria | 6034 |
| 476 | Ga0495635_0028428 | 3300046663 | Bacteria | 3886 |
| 477 | Ga0495588_0008813 | 3300046674 | Bacteria | 4637 |
| 478 | Ga0495657_0003044 | 3300046675 | Bacteria | 13872 |
| 479 | Ga0495657_0009809 | 3300046675 | Bacteria | 7229 |
| 480 | Ga0495657_0015303 | 3300046675 | Bacteria | 5616 |
| 481 | Ga0495599_0010916 | 3300046678 | Bacteria | 5568 |
| 482 | Ga0495599_0021657 | 3300046678 | Bacteria | 4010 |
| 483 | Ga0495599_0050948 | 3300046678 | Bacteria | 2594 |
| 484 | Ga0495623_0008957 | 3300046679 | Bacteria | 6499 |
| 485 | Ga0495623_0026268 | 3300046679 | Bacteria | 3749 |
| 486 | Ga0495646_0025300 | 3300046680 | Bacteria | 3734 |
| 487 | Ga0495646_0029906 | 3300046680 | Bacteria | 3402 |
| 488 | Ga0495624_0000989 | 3300046690 | Bacteria | 22470 |
| 489 | Ga0495624_0002326 | 3300046690 | Bacteria | 14470 |
| 490 | Ga0495624_0002760 | 3300046690 | Bacteria | 13187 |
| 491 | Ga0495670_0001666 | 3300046691 | Bacteria | 10897 |
| 492 | Ga0495671_0000008 | 3300046692 | Bacteria | 419524 |
| 493 | Ga0495671_0006971 | 3300046692 | Bacteria | 6480 |
| 494 | Ga0495671_0029544 | 3300046692 | Bacteria | 2814 |
| 495 | Ga0495600_0019097 | 3300046809 | Bacteria | 4373 |
| 496 | Ga0495600_0026610 | 3300046809 | Bacteria | 3734 |
| 497 | Ga0495600_0036267 | 3300046809 | Bacteria | 3204 |
| 498 | Ga0495581_0000510 | 3300047315 | Bacteria | 19910 |
| 499 | Ga0495581_0020951 | 3300047315 | Bacteria | 3793 |
| 500 | Ga0495604_0000884 | 3300047317 | Bacteria | 24919 |
| 501 | Ga0495604_0006999 | 3300047317 | Bacteria | 8937 |
| 502 | Ga0495604_0084086 | 3300047317 | Bacteria | 2377 |
| 503 | Ga0495674_0003043 | 3300047319 | Bacteria | 16312 |
| 504 | Ga0495674_0012615 | 3300047319 | Bacteria | 7962 |
| 505 | Ga0495674_0018553 | 3300047319 | Bacteria | 6475 |
| 506 | Ga0495674_0040366 | 3300047319 | Bacteria | 4175 |
| 507 | Ga0495674_0102978 | 3300047319 | Bacteria | 2427 |
| 508 | Ga0495672_0006713 | 3300047320 | Bacteria | 8834 |
| 509 | Ga0495672_0015785 | 3300047320 | Bacteria | 5115 |
| 510 | Ga0495676_0002502 | 3300047321 | Bacteria | 16361 |
| 511 | Ga0495676_0021417 | 3300047321 | Bacteria | 5645 |
| 512 | Ga0495680_0008897 | 3300047322 | Bacteria | 9077 |
| 513 | Ga0495680_0018754 | 3300047322 | Bacteria | 5864 |
| 514 | Ga0495680_0022567 | 3300047322 | Bacteria | 5242 |
| 515 | Ga0495680_0051412 | 3300047322 | Bacteria | 3217 |
| 516 | Ga0495680_0052464 | 3300047322 | Bacteria | 3178 |
| 517 | Ga0495675_0009340 | 3300047444 | Bacteria | 6099 |
| 518 | Ga0495675_0023179 | 3300047444 | Bacteria | 3956 |
| 519 | Ga0495675_0026882 | 3300047444 | Bacteria | 3668 |
| 520 | Ga0495677_0001245 | 3300047445 | Bacteria | 10197 |
| 521 | Ga0495681_0000022 | 3300047470 | Bacteria | 165281 |
| 522 | Ga0495681_0002045 | 3300047470 | Bacteria | 14697 |
| 523 | Ga0495684_0007992 | 3300047471 | Bacteria | 8176 |
| 524 | Ga0495684_0008048 | 3300047471 | Bacteria | 8152 |
| 525 | Ga0495684_0013394 | 3300047471 | Bacteria | 6312 |
| 526 | Ga0495684_0039063 | 3300047471 | Bacteria | 3638 |
| 527 | Ga0495684_0042567 | 3300047471 | Bacteria | 3478 |
| 528 | Ga0495686_0008331 | 3300047472 | Bacteria | 7620 |
| 529 | Ga0495686_0036614 | 3300047472 | Bacteria | 3149 |
| 530 | Ga0495686_0039467 | 3300047472 | Bacteria | 3015 |
| 531 | Ga0495593_0051201 | 3300047673 | Bacteria | 2185 |
| 532 | Ga0495602_0009207 | 3300048088 | Bacteria | 10278 |
| 533 | Ga0495602_0045787 | 3300048088 | Bacteria | 3956 |
| 534 | Ga0495602_0072763 | 3300048088 | Bacteria | 2929 |
| 535 | Ga0495602_0110417 | 3300048088 | Bacteria | 2235 |
| 536 | Ga0495602_0114340 | 3300048088 | Bacteria | 2185 |
| 537 | Ga0496100_0001545 | 3300048903 | Bacteria | 11304 |
| 538 | Ga0496101_0006501 | 3300048904 | Bacteria | 7525 |
| 539 | Ga0496101_0031887 | 3300048904 | Bacteria | 3706 |
| 540 | Ga0496101_0080995 | 3300048904 | Bacteria | 2400 |
| 541 | Ga0496102_0000286 | 3300048905 | Bacteria | 64518 |
| 542 | Ga0496102_0000597 | 3300048905 | Bacteria | 37872 |
| 543 | Ga0496102_0006754 | 3300048905 | Bacteria | 9795 |
| 544 | Ga0496102_0032587 | 3300048905 | Bacteria | 4681 |
| 545 | Ga0496102_0051173 | 3300048905 | Bacteria | 3763 |
| 546 | Ga0496102_0116117 | 3300048905 | Bacteria | 2498 |
| 547 | Ga0496103_0000490 | 3300048906 | Bacteria | 32894 |
| 548 | Ga0496104_0001473 | 3300048907 | Bacteria | 20326 |
| 549 | Ga0496104_0003060 | 3300048907 | Bacteria | 14414 |
| 550 | Ga0496104_0003963 | 3300048907 | Bacteria | 12814 |
| 551 | Ga0496104_0008437 | 3300048907 | Bacteria | 9162 |
| 552 | Ga0496104_0024032 | 3300048907 | Bacteria | 5607 |
| 553 | Ga0496104_0198845 | 3300048907 | Bacteria | 1916 |
| 554 | Ga0496104_0241722 | 3300048907 | Bacteria | 1718 |
| 555 | Ga0496105_0002023 | 3300048908 | Bacteria | 14649 |
| 556 | Ga0496105_0011879 | 3300048908 | Bacteria | 6896 |
| 557 | Ga0496105_0012595 | 3300048908 | Bacteria | 6697 |
| 558 | Ga0496105_0014155 | 3300048908 | Bacteria | 6347 |
| 559 | Ga0496105_0102504 | 3300048908 | Bacteria | 2363 |
| 560 | Ga0496106_0027628 | 3300048909 | Bacteria | 4227 |
| 561 | Ga0496106_0122083 | 3300048909 | Bacteria | 2037 |
| 562 | Ga0496107_0079383 | 3300048910 | Bacteria | 2392 |
| 563 | Ga0496107_0083010 | 3300048910 | Bacteria | 2336 |
| 564 | Ga0496107_0135991 | 3300048910 | Bacteria | 1815 |
| 565 | Ga0496108_0010632 | 3300048911 | Bacteria | 7465 |
| 566 | Ga0496108_0017998 | 3300048911 | Bacteria | 5780 |
| 567 | Ga0496108_0039650 | 3300048911 | Bacteria | 3925 |
| 568 | Ga0496108_0051720 | 3300048911 | Bacteria | 3441 |
| 569 | Ga0496108_0114705 | 3300048911 | Bacteria | 2307 |
| 570 | Ga0496109_0011608 | 3300048912 | Bacteria | 7576 |
| 571 | Ga0496109_0031161 | 3300048912 | Bacteria | 4783 |
| 572 | Ga0496109_0032929 | 3300048912 | Bacteria | 4663 |
| 573 | Ga0496109_0045004 | 3300048912 | Bacteria | 4005 |
| 574 | Ga0496109_0073903 | 3300048912 | Bacteria | 3133 |
| 575 | Ga0496110_0001000 | 3300048913 | Bacteria | 19881 |
| 576 | Ga0496110_0004537 | 3300048913 | Bacteria | 10778 |
| 577 | Ga0496110_0066517 | 3300048913 | Bacteria | 3187 |
| 578 | Ga0496111_0013741 | 3300048914 | Bacteria | 5515 |
| 579 | Ga0496111_0017504 | 3300048914 | Bacteria | 4956 |
| 580 | Ga0496111_0021375 | 3300048914 | Bacteria | 4517 |
| 581 | Ga0496112_0018227 | 3300048915 | Bacteria | 6608 |
| 582 | Ga0496112_0035818 | 3300048915 | Bacteria | 4837 |
| 583 | Ga0496112_0208399 | 3300048915 | Bacteria | 1912 |
| 584 | Ga0496113_0028398 | 3300048916 | Bacteria | 4023 |
| 585 | Ga0496113_0063145 | 3300048916 | Bacteria | 2799 |
| 586 | Ga0496113_0111440 | 3300048916 | Bacteria | 2130 |
| 587 | Ga0496114_0008354 | 3300048917 | Bacteria | 8200 |
| 588 | Ga0496114_0014087 | 3300048917 | Bacteria | 6411 |
| 589 | Ga0496114_0027090 | 3300048917 | Bacteria | 4695 |
| 590 | Ga0496114_0048288 | 3300048917 | Bacteria | 3540 |
| 591 | Ga0496114_0065841 | 3300048917 | Bacteria | 3036 |
| 592 | Ga0496114_0110278 | 3300048917 | Bacteria | 2357 |
| 593 | Ga0496114_0152875 | 3300048917 | Bacteria | 2002 |
| 594 | Ga0496114_0181426 | 3300048917 | Bacteria | 1839 |
| 595 | Ga0496115_0012725 | 3300048918 | Bacteria | 6341 |
| 596 | Ga0496115_0030072 | 3300048918 | Bacteria | 4270 |
| 597 | Ga0496115_0279334 | 3300048918 | Bacteria | 1371 |
| 598 | Ga0496116_0000716 | 3300048919 | Bacteria | 42501 |
| 599 | Ga0496117_0000579 | 3300048920 | Bacteria | 60223 |
| 600 | Ga0496118_0000587 | 3300048921 | Bacteria | 60205 |
| 601 | Ga0496119_0001329 | 3300048922 | Bacteria | 30377 |
| 602 | Ga0496120_0002815 | 3300048923 | Bacteria | 16800 |
| 603 | Ga0496121_0016612 | 3300048924 | Bacteria | 7585 |
| 604 | Ga0496123_0010794 | 3300048926 | Bacteria | 8015 |
| 605 | Ga0496124_0063030 | 3300048927 | Bacteria | 3099 |
| 606 | Ga0496125_0003687 | 3300048928 | Bacteria | 18296 |
| 607 | Ga0496125_0004511 | 3300048928 | Bacteria | 16008 |
| 608 | Ga0496126_0000272 | 3300048929 | Bacteria | 110072 |
| 609 | Ga0496126_0000588 | 3300048929 | Bacteria | 68756 |
| 610 | Ga0496126_0000649 | 3300048929 | Bacteria | 64480 |
| 611 | Ga0496126_0020830 | 3300048929 | Bacteria | 6418 |
| 612 | Ga0496126_0025832 | 3300048929 | Bacteria | 5643 |
| 613 | Ga0496126_0088657 | 3300048929 | Bacteria | 2725 |
| 614 | Ga0501033_0065851 | 3300049570 | Bacteria | 2665 |
| 615 | Ga0501034_0020094 | 3300049571 | Bacteria | 6820 |
| 616 | Ga0501036_0005090 | 3300049572 | Bacteria | 10639 |
| 617 | Ga0501038_0038142 | 3300049574 | Bacteria | 4209 |
| 618 | Ga0501038_0038679 | 3300049574 | Bacteria | 4176 |
| 619 | Ga0501039_0061030 | 3300049575 | Bacteria | 2920 |
| 620 | Ga0501043_0017475 | 3300049579 | Bacteria | 5623 |
| 621 | Ga0501046_0035807 | 3300049580 | Bacteria | 3998 |
| 622 | Ga0501047_0000514 | 3300049581 | Bacteria | 41781 |
| 623 | Ga0501047_0012506 | 3300049581 | Bacteria | 8038 |
| 624 | Ga0501048_0073434 | 3300049582 | Bacteria | 2414 |
| 625 | Ga0501067_0016723 | 3300049583 | Bacteria | 4053 |
| 626 | Ga0501067_0051568 | 3300049583 | Bacteria | 2280 |
| 627 | Ga0501067_0054191 | 3300049583 | Bacteria | 2222 |
| 628 | Ga0501071_0018860 | 3300049587 | Bacteria | 4784 |
| 629 | Ga0501072_0004592 | 3300049588 | Bacteria | 10510 |
| 630 | nmdc:mga00v17_3991_c1 | 3300050491 | Bacteria | 7618 |
| 631 | nmdc:mga0yw44_11116_c1 | 3300050492 | Bacteria | 4628 |
| 632 | nmdc:mga0yw44_15782_c1 | 3300050492 | Bacteria | 4059 |
| 633 | nmdc:mga07m45_21284_c1 | 3300050496 | Bacteria | 3529 |
| 634 | nmdc:mga05p37_6701_c1 | 3300050507 | Bacteria | 13571 |
| 635 | nmdc:mga09592_71_c1 | 3300050508 | Bacteria | 57332 |
| 636 | nmdc:mga0qj67_6384_c1 | 3300050509 | Bacteria | 8660 |
| 637 | nmdc:mga06r32_31467_c1 | 3300050510 | Bacteria | 4984 |
| 638 | nmdc:mga08y16_55524_c1 | 3300050511 | Bacteria | 4138 |
| 639 | nmdc:mga0rr50_109703_c1 | 3300050513 | Bacteria | 2182 |
| 640 | nmdc:mga0a205_86348_c1 | 3300050515 | Bacteria | 3030 |
| 641 | Ga0495601_0043059 | 3300053077 | Bacteria | 2835 |
| 642 | Ga0495612_0026850 | 3300053078 | Bacteria | 2313 |
| 643 | Ga0495595_0019955 | 3300053084 | Bacteria | 2912 |
| 644 | Ga0495619_0012890 | 3300053085 | Bacteria | 5265 |
| 645 | Ga0495619_0099843 | 3300053085 | Bacteria | 1974 |
| 646 | Ga0500643_000221 | 3300053087 | Bacteria | 53085 |
| 647 | Ga0500566_0006585 | 3300053094 | Bacteria | 6885 |
| 648 | Ga0500641_0020714 | 3300053096 | Bacteria | 2498 |
| 649 | Ga0500556_0000532 | 3300053104 | Bacteria | 26053 |
| 650 | Ga0500594_0006883 | 3300053118 | Bacteria | 2563 |
| 651 | Ga0500568_0001089 | 3300053139 | Bacteria | 18282 |
| 652 | Ga0500568_0030813 | 3300053139 | Bacteria | 2218 |
| 653 | Ga0500604_0000011 | 3300053151 | Bacteria | 104892 |
| 654 | Ga0500616_0000123 | 3300053153 | Bacteria | 140214 |
| 655 | Ga0500627_0000001 | 3300053158 | Bacteria | 251552 |
| 656 | Ga0501084_0006171 | 3300054114 | Bacteria | 9857 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0079383 | Ga0496107_0079383_1046_2341 | 399 |
| 2 | 3300013306 | Ga0163162_10112126 | Ga0163162_101121263 | 405 |
| 3 | 3300049570 | Ga0501033_0065851 | Ga0501033_0065851_307_1638 | 405 |
| 4 | 3300048918 | Ga0496115_0279334 | Ga0496115_0279334_34_1359 | 409 |
| 5 | 3300046514 | Ga0495618_0171047 | Ga0495618_0171047_12_1358 | 413 |
| 6 | 3300048917 | Ga0496114_0152875 | Ga0496114_0152875_540_1964 | 423 |
| 7 | 3300046518 | Ga0495631_0046322 | Ga0495631_0046322_530_1897 | 424 |
| 8 | 3300047322 | Ga0495680_0022567 | Ga0495680_0022567_1196_2632 | 429 |
| 9 | 3300048910 | Ga0496107_0135991 | Ga0496107_0135991_390_1802 | 438 |
| 10 | 3300035119 | Ga0373956_0000970 | Ga0373956_0000970_5281_6834 | 451 |
| 11 | 3300048903 | Ga0496100_0001545 | Ga0496100_0001545_3378_4997 | 451 |
| 12 | 3300048904 | Ga0496101_0006501 | Ga0496101_0006501_3194_4813 | 451 |
| 13 | 3300048908 | Ga0496105_0012595 | Ga0496105_0012595_1488_3110 | 451 |
| 14 | 3300048922 | Ga0496119_0001329 | Ga0496119_0001329_6339_7961 | 451 |
| 15 | 3300048923 | Ga0496120_0002815 | Ga0496120_0002815_2858_4480 | 451 |
| 16 | 3300048927 | Ga0496124_0063030 | Ga0496124_0063030_149_1771 | 451 |
| 17 | 3300033179 | Ga0307507_10047549 | Ga0307507_100475493 | 453 |
| 18 | 3300053085 | Ga0495619_0012890 | Ga0495619_0012890_2538_4001 | 453 |
| 19 | 3300031995 | Ga0307409_100141808 | Ga0307409_1001418082 | 457 |
| 20 | 3300046463 | Ga0495653_0104813 | Ga0495653_0104813_15_1478 | 457 |
| 21 | 3300025928 | Ga0207700_10028349 | Ga0207700_100283493 | 460 |
| 22 | 3300048912 | Ga0496109_0073903 | Ga0496109_0073903_552_2102 | 460 |
| 23 | 3300005841 | Ga0068863_100034139 | Ga0068863_1000341394 | 462 |
| 24 | 3300005985 | Ga0081539_10000999 | Ga0081539_1000099958 | 462 |
| 25 | 3300026088 | Ga0207641_10013183 | Ga0207641_100131831 | 462 |
| 26 | 3300028800 | Ga0265338_10005162 | Ga0265338_1000516210 | 462 |
| 27 | 3300048905 | Ga0496102_0000286 | Ga0496102_0000286_6300_7922 | 462 |
| 28 | 3300048906 | Ga0496103_0000490 | Ga0496103_0000490_6301_7923 | 462 |
| 29 | 3300048919 | Ga0496116_0000716 | Ga0496116_0000716_6301_7923 | 462 |
| 30 | 3300048920 | Ga0496117_0000579 | Ga0496117_0000579_24008_25630 | 462 |
| 31 | 3300048921 | Ga0496118_0000587 | Ga0496118_0000587_34576_36198 | 462 |
| 32 | 3300048929 | Ga0496126_0000649 | Ga0496126_0000649_56588_58210 | 462 |
| 33 | 3300005577 | Ga0068857_100081984 | Ga0068857_1000819842 | 463 |
| 34 | 3300026116 | Ga0207674_10080075 | Ga0207674_100800752 | 463 |
| 35 | 3300048917 | Ga0496114_0014087 | Ga0496114_0014087_3681_5216 | 464 |
| 36 | 3300035113 | Ga0373936_0002046 | Ga0373936_0002046_2711_4261 | 465 |
| 37 | 3300035116 | Ga0373945_0000375 | Ga0373945_0000375_1508_3058 | 465 |
| 38 | 3300035170 | Ga0373943_0000129 | Ga0373943_0000129_5188_6738 | 465 |
| 39 | 3300035171 | Ga0373946_0000242 | Ga0373946_0000242_7602_9152 | 465 |
| 40 | 3300035692 | Ga0373935_0014651 | Ga0373935_0014651_1578_3128 | 465 |
| 41 | 3300035695 | Ga0373927_0003873 | Ga0373927_0003873_4285_5835 | 465 |
| 42 | 3300035725 | Ga0373947_0001856 | Ga0373947_0001856_7959_9509 | 465 |
| 43 | 3300037068 | Ga0373925_0003615 | Ga0373925_0003615_2404_3954 | 465 |
| 44 | 3300046461 | Ga0495641_0011856 | Ga0495641_0011856_1941_3491 | 465 |
| 45 | 3300046462 | Ga0495651_0090440 | Ga0495651_0090440_474_2024 | 465 |
| 46 | 3300046463 | Ga0495653_0062980 | Ga0495653_0062980_339_1889 | 465 |
| 47 | 3300046517 | Ga0495630_0051296 | Ga0495630_0051296_909_2459 | 465 |
| 48 | 3300046529 | Ga0495652_0016357 | Ga0495652_0016357_4150_5700 | 465 |
| 49 | 3300046559 | Ga0495667_0003206 | Ga0495667_0003206_4465_6015 | 465 |
| 50 | 3300046663 | Ga0495635_0001305 | Ga0495635_0001305_11918_13468 | 465 |
| 51 | 3300046690 | Ga0495624_0002760 | Ga0495624_0002760_903_2453 | 465 |
| 52 | 3300047319 | Ga0495674_0018553 | Ga0495674_0018553_3783_5333 | 465 |
| 53 | 3300047471 | Ga0495684_0008048 | Ga0495684_0008048_5750_7300 | 465 |
| 54 | iso_pu_bacteria | 2643221654 | 2644303094 | 465 |
| 55 | iso_pu_bacteria | 2915358134 | 2915363004 | 465 |
| 56 | 3300013105 | Ga0157369_10033051 | Ga0157369_100330514 | 466 |
| 57 | 3300046472 | Ga0495580_0016612 | Ga0495580_0016612_1254_2855 | 466 |
| 58 | 3300046526 | Ga0495666_0021076 | Ga0495666_0021076_1604_3205 | 466 |
| 59 | 3300046690 | Ga0495624_0000989 | Ga0495624_0000989_17698_19299 | 466 |
| 60 | 3300047317 | Ga0495604_0084086 | Ga0495604_0084086_228_1829 | 466 |
| 61 | 3300047322 | Ga0495680_0018754 | Ga0495680_0018754_3379_4980 | 466 |
| 62 | 3300025302 | Ga0207426_1007082 | Ga0207426_10070822 | 467 |
| 63 | 3300049587 | Ga0501071_0018860 | Ga0501071_0018860_1799_3289 | 467 |
| 64 | 3300045976 | Ga0466967_0018193 | Ga0466967_0018193_2753_4240 | 468 |
| 65 | 3300046511 | Ga0495608_0059385 | Ga0495608_0059385_181_1785 | 468 |
| 66 | 3300005329 | Ga0070683_100013188 | Ga0070683_1000131885 | 469 |
| 67 | 3300005334 | Ga0068869_100009568 | Ga0068869_1000095685 | 469 |
| 68 | 3300005337 | Ga0070682_100101305 | Ga0070682_1001013051 | 469 |
| 69 | 3300005356 | Ga0070674_100041183 | Ga0070674_1000411833 | 469 |
| 70 | 3300005466 | Ga0070685_10086558 | Ga0070685_100865582 | 469 |
| 71 | 3300005617 | Ga0068859_100109284 | Ga0068859_1001092843 | 469 |
| 72 | 3300006931 | Ga0097620_100109284 | Ga0097620_1001092843 | 469 |
| 73 | 3300009094 | Ga0111539_10089136 | Ga0111539_100891363 | 469 |
| 74 | 3300025901 | Ga0207688_10000995 | Ga0207688_1000099512 | 469 |
| 75 | 3300026067 | Ga0207678_10019597 | Ga0207678_100195974 | 469 |
| 76 | 3300026118 | Ga0207675_100149280 | Ga0207675_1001492802 | 469 |
| 77 | 3300046678 | Ga0495599_0050948 | Ga0495599_0050948_536_2137 | 469 |
| 78 | 3300047444 | Ga0495675_0009340 | Ga0495675_0009340_1528_3129 | 469 |
| 79 | 3300049574 | Ga0501038_0038679 | Ga0501038_0038679_1769_3259 | 469 |
| 80 | iso_pu_bacteria | 2565956761 | 2566995155 | 469 |
| 81 | iso_pu_bacteria | 2643221561 | 2643827547 | 469 |
| 82 | iso_pu_bacteria | 2643221696 | 2644533622 | 469 |
| 83 | iso_pu_bacteria | 2738541308 | 2738889451 | 469 |
| 84 | iso_pu_bacteria | 2904535858 | 2904537321 | 469 |
| 85 | iso_pu_bacteria | 2922554459 | 2922559064 | 469 |
| 86 | 3300005543 | Ga0070672_100148817 | Ga0070672_1001488171 | 470 |
| 87 | 3300049579 | Ga0501043_0017475 | Ga0501043_0017475_2314_3831 | 470 |
| 88 | 3300049581 | Ga0501047_0000514 | Ga0501047_0000514_36801_38318 | 470 |
| 89 | 3300049582 | Ga0501048_0073434 | Ga0501048_0073434_107_1615 | 470 |
| 90 | 3300049588 | Ga0501072_0004592 | Ga0501072_0004592_2867_4375 | 470 |
| 91 | iso_pu_bacteria | 2824704595 | 2824709430 | 470 |
| 92 | iso_pu_bacteria | 2824753945 | 2824757730 | 470 |
| 93 | iso_pu_bacteria | 2824763712 | 2824768758 | 470 |
| 94 | iso_pu_bacteria | 2904711408 | 2904713068 | 470 |
| 95 | 3300005347 | Ga0070668_100039888 | Ga0070668_1000398882 | 471 |
| 96 | 3300005354 | Ga0070675_100196275 | Ga0070675_1001962751 | 471 |
| 97 | 3300005366 | Ga0070659_100058748 | Ga0070659_1000587482 | 471 |
| 98 | 3300005457 | Ga0070662_100042699 | Ga0070662_1000426993 | 471 |
| 99 | 3300005719 | Ga0068861_100021704 | Ga0068861_1000217043 | 471 |
| 100 | 3300009553 | Ga0105249_10170644 | Ga0105249_101706442 | 471 |
| 101 | 3300014745 | Ga0157377_10065040 | Ga0157377_100650402 | 471 |
| 102 | 3300025321 | Ga0207656_10053774 | Ga0207656_100537742 | 471 |
| 103 | 3300025919 | Ga0207657_10056571 | Ga0207657_100565712 | 471 |
| 104 | 3300025927 | Ga0207687_10166833 | Ga0207687_101668331 | 471 |
| 105 | 3300025933 | Ga0207706_10145110 | Ga0207706_101451102 | 471 |
| 106 | 3300026023 | Ga0207677_10068782 | Ga0207677_100687822 | 471 |
| 107 | 3300032126 | Ga0307415_100003630 | Ga0307415_1000036304 | 471 |
| 108 | 3300033180 | Ga0307510_10040826 | Ga0307510_100408263 | 471 |
| 109 | 3300036459 | Ga0372808_002217 | Ga0372808_002217_617_2185 | 471 |
| 110 | 3300048909 | Ga0496106_0122083 | Ga0496106_0122083_213_1721 | 471 |
| 111 | 3300048929 | Ga0496126_0000272 | Ga0496126_0000272_22929_24497 | 471 |
| 112 | iso_pu_bacteria | 2513237104 | 2513718960 | 471 |
| 113 | iso_pu_bacteria | 2513237141 | 2513891068 | 471 |
| 114 | 3300005337 | Ga0070682_100057762 | Ga0070682_1000577622 | 472 |
| 115 | 3300005466 | Ga0070685_10071439 | Ga0070685_100714392 | 472 |
| 116 | 3300005548 | Ga0070665_100072533 | Ga0070665_1000725333 | 472 |
| 117 | 3300005834 | Ga0068851_10061692 | Ga0068851_100616922 | 472 |
| 118 | 3300005844 | Ga0068862_100022922 | Ga0068862_1000229222 | 472 |
| 119 | 3300005937 | Ga0081455_10084898 | Ga0081455_100848982 | 472 |
| 120 | 3300009551 | Ga0105238_10163190 | Ga0105238_101631901 | 472 |
| 121 | 3300025907 | Ga0207645_10032768 | Ga0207645_100327683 | 472 |
| 122 | 3300025933 | Ga0207706_10009888 | Ga0207706_100098888 | 472 |
| 123 | 3300026067 | Ga0207678_10069896 | Ga0207678_100698962 | 472 |
| 124 | 3300026121 | Ga0207683_10139381 | Ga0207683_101393812 | 472 |
| 125 | 3300050496 | nmdc:mga07m45_21284_c1 | nmdc:mga07m45_21284_c1_411_1922 | 472 |
| 126 | 3300053104 | Ga0500556_0000532 | Ga0500556_0000532_12173_13738 | 472 |
| 127 | 3300054114 | Ga0501084_0006171 | Ga0501084_0006171_8136_9644 | 472 |
| 128 | iso_pu_bacteria | 2585427649 | 2586061796 | 472 |
| 129 | iso_pu_bacteria | 2643221615 | 2644090252 | 472 |
| 130 | iso_pu_bacteria | 2643221657 | 2644320097 | 472 |
| 131 | iso_pu_bacteria | 8047710418 | 8047720425 | 472 |
| 132 | 3300031456 | Ga0307513_10004469 | Ga0307513_1000446911 | 473 |
| 133 | 3300031691 | Ga0316579_10011725 | Ga0316579_100117252 | 473 |
| 134 | 3300036712 | Ga0316584_0022151 | Ga0316584_0022151_2050_3639 | 473 |
| 135 | 3300046616 | Ga0495668_0062364 | Ga0495668_0062364_99_1619 | 473 |
| 136 | 3300047315 | Ga0495581_0020951 | Ga0495581_0020951_649_2169 | 473 |
| 137 | 3300048905 | Ga0496102_0051173 | Ga0496102_0051173_1748_3271 | 473 |
| 138 | 3300048907 | Ga0496104_0003963 | Ga0496104_0003963_10317_11840 | 473 |
| 139 | 3300048908 | Ga0496105_0011879 | Ga0496105_0011879_4955_6478 | 473 |
| 140 | 3300048911 | Ga0496108_0114705 | Ga0496108_0114705_369_1961 | 473 |
| 141 | 3300048917 | Ga0496114_0008354 | Ga0496114_0008354_1956_3479 | 473 |
| 142 | iso_pu_bacteria | 2738543034 | 2739362509 | 473 |
| 143 | iso_pu_bacteria | 2818991472 | 2819745855 | 473 |
| 144 | iso_pu_bacteria | 2974315732 | 2974319439 | 473 |
| 145 | iso_pu_bacteria | 2984523437 | 2984527645 | 473 |
| 146 | iso_pu_bacteria | 8003314358 | 8003317686 | 473 |
| 147 | iso_pu_bacteria | 8054472261 | 8054475976 | 473 |
| 148 | 3300005329 | Ga0070683_100075807 | Ga0070683_1000758073 | 474 |
| 149 | 3300005471 | Ga0070698_100001126 | Ga0070698_1000011265 | 474 |
| 150 | 3300005840 | Ga0068870_10054071 | Ga0068870_100540712 | 474 |
| 151 | 3300026067 | Ga0207678_10099774 | Ga0207678_100997742 | 474 |
| 152 | 3300048905 | Ga0496102_0006754 | Ga0496102_0006754_7546_9072 | 474 |
| 153 | 3300048909 | Ga0496106_0027628 | Ga0496106_0027628_2677_4203 | 474 |
| 154 | 3300048912 | Ga0496109_0032929 | Ga0496109_0032929_2807_4333 | 474 |
| 155 | 3300048916 | Ga0496113_0063145 | Ga0496113_0063145_1219_2745 | 474 |
| 156 | 3300048917 | Ga0496114_0065841 | Ga0496114_0065841_1481_3007 | 474 |
| 157 | 3300048917 | Ga0496114_0181426 | Ga0496114_0181426_182_1711 | 474 |
| 158 | iso_pu_bacteria | 2643221576 | 2643891134 | 474 |
| 159 | iso_pu_bacteria | 2643221590 | 2643960190 | 474 |
| 160 | iso_pu_bacteria | 2808606522 | 2809590471 | 474 |
| 161 | iso_pu_bacteria | 2811994874 | 2812330364 | 474 |
| 162 | iso_pu_bacteria | 2811994878 | 2812350933 | 474 |
| 163 | 3300005335 | Ga0070666_10029643 | Ga0070666_100296433 | 475 |
| 164 | 3300005343 | Ga0070687_100019362 | Ga0070687_1000193622 | 475 |
| 165 | 3300005344 | Ga0070661_100030912 | Ga0070661_1000309121 | 475 |
| 166 | 3300005347 | Ga0070668_100071753 | Ga0070668_1000717532 | 475 |
| 167 | 3300005440 | Ga0070705_100020353 | Ga0070705_1000203532 | 475 |
| 168 | 3300005444 | Ga0070694_100113622 | Ga0070694_1001136222 | 475 |
| 169 | 3300005445 | Ga0070708_100055574 | Ga0070708_1000555742 | 475 |
| 170 | 3300005445 | Ga0070708_100143161 | Ga0070708_1001431613 | 475 |
| 171 | 3300005466 | Ga0070685_10018383 | Ga0070685_100183831 | 475 |
| 172 | 3300005518 | Ga0070699_100002453 | Ga0070699_1000024533 | 475 |
| 173 | 3300005530 | Ga0070679_100024686 | Ga0070679_1000246866 | 475 |
| 174 | 3300005536 | Ga0070697_100003236 | Ga0070697_10000323612 | 475 |
| 175 | 3300005543 | Ga0070672_100041287 | Ga0070672_1000412872 | 475 |
| 176 | 3300005577 | Ga0068857_100041684 | Ga0068857_1000416843 | 475 |
| 177 | 3300005718 | Ga0068866_10034919 | Ga0068866_100349192 | 475 |
| 178 | 3300005840 | Ga0068870_10008775 | Ga0068870_100087751 | 475 |
| 179 | 3300005841 | Ga0068863_100054372 | Ga0068863_1000543723 | 475 |
| 180 | 3300005842 | Ga0068858_100047466 | Ga0068858_1000474662 | 475 |
| 181 | 3300005983 | Ga0081540_1000528 | Ga0081540_100052811 | 475 |
| 182 | 3300006358 | Ga0068871_100095675 | Ga0068871_1000956752 | 475 |
| 183 | 3300009093 | Ga0105240_10180463 | Ga0105240_101804631 | 475 |
| 184 | 3300011119 | Ga0105246_10038778 | Ga0105246_100387783 | 475 |
| 185 | 3300012507 | Ga0157342_1001046 | Ga0157342_10010461 | 475 |
| 186 | 3300020070 | Ga0206356_11380849 | Ga0206356_113808492 | 475 |
| 187 | 3300020081 | Ga0206354_10770736 | Ga0206354_107707363 | 475 |
| 188 | 3300025885 | Ga0207653_10002294 | Ga0207653_100022946 | 475 |
| 189 | 3300025901 | Ga0207688_10014437 | Ga0207688_100144372 | 475 |
| 190 | 3300025906 | Ga0207699_10004882 | Ga0207699_100048824 | 475 |
| 191 | 3300025906 | Ga0207699_10046955 | Ga0207699_100469552 | 475 |
| 192 | 3300025908 | Ga0207643_10063681 | Ga0207643_100636812 | 475 |
| 193 | 3300025918 | Ga0207662_10012788 | Ga0207662_100127883 | 475 |
| 194 | 3300025919 | Ga0207657_10020250 | Ga0207657_100202505 | 475 |
| 195 | 3300025922 | Ga0207646_10006511 | Ga0207646_1000651110 | 475 |
| 196 | 3300025933 | Ga0207706_10027818 | Ga0207706_100278183 | 475 |
| 197 | 3300025939 | Ga0207665_10006158 | Ga0207665_1000615810 | 475 |
| 198 | 3300025940 | Ga0207691_10045389 | Ga0207691_100453892 | 475 |
| 199 | 3300026067 | Ga0207678_10010983 | Ga0207678_100109837 | 475 |
| 200 | 3300026078 | Ga0207702_10011750 | Ga0207702_100117506 | 475 |
| 201 | 3300026116 | Ga0207674_10037641 | Ga0207674_100376414 | 475 |
| 202 | 3300026118 | Ga0207675_100043257 | Ga0207675_1000432572 | 475 |
| 203 | 3300026121 | Ga0207683_10023161 | Ga0207683_100231615 | 475 |
| 204 | 3300031456 | Ga0307513_10001838 | Ga0307513_1000183827 | 475 |
| 205 | 3300031616 | Ga0307508_10019006 | Ga0307508_100190064 | 475 |
| 206 | 3300035083 | Ga0373926_0001284 | Ga0373926_0001284_5119_6645 | 475 |
| 207 | 3300035111 | Ga0373923_0014478 | Ga0373923_0014478_1303_2829 | 475 |
| 208 | 3300035117 | Ga0373953_0015437 | Ga0373953_0015437_1154_2680 | 475 |
| 209 | 3300035170 | Ga0373943_0001180 | Ga0373943_0001180_2165_3691 | 475 |
| 210 | 3300035171 | Ga0373946_0002798 | Ga0373946_0002798_4322_5848 | 475 |
| 211 | 3300035410 | Ga0373924_0000750 | Ga0373924_0000750_2372_3898 | 475 |
| 212 | 3300035692 | Ga0373935_0014178 | Ga0373935_0014178_1464_2990 | 475 |
| 213 | 3300035725 | Ga0373947_0068144 | Ga0373947_0068144_224_1750 | 475 |
| 214 | 3300037068 | Ga0373925_0032872 | Ga0373925_0032872_310_1836 | 475 |
| 215 | 3300046454 | Ga0495592_0033654 | Ga0495592_0033654_2116_3642 | 475 |
| 216 | 3300046463 | Ga0495653_0012779 | Ga0495653_0012779_3344_4870 | 475 |
| 217 | 3300046472 | Ga0495580_0011006 | Ga0495580_0011006_224_1750 | 475 |
| 218 | 3300046473 | Ga0495582_0002565 | Ga0495582_0002565_6989_8515 | 475 |
| 219 | 3300046476 | Ga0495662_0000938 | Ga0495662_0000938_4853_6379 | 475 |
| 220 | 3300046499 | Ga0495594_0023142 | Ga0495594_0023142_426_1952 | 475 |
| 221 | 3300046511 | Ga0495608_0034479 | Ga0495608_0034479_224_1750 | 475 |
| 222 | 3300046516 | Ga0495628_0039393 | Ga0495628_0039393_1782_3308 | 475 |
| 223 | 3300046516 | Ga0495628_0057808 | Ga0495628_0057808_224_1750 | 475 |
| 224 | 3300046517 | Ga0495630_0001927 | Ga0495630_0001927_6682_8208 | 475 |
| 225 | 3300046531 | Ga0495665_0001964 | Ga0495665_0001964_2691_4217 | 475 |
| 226 | 3300046533 | Ga0495640_0065988 | Ga0495640_0065988_564_2090 | 475 |
| 227 | 3300046535 | Ga0495586_0002352 | Ga0495586_0002352_2369_3895 | 475 |
| 228 | 3300046536 | Ga0495587_0023240 | Ga0495587_0023240_1147_2673 | 475 |
| 229 | 3300046543 | Ga0495645_0053901 | Ga0495645_0053901_224_1750 | 475 |
| 230 | 3300046559 | Ga0495667_0033563 | Ga0495667_0033563_1557_3083 | 475 |
| 231 | 3300046642 | Ga0495634_0011880 | Ga0495634_0011880_4578_6104 | 475 |
| 232 | 3300046663 | Ga0495635_0006403 | Ga0495635_0006403_6329_7855 | 475 |
| 233 | 3300046675 | Ga0495657_0003044 | Ga0495657_0003044_1429_2955 | 475 |
| 234 | 3300046680 | Ga0495646_0025300 | Ga0495646_0025300_224_1750 | 475 |
| 235 | 3300046690 | Ga0495624_0002326 | Ga0495624_0002326_4954_6480 | 475 |
| 236 | 3300046809 | Ga0495600_0026610 | Ga0495600_0026610_224_1750 | 475 |
| 237 | 3300047315 | Ga0495581_0000510 | Ga0495581_0000510_352_1878 | 475 |
| 238 | 3300047317 | Ga0495604_0006999 | Ga0495604_0006999_6479_8005 | 475 |
| 239 | 3300047319 | Ga0495674_0003043 | Ga0495674_0003043_12802_14328 | 475 |
| 240 | 3300047319 | Ga0495674_0102978 | Ga0495674_0102978_130_1656 | 475 |
| 241 | 3300047321 | Ga0495676_0021417 | Ga0495676_0021417_1557_3083 | 475 |
| 242 | 3300047322 | Ga0495680_0052464 | Ga0495680_0052464_224_1750 | 475 |
| 243 | 3300047444 | Ga0495675_0026882 | Ga0495675_0026882_153_1679 | 475 |
| 244 | 3300047471 | Ga0495684_0042567 | Ga0495684_0042567_352_1878 | 475 |
| 245 | 3300047673 | Ga0495593_0051201 | Ga0495593_0051201_224_1750 | 475 |
| 246 | 3300048088 | Ga0495602_0072763 | Ga0495602_0072763_1283_2809 | 475 |
| 247 | 3300048088 | Ga0495602_0114340 | Ga0495602_0114340_224_1750 | 475 |
| 248 | 3300048904 | Ga0496101_0031887 | Ga0496101_0031887_858_2384 | 475 |
| 249 | 3300048904 | Ga0496101_0080995 | Ga0496101_0080995_288_1826 | 475 |
| 250 | 3300048907 | Ga0496104_0024032 | Ga0496104_0024032_2798_4324 | 475 |
| 251 | 3300048907 | Ga0496104_0198845 | Ga0496104_0198845_262_1800 | 475 |
| 252 | 3300048908 | Ga0496105_0102504 | Ga0496105_0102504_432_1958 | 475 |
| 253 | 3300048911 | Ga0496108_0051720 | Ga0496108_0051720_1799_3325 | 475 |
| 254 | 3300048914 | Ga0496111_0021375 | Ga0496111_0021375_1798_3324 | 475 |
| 255 | 3300048916 | Ga0496113_0111440 | Ga0496113_0111440_190_1716 | 475 |
| 256 | 3300048917 | Ga0496114_0048288 | Ga0496114_0048288_1385_2923 | 475 |
| 257 | 3300048918 | Ga0496115_0030072 | Ga0496115_0030072_1997_3535 | 475 |
| 258 | 3300049575 | Ga0501039_0061030 | Ga0501039_0061030_1383_2906 | 475 |
| 259 | 3300053078 | Ga0495612_0026850 | Ga0495612_0026850_564_2090 | 475 |
| 260 | 3300053085 | Ga0495619_0099843 | Ga0495619_0099843_426_1952 | 475 |
| 261 | iso_pu_bacteria | 2824679649 | 2824682654 | 475 |
| 262 | iso_pu_bacteria | 2857481737 | 2857485266 | 475 |
| 263 | iso_pu_bacteria | 2891968417 | 2891971477 | 475 |
| 264 | iso_pu_bacteria | 2915768154 | 2915770696 | 475 |
| 265 | iso_pu_bacteria | 2917736166 | 2917739937 | 475 |
| 266 | iso_pu_bacteria | 2922393267 | 2922396334 | 475 |
| 267 | iso_pu_bacteria | 2932801729 | 2932806705 | 475 |
| 268 | iso_pu_bacteria | 2941531003 | 2941535615 | 475 |
| 269 | iso_pu_bacteria | 8006926726 | 8006928545 | 475 |
| 270 | 3300005347 | Ga0070668_100000425 | Ga0070668_10000042526 | 476 |
| 271 | 3300005844 | Ga0068862_100027619 | Ga0068862_1000276194 | 476 |
| 272 | 3300006042 | Ga0075368_10004625 | Ga0075368_100046255 | 476 |
| 273 | 3300013308 | Ga0157375_10106674 | Ga0157375_101066742 | 476 |
| 274 | 3300025928 | Ga0207700_10013193 | Ga0207700_100131933 | 476 |
| 275 | 3300025972 | Ga0207668_10001956 | Ga0207668_100019566 | 476 |
| 276 | 3300028794 | Ga0307515_10046075 | Ga0307515_100460754 | 476 |
| 277 | 3300031507 | Ga0307509_10047050 | Ga0307509_100470502 | 476 |
| 278 | 3300031838 | Ga0307518_10002915 | Ga0307518_100029153 | 476 |
| 279 | 3300035113 | Ga0373936_0011727 | Ga0373936_0011727_494_2023 | 476 |
| 280 | 3300035172 | Ga0373955_0005820 | Ga0373955_0005820_1410_2939 | 476 |
| 281 | 3300035172 | Ga0373955_0050635 | Ga0373955_0050635_63_1592 | 476 |
| 282 | 3300035724 | Ga0373933_0015835 | Ga0373933_0015835_440_1969 | 476 |
| 283 | 3300037466 | Ga0395898_0074973 | Ga0395898_0074973_170_1699 | 476 |
| 284 | 3300046559 | Ga0495667_0004058 | Ga0495667_0004058_5630_7159 | 476 |
| 285 | 3300046663 | Ga0495635_0012165 | Ga0495635_0012165_62_1591 | 476 |
| 286 | 3300046675 | Ga0495657_0009809 | Ga0495657_0009809_197_1726 | 476 |
| 287 | 3300047320 | Ga0495672_0006713 | Ga0495672_0006713_1725_3254 | 476 |
| 288 | 3300047322 | Ga0495680_0051412 | Ga0495680_0051412_1501_3030 | 476 |
| 289 | 3300048088 | Ga0495602_0110417 | Ga0495602_0110417_315_1844 | 476 |
| 290 | 3300048926 | Ga0496123_0010794 | Ga0496123_0010794_3025_4554 | 476 |
| 291 | 3300050492 | nmdc:mga0yw44_15782_c1 | nmdc:mga0yw44_15782_c1_1876_3405 | 476 |
| 292 | 3300053096 | Ga0500641_0020714 | Ga0500641_0020714_219_1748 | 476 |
| 293 | iso_pu_bacteria | 2643221604 | 2644035139 | 476 |
| 294 | iso_pu_bacteria | 2773857762 | 2774393064 | 476 |
| 295 | iso_pu_bacteria | 2818991318 | 2819426109 | 476 |
| 296 | iso_pu_bacteria | 2818991463 | 2819696995 | 476 |
| 297 | iso_pu_bacteria | 2966598605 | 2966605567 | 476 |
| 298 | iso_pu_bacteria | 3006493962 | 3006497949 | 476 |
| 299 | 3300005355 | Ga0070671_100013148 | Ga0070671_1000131484 | 477 |
| 300 | 3300005365 | Ga0070688_100064672 | Ga0070688_1000646722 | 477 |
| 301 | 3300005439 | Ga0070711_100029686 | Ga0070711_1000296862 | 477 |
| 302 | 3300005445 | Ga0070708_100072383 | Ga0070708_1000723833 | 477 |
| 303 | 3300005467 | Ga0070706_100150348 | Ga0070706_1001503482 | 477 |
| 304 | 3300005468 | Ga0070707_100011160 | Ga0070707_1000111604 | 477 |
| 305 | 3300005468 | Ga0070707_100080783 | Ga0070707_1000807832 | 477 |
| 306 | 3300005471 | Ga0070698_100005767 | Ga0070698_1000057677 | 477 |
| 307 | 3300005548 | Ga0070665_100004605 | Ga0070665_10000460517 | 477 |
| 308 | 3300005937 | Ga0081455_10000724 | Ga0081455_1000072414 | 477 |
| 309 | 3300006038 | Ga0075365_10009286 | Ga0075365_100092863 | 477 |
| 310 | 3300006048 | Ga0075363_100035372 | Ga0075363_1000353721 | 477 |
| 311 | 3300006178 | Ga0075367_10064425 | Ga0075367_100644252 | 477 |
| 312 | 3300025908 | Ga0207643_10054170 | Ga0207643_100541702 | 477 |
| 313 | 3300025915 | Ga0207693_10016153 | Ga0207693_100161534 | 477 |
| 314 | 3300025931 | Ga0207644_10014395 | Ga0207644_100143954 | 477 |
| 315 | 3300025939 | Ga0207665_10002187 | Ga0207665_100021877 | 477 |
| 316 | 3300028379 | Ga0268266_10029429 | Ga0268266_100294291 | 477 |
| 317 | 3300028556 | Ga0265337_1003142 | Ga0265337_10031427 | 477 |
| 318 | 3300028666 | Ga0265336_10003485 | Ga0265336_100034856 | 477 |
| 319 | 3300031238 | Ga0265332_10014040 | Ga0265332_100140404 | 477 |
| 320 | 3300033179 | Ga0307507_10004675 | Ga0307507_100046756 | 477 |
| 321 | 3300035117 | Ga0373953_0031235 | Ga0373953_0031235_402_1934 | 477 |
| 322 | 3300035119 | Ga0373956_0009086 | Ga0373956_0009086_2466_3998 | 477 |
| 323 | 3300035410 | Ga0373924_0021296 | Ga0373924_0021296_214_1746 | 477 |
| 324 | 3300035692 | Ga0373935_0021142 | Ga0373935_0021142_1486_3018 | 477 |
| 325 | 3300035724 | Ga0373933_0020652 | Ga0373933_0020652_1013_2545 | 477 |
| 326 | 3300037853 | Ga0436364_0764299 | Ga0436364_0764299_524_2056 | 477 |
| 327 | 3300044658 | Ga0466972_0001395 | Ga0466972_0001395_3361_4914 | 477 |
| 328 | 3300044658 | Ga0466972_0033019 | Ga0466972_0033019_883_2442 | 477 |
| 329 | 3300044901 | Ga0466960_0012342 | Ga0466960_0012342_101_1654 | 477 |
| 330 | 3300046462 | Ga0495651_0032332 | Ga0495651_0032332_1167_2699 | 477 |
| 331 | 3300046511 | Ga0495608_0055321 | Ga0495608_0055321_111_1643 | 477 |
| 332 | 3300046514 | Ga0495618_0011128 | Ga0495618_0011128_1406_2938 | 477 |
| 333 | 3300046529 | Ga0495652_0042844 | Ga0495652_0042844_1676_3208 | 477 |
| 334 | 3300046533 | Ga0495640_0009996 | Ga0495640_0009996_2637_4169 | 477 |
| 335 | 3300046663 | Ga0495635_0028428 | Ga0495635_0028428_692_2224 | 477 |
| 336 | 3300046675 | Ga0495657_0015303 | Ga0495657_0015303_1086_2618 | 477 |
| 337 | 3300046680 | Ga0495646_0029906 | Ga0495646_0029906_1535_3067 | 477 |
| 338 | 3300046809 | Ga0495600_0019097 | Ga0495600_0019097_2655_4187 | 477 |
| 339 | 3300047471 | Ga0495684_0013394 | Ga0495684_0013394_3992_5524 | 477 |
| 340 | 3300048088 | Ga0495602_0045787 | Ga0495602_0045787_899_2431 | 477 |
| 341 | 3300048929 | Ga0496126_0000588 | Ga0496126_0000588_10086_11621 | 477 |
| 342 | 3300050492 | nmdc:mga0yw44_11116_c1 | nmdc:mga0yw44_11116_c1_1362_2894 | 477 |
| 343 | 3300053077 | Ga0495601_0043059 | Ga0495601_0043059_841_2373 | 477 |
| 344 | iso_pu_bacteria | 2738541305 | 2738868914 | 477 |
| 345 | iso_pu_bacteria | 2984576629 | 2984580520 | 477 |
| 346 | iso_pu_bacteria | 2990256926 | 2990258212 | 477 |
| 347 | 3300002067 | JGI24735J21928_10006642 | JGI24735J21928_100066422 | 478 |
| 348 | 3300005367 | Ga0070667_100041269 | Ga0070667_1000412692 | 478 |
| 349 | 3300005467 | Ga0070706_100033486 | Ga0070706_1000334864 | 478 |
| 350 | 3300005471 | Ga0070698_100004906 | Ga0070698_10000490614 | 478 |
| 351 | 3300025304 | Ga0209257_1006194 | Ga0209257_10061944 | 478 |
| 352 | 3300025986 | Ga0207658_10032959 | Ga0207658_100329592 | 478 |
| 353 | 3300026116 | Ga0207674_10052862 | Ga0207674_100528622 | 478 |
| 354 | 3300028794 | Ga0307515_10036149 | Ga0307515_100361498 | 478 |
| 355 | 3300028800 | Ga0265338_10004224 | Ga0265338_1000422411 | 478 |
| 356 | 3300029957 | Ga0265324_10002929 | Ga0265324_100029292 | 478 |
| 357 | 3300030522 | Ga0307512_10008020 | Ga0307512_100080208 | 478 |
| 358 | 3300031240 | Ga0265320_10023782 | Ga0265320_100237822 | 478 |
| 359 | 3300031241 | Ga0265325_10079709 | Ga0265325_100797091 | 478 |
| 360 | 3300031595 | Ga0265313_10020736 | Ga0265313_100207364 | 478 |
| 361 | 3300031712 | Ga0265342_10013750 | Ga0265342_100137505 | 478 |
| 362 | 3300035120 | Ga0373957_0014511 | Ga0373957_0014511_1090_2637 | 478 |
| 363 | 3300037068 | Ga0373925_0082139 | Ga0373925_0082139_23_1570 | 478 |
| 364 | 3300037068 | Ga0373925_0142407 | Ga0373925_0142407_165_1721 | 478 |
| 365 | 3300046463 | Ga0495653_0008312 | Ga0495653_0008312_2344_3891 | 478 |
| 366 | 3300046511 | Ga0495608_0002908 | Ga0495608_0002908_3043_4590 | 478 |
| 367 | 3300046529 | Ga0495652_0005862 | Ga0495652_0005862_4954_6501 | 478 |
| 368 | 3300046536 | Ga0495587_0030726 | Ga0495587_0030726_776_2323 | 478 |
| 369 | 3300046678 | Ga0495599_0021657 | Ga0495599_0021657_2422_3969 | 478 |
| 370 | 3300046679 | Ga0495623_0008957 | Ga0495623_0008957_3997_5544 | 478 |
| 371 | 3300046809 | Ga0495600_0036267 | Ga0495600_0036267_38_1609 | 478 |
| 372 | 3300047317 | Ga0495604_0000884 | Ga0495604_0000884_18248_19795 | 478 |
| 373 | 3300047319 | Ga0495674_0012615 | Ga0495674_0012615_592_2139 | 478 |
| 374 | 3300047322 | Ga0495680_0008897 | Ga0495680_0008897_4975_6522 | 478 |
| 375 | 3300047444 | Ga0495675_0023179 | Ga0495675_0023179_192_1739 | 478 |
| 376 | 3300047471 | Ga0495684_0039063 | Ga0495684_0039063_1046_2617 | 478 |
| 377 | 3300048917 | Ga0496114_0110278 | Ga0496114_0110278_188_1771 | 478 |
| 378 | 3300048924 | Ga0496121_0016612 | Ga0496121_0016612_4761_6320 | 478 |
| 379 | 3300049572 | Ga0501036_0005090 | Ga0501036_0005090_2371_3927 | 478 |
| 380 | iso_pu_bacteria | 2643221617 | 2644101288 | 478 |
| 381 | iso_pu_bacteria | 2643221620 | 2644119306 | 478 |
| 382 | iso_pu_bacteria | 2643221683 | 2644464723 | 478 |
| 383 | iso_pu_bacteria | 2873151551 | 2873158729 | 478 |
| 384 | iso_pu_bacteria | 2904765812 | 2904767144 | 478 |
| 385 | iso_pu_bacteria | 2904770941 | 2904773896 | 478 |
| 386 | iso_pu_bacteria | 2908811453 | 2908814782 | 478 |
| 387 | iso_pu_bacteria | 2919420072 | 2919420417 | 478 |
| 388 | iso_pu_bacteria | 2919432681 | 2919433825 | 478 |
| 389 | iso_pu_bacteria | 3006321560 | 3006322908 | 478 |
| 390 | 3300003659 | JGI25404J52841_10000235 | JGI25404J52841_100002356 | 479 |
| 391 | 3300003791 | Ga0055530_10000093 | Ga0055530_1000009321 | 479 |
| 392 | 3300003791 | Ga0055530_10000104 | Ga0055530_1000010427 | 479 |
| 393 | 3300003794 | Ga0055531_10000432 | Ga0055531_1000043235 | 479 |
| 394 | 3300003794 | Ga0055531_10002055 | Ga0055531_1000205512 | 479 |
| 395 | 3300005329 | Ga0070683_100002702 | Ga0070683_1000027022 | 479 |
| 396 | 3300005329 | Ga0070683_100010116 | Ga0070683_1000101169 | 479 |
| 397 | 3300005334 | Ga0068869_100077878 | Ga0068869_1000778782 | 479 |
| 398 | 3300005338 | Ga0068868_100037250 | Ga0068868_1000372504 | 479 |
| 399 | 3300005355 | Ga0070671_100050494 | Ga0070671_1000504942 | 479 |
| 400 | 3300005445 | Ga0070708_100016030 | Ga0070708_1000160305 | 479 |
| 401 | 3300005468 | Ga0070707_100015242 | Ga0070707_1000152428 | 479 |
| 402 | 3300005518 | Ga0070699_100011087 | Ga0070699_1000110876 | 479 |
| 403 | 3300005535 | Ga0070684_100003428 | Ga0070684_1000034287 | 479 |
| 404 | 3300005564 | Ga0070664_100001201 | Ga0070664_10000120118 | 479 |
| 405 | 3300005841 | Ga0068863_100069141 | Ga0068863_1000691412 | 479 |
| 406 | 3300006358 | Ga0068871_100020061 | Ga0068871_1000200614 | 479 |
| 407 | 3300009094 | Ga0111539_10000515 | Ga0111539_1000051544 | 479 |
| 408 | 3300009098 | Ga0105245_10020906 | Ga0105245_100209063 | 479 |
| 409 | 3300010375 | Ga0105239_10258978 | Ga0105239_102589782 | 479 |
| 410 | 3300013296 | Ga0157374_10073628 | Ga0157374_100736281 | 479 |
| 411 | 3300013308 | Ga0157375_10033927 | Ga0157375_100339275 | 479 |
| 412 | 3300013308 | Ga0157375_10138891 | Ga0157375_101388912 | 479 |
| 413 | 3300014745 | Ga0157377_10011005 | Ga0157377_100110051 | 479 |
| 414 | 3300014968 | Ga0157379_10018288 | Ga0157379_100182887 | 479 |
| 415 | 3300014969 | Ga0157376_10103403 | Ga0157376_101034033 | 479 |
| 416 | 3300021320 | Ga0214544_1000056 | Ga0214544_1000056115 | 479 |
| 417 | 3300025291 | Ga0209675_1000132 | Ga0209675_100013266 | 479 |
| 418 | 3300025292 | Ga0209676_1000085 | Ga0209676_100008528 | 479 |
| 419 | 3300025292 | Ga0209676_1000118 | Ga0209676_100011810 | 479 |
| 420 | 3300025298 | Ga0209050_1000115 | Ga0209050_1000115112 | 479 |
| 421 | 3300025304 | Ga0209257_1000160 | Ga0209257_100016086 | 479 |
| 422 | 3300025304 | Ga0209257_1000482 | Ga0209257_100048228 | 479 |
| 423 | 3300025898 | Ga0207692_10020664 | Ga0207692_100206642 | 479 |
| 424 | 3300025901 | Ga0207688_10080432 | Ga0207688_100804322 | 479 |
| 425 | 3300025922 | Ga0207646_10005267 | Ga0207646_100052674 | 479 |
| 426 | 3300025926 | Ga0207659_10027441 | Ga0207659_100274413 | 479 |
| 427 | 3300025933 | Ga0207706_10035702 | Ga0207706_100357023 | 479 |
| 428 | 3300025939 | Ga0207665_10111621 | Ga0207665_101116212 | 479 |
| 429 | 3300025942 | Ga0207689_10025359 | Ga0207689_100253594 | 479 |
| 430 | 3300026023 | Ga0207677_10042210 | Ga0207677_100422103 | 479 |
| 431 | 3300026067 | Ga0207678_10052876 | Ga0207678_100528763 | 479 |
| 432 | 3300026075 | Ga0207708_10021659 | Ga0207708_100216592 | 479 |
| 433 | 3300026116 | Ga0207674_10034983 | Ga0207674_100349835 | 479 |
| 434 | 3300026116 | Ga0207674_10035385 | Ga0207674_100353853 | 479 |
| 435 | 3300027907 | Ga0207428_10053149 | Ga0207428_100531492 | 479 |
| 436 | 3300028380 | Ga0268265_10101647 | Ga0268265_101016471 | 479 |
| 437 | 3300031995 | Ga0307409_100011709 | Ga0307409_1000117092 | 479 |
| 438 | 3300032126 | Ga0307415_100161534 | Ga0307415_1001615342 | 479 |
| 439 | 3300035117 | Ga0373953_0022533 | Ga0373953_0022533_596_2122 | 479 |
| 440 | 3300035725 | Ga0373947_0015165 | Ga0373947_0015165_2685_4211 | 479 |
| 441 | 3300046454 | Ga0495592_0003588 | Ga0495592_0003588_2943_4469 | 479 |
| 442 | 3300046455 | Ga0495603_0004389 | Ga0495603_0004389_607_2172 | 479 |
| 443 | 3300046462 | Ga0495651_0000950 | Ga0495651_0000950_4680_6206 | 479 |
| 444 | 3300046514 | Ga0495618_0012264 | Ga0495618_0012264_1854_3380 | 479 |
| 445 | 3300046526 | Ga0495666_0061266 | Ga0495666_0061266_150_1676 | 479 |
| 446 | 3300046529 | Ga0495652_0008046 | Ga0495652_0008046_7648_9174 | 479 |
| 447 | 3300046536 | Ga0495587_0000345 | Ga0495587_0000345_27075_28601 | 479 |
| 448 | 3300046660 | Ga0495625_0000373 | Ga0495625_0000373_20084_21622 | 479 |
| 449 | 3300046674 | Ga0495588_0008813 | Ga0495588_0008813_2243_3781 | 479 |
| 450 | 3300046678 | Ga0495599_0010916 | Ga0495599_0010916_1622_3148 | 479 |
| 451 | 3300046679 | Ga0495623_0026268 | Ga0495623_0026268_1222_2748 | 479 |
| 452 | 3300047321 | Ga0495676_0002502 | Ga0495676_0002502_410_1975 | 479 |
| 453 | 3300047471 | Ga0495684_0007992 | Ga0495684_0007992_4536_6062 | 479 |
| 454 | 3300048088 | Ga0495602_0009207 | Ga0495602_0009207_1110_2636 | 479 |
| 455 | 3300048907 | Ga0496104_0008437 | Ga0496104_0008437_6713_8239 | 479 |
| 456 | 3300048913 | Ga0496110_0004537 | Ga0496110_0004537_7188_8714 | 479 |
| 457 | 3300048914 | Ga0496111_0013741 | Ga0496111_0013741_2935_4461 | 479 |
| 458 | 3300048915 | Ga0496112_0035818 | Ga0496112_0035818_2864_4390 | 479 |
| 459 | 3300050511 | nmdc:mga08y16_55524_c1 | nmdc:mga08y16_55524_c1_1137_2663 | 479 |
| 460 | 3300053084 | Ga0495595_0019955 | Ga0495595_0019955_1256_2782 | 479 |
| 461 | 3300053094 | Ga0500566_0006585 | Ga0500566_0006585_468_2006 | 479 |
| 462 | iso_pu_bacteria | 2808606439 | 2809196908 | 479 |
| 463 | 3300003373 | JGI25407J50210_10003955 | JGI25407J50210_100039552 | 480 |
| 464 | 3300005329 | Ga0070683_100032144 | Ga0070683_1000321443 | 480 |
| 465 | 3300005334 | Ga0068869_100071657 | Ga0068869_1000716572 | 480 |
| 466 | 3300005335 | Ga0070666_10014340 | Ga0070666_100143402 | 480 |
| 467 | 3300005337 | Ga0070682_100067088 | Ga0070682_1000670882 | 480 |
| 468 | 3300005364 | Ga0070673_100047366 | Ga0070673_1000473663 | 480 |
| 469 | 3300005367 | Ga0070667_100233722 | Ga0070667_1002337221 | 480 |
| 470 | 3300005406 | Ga0070703_10010202 | Ga0070703_100102022 | 480 |
| 471 | 3300005434 | Ga0070709_10021541 | Ga0070709_100215414 | 480 |
| 472 | 3300005435 | Ga0070714_100021486 | Ga0070714_1000214863 | 480 |
| 473 | 3300005436 | Ga0070713_100057549 | Ga0070713_1000575492 | 480 |
| 474 | 3300005437 | Ga0070710_10007207 | Ga0070710_100072073 | 480 |
| 475 | 3300005439 | Ga0070711_100003971 | Ga0070711_1000039718 | 480 |
| 476 | 3300005439 | Ga0070711_100076887 | Ga0070711_1000768872 | 480 |
| 477 | 3300005444 | Ga0070694_100009061 | Ga0070694_1000090614 | 480 |
| 478 | 3300005456 | Ga0070678_100039449 | Ga0070678_1000394493 | 480 |
| 479 | 3300005457 | Ga0070662_100020261 | Ga0070662_1000202613 | 480 |
| 480 | 3300005467 | Ga0070706_100001943 | Ga0070706_10000194319 | 480 |
| 481 | 3300005530 | Ga0070679_100048194 | Ga0070679_1000481944 | 480 |
| 482 | 3300005546 | Ga0070696_100017808 | Ga0070696_1000178082 | 480 |
| 483 | 3300005577 | Ga0068857_100127933 | Ga0068857_1001279332 | 480 |
| 484 | 3300005618 | Ga0068864_100143672 | Ga0068864_1001436722 | 480 |
| 485 | 3300005718 | Ga0068866_10057655 | Ga0068866_100576552 | 480 |
| 486 | 3300005840 | Ga0068870_10097947 | Ga0068870_100979471 | 480 |
| 487 | 3300005842 | Ga0068858_100032909 | Ga0068858_1000329092 | 480 |
| 488 | 3300005981 | Ga0081538_10004167 | Ga0081538_100041677 | 480 |
| 489 | 3300005985 | Ga0081539_10007595 | Ga0081539_100075954 | 480 |
| 490 | 3300006028 | Ga0070717_10039004 | Ga0070717_100390042 | 480 |
| 491 | 3300006163 | Ga0070715_10020379 | Ga0070715_100203792 | 480 |
| 492 | 3300006163 | Ga0070715_10047190 | Ga0070715_100471902 | 480 |
| 493 | 3300006175 | Ga0070712_100005558 | Ga0070712_1000055582 | 480 |
| 494 | 3300006175 | Ga0070712_100006558 | Ga0070712_1000065584 | 480 |
| 495 | 3300006175 | Ga0070712_100010785 | Ga0070712_1000107855 | 480 |
| 496 | 3300006852 | Ga0075433_10053485 | Ga0075433_100534854 | 480 |
| 497 | 3300007076 | Ga0075435_100026319 | Ga0075435_1000263192 | 480 |
| 498 | 3300009101 | Ga0105247_10011549 | Ga0105247_100115493 | 480 |
| 499 | 3300009176 | Ga0105242_10051819 | Ga0105242_100518192 | 480 |
| 500 | 3300009545 | Ga0105237_10069511 | Ga0105237_100695112 | 480 |
| 501 | 3300009551 | Ga0105238_10103866 | Ga0105238_101038662 | 480 |
| 502 | 3300009553 | Ga0105249_10022755 | Ga0105249_100227554 | 480 |
| 503 | 3300011119 | Ga0105246_10004077 | Ga0105246_100040775 | 480 |
| 504 | 3300013104 | Ga0157370_10029089 | Ga0157370_100290893 | 480 |
| 505 | 3300013105 | Ga0157369_10071413 | Ga0157369_100714133 | 480 |
| 506 | 3300013297 | Ga0157378_10154159 | Ga0157378_101541592 | 480 |
| 507 | 3300014326 | Ga0157380_10047068 | Ga0157380_100470684 | 480 |
| 508 | 3300014968 | Ga0157379_10048224 | Ga0157379_100482241 | 480 |
| 509 | 3300014969 | Ga0157376_10020114 | Ga0157376_100201142 | 480 |
| 510 | 3300017792 | Ga0163161_10023742 | Ga0163161_100237423 | 480 |
| 511 | 3300025885 | Ga0207653_10015836 | Ga0207653_100158362 | 480 |
| 512 | 3300025898 | Ga0207692_10006037 | Ga0207692_100060374 | 480 |
| 513 | 3300025898 | Ga0207692_10008808 | Ga0207692_100088082 | 480 |
| 514 | 3300025901 | Ga0207688_10012849 | Ga0207688_100128494 | 480 |
| 515 | 3300025903 | Ga0207680_10029174 | Ga0207680_100291743 | 480 |
| 516 | 3300025906 | Ga0207699_10006490 | Ga0207699_100064902 | 480 |
| 517 | 3300025910 | Ga0207684_10002895 | Ga0207684_100028954 | 480 |
| 518 | 3300025910 | Ga0207684_10096748 | Ga0207684_100967482 | 480 |
| 519 | 3300025915 | Ga0207693_10001394 | Ga0207693_100013947 | 480 |
| 520 | 3300025915 | Ga0207693_10003334 | Ga0207693_100033345 | 480 |
| 521 | 3300025915 | Ga0207693_10008049 | Ga0207693_100080493 | 480 |
| 522 | 3300025915 | Ga0207693_10021512 | Ga0207693_100215123 | 480 |
| 523 | 3300025916 | Ga0207663_10002702 | Ga0207663_100027023 | 480 |
| 524 | 3300025918 | Ga0207662_10024763 | Ga0207662_100247632 | 480 |
| 525 | 3300025919 | Ga0207657_10006877 | Ga0207657_1000687712 | 480 |
| 526 | 3300025921 | Ga0207652_10005615 | Ga0207652_100056154 | 480 |
| 527 | 3300025928 | Ga0207700_10017788 | Ga0207700_100177883 | 480 |
| 528 | 3300025928 | Ga0207700_10067357 | Ga0207700_100673572 | 480 |
| 529 | 3300025929 | Ga0207664_10010087 | Ga0207664_100100873 | 480 |
| 530 | 3300025929 | Ga0207664_10032123 | Ga0207664_100321234 | 480 |
| 531 | 3300025933 | Ga0207706_10017955 | Ga0207706_100179554 | 480 |
| 532 | 3300025935 | Ga0207709_10082687 | Ga0207709_100826872 | 480 |
| 533 | 3300025936 | Ga0207670_10015775 | Ga0207670_100157753 | 480 |
| 534 | 3300025939 | Ga0207665_10001604 | Ga0207665_100016049 | 480 |
| 535 | 3300025939 | Ga0207665_10011024 | Ga0207665_100110245 | 480 |
| 536 | 3300025939 | Ga0207665_10067307 | Ga0207665_100673072 | 480 |
| 537 | 3300025941 | Ga0207711_10034870 | Ga0207711_100348703 | 480 |
| 538 | 3300025942 | Ga0207689_10088384 | Ga0207689_100883842 | 480 |
| 539 | 3300025944 | Ga0207661_10085376 | Ga0207661_100853762 | 480 |
| 540 | 3300025960 | Ga0207651_10036222 | Ga0207651_100362221 | 480 |
| 541 | 3300026041 | Ga0207639_10122657 | Ga0207639_101226572 | 480 |
| 542 | 3300026067 | Ga0207678_10011222 | Ga0207678_100112224 | 480 |
| 543 | 3300026067 | Ga0207678_10055042 | Ga0207678_100550423 | 480 |
| 544 | 3300026095 | Ga0207676_10189753 | Ga0207676_101897532 | 480 |
| 545 | 3300026118 | Ga0207675_100032639 | Ga0207675_1000326393 | 480 |
| 546 | 3300026121 | Ga0207683_10052256 | Ga0207683_100522564 | 480 |
| 547 | 3300026121 | Ga0207683_10090274 | Ga0207683_100902742 | 480 |
| 548 | 3300028794 | Ga0307515_10103950 | Ga0307515_101039502 | 480 |
| 549 | 3300030522 | Ga0307512_10007181 | Ga0307512_100071814 | 480 |
| 550 | 3300031240 | Ga0265320_10000584 | Ga0265320_1000058412 | 480 |
| 551 | 3300035121 | Ga0373960_0013726 | Ga0373960_0013726_44_1573 | 480 |
| 552 | 3300037466 | Ga0395898_0002459 | Ga0395898_0002459_10644_12194 | 480 |
| 553 | 3300037466 | Ga0395898_0058182 | Ga0395898_0058182_505_2067 | 480 |
| 554 | 3300037853 | Ga0436364_1261928 | Ga0436364_1261928_1805_3349 | 480 |
| 555 | 3300041491 | Ga0451833_1162688 | Ga0451833_1162688_170_1699 | 480 |
| 556 | 3300041512 | Ga0451853_0323525 | Ga0451853_0323525_4201_5754 | 480 |
| 557 | 3300042004 | Ga0439445_0004315 | Ga0439445_0004315_289_1830 | 480 |
| 558 | 3300042115 | Ga0450911_000124 | Ga0450911_000124_2007_3548 | 480 |
| 559 | 3300047319 | Ga0495674_0040366 | Ga0495674_0040366_853_2430 | 480 |
| 560 | 3300048905 | Ga0496102_0032587 | Ga0496102_0032587_1589_3118 | 480 |
| 561 | 3300048907 | Ga0496104_0001473 | Ga0496104_0001473_1620_3170 | 480 |
| 562 | 3300048907 | Ga0496104_0241722 | Ga0496104_0241722_67_1617 | 480 |
| 563 | 3300048908 | Ga0496105_0014155 | Ga0496105_0014155_4031_5581 | 480 |
| 564 | 3300048910 | Ga0496107_0083010 | Ga0496107_0083010_103_1632 | 480 |
| 565 | 3300048911 | Ga0496108_0017998 | Ga0496108_0017998_2960_4510 | 480 |
| 566 | 3300048911 | Ga0496108_0039650 | Ga0496108_0039650_89_1651 | 480 |
| 567 | 3300048912 | Ga0496109_0011608 | Ga0496109_0011608_1808_3337 | 480 |
| 568 | 3300048912 | Ga0496109_0045004 | Ga0496109_0045004_1279_2829 | 480 |
| 569 | 3300048913 | Ga0496110_0066517 | Ga0496110_0066517_1378_2907 | 480 |
| 570 | 3300048914 | Ga0496111_0017504 | Ga0496111_0017504_827_2356 | 480 |
| 571 | 3300048915 | Ga0496112_0018227 | Ga0496112_0018227_3764_5314 | 480 |
| 572 | 3300048915 | Ga0496112_0208399 | Ga0496112_0208399_68_1597 | 480 |
| 573 | 3300048918 | Ga0496115_0012725 | Ga0496115_0012725_3917_5446 | 480 |
| 574 | 3300048928 | Ga0496125_0004511 | Ga0496125_0004511_12084_13625 | 480 |
| 575 | 3300048929 | Ga0496126_0088657 | Ga0496126_0088657_640_2181 | 480 |
| 576 | 3300049583 | Ga0501067_0016723 | Ga0501067_0016723_2160_3701 | 480 |
| 577 | 3300050513 | nmdc:mga0rr50_109703_c1 | nmdc:mga0rr50_109703_c1_157_1686 | 480 |
| 578 | 3300050515 | nmdc:mga0a205_86348_c1 | nmdc:mga0a205_86348_c1_414_1943 | 480 |
| 579 | 3300053158 | Ga0500627_0000001 | Ga0500627_0000001_185588_187144 | 480 |
| 580 | 3300005548 | Ga0070665_100000596 | Ga0070665_10000059612 | 481 |
| 581 | 3300005577 | Ga0068857_100042508 | Ga0068857_1000425084 | 481 |
| 582 | 3300009098 | Ga0105245_10072319 | Ga0105245_100723192 | 481 |
| 583 | 3300013307 | Ga0157372_10196199 | Ga0157372_101961992 | 481 |
| 584 | 3300025904 | Ga0207647_10030334 | Ga0207647_100303343 | 481 |
| 585 | 3300026116 | Ga0207674_10056821 | Ga0207674_100568213 | 481 |
| 586 | 3300028379 | Ga0268266_10005453 | Ga0268266_100054533 | 481 |
| 587 | 3300028794 | Ga0307515_10000456 | Ga0307515_1000045659 | 481 |
| 588 | 3300031995 | Ga0307409_100105678 | Ga0307409_1001056781 | 481 |
| 589 | 3300037068 | Ga0373925_0000177 | Ga0373925_0000177_11706_13313 | 481 |
| 590 | 3300039437 | Ga0436365_1238059 | Ga0436365_1238059_152_1705 | 481 |
| 591 | 3300048905 | Ga0496102_0116117 | Ga0496102_0116117_311_1855 | 481 |
| 592 | 3300048907 | Ga0496104_0003060 | Ga0496104_0003060_7540_9195 | 481 |
| 593 | 3300048908 | Ga0496105_0002023 | Ga0496105_0002023_1215_2870 | 481 |
| 594 | 3300048911 | Ga0496108_0010632 | Ga0496108_0010632_1794_3449 | 481 |
| 595 | 3300048912 | Ga0496109_0031161 | Ga0496109_0031161_2356_4011 | 481 |
| 596 | 3300048913 | Ga0496110_0001000 | Ga0496110_0001000_9772_11427 | 481 |
| 597 | 3300048916 | Ga0496113_0028398 | Ga0496113_0028398_536_2191 | 481 |
| 598 | 3300048917 | Ga0496114_0027090 | Ga0496114_0027090_72_1616 | 481 |
| 599 | 3300048929 | Ga0496126_0020830 | Ga0496126_0020830_4175_5740 | 481 |
| 600 | 3300049571 | Ga0501034_0020094 | Ga0501034_0020094_3009_4640 | 481 |
| 601 | 3300049574 | Ga0501038_0038142 | Ga0501038_0038142_1311_2942 | 481 |
| 602 | 3300049581 | Ga0501047_0012506 | Ga0501047_0012506_6349_7980 | 481 |
| 603 | iso_pu_bacteria | 2808606401 | 2809063805 | 481 |
| 604 | iso_pu_bacteria | 2808606404 | 2809079773 | 481 |
| 605 | iso_pu_bacteria | 2808606405 | 2809084138 | 481 |
| 606 | iso_pu_bacteria | 2880518877 | 2880523510 | 481 |
| 607 | 3300006051 | Ga0075364_10006473 | Ga0075364_100064733 | 482 |
| 608 | 3300033180 | Ga0307510_10025725 | Ga0307510_100257252 | 482 |
| 609 | 3300042876 | Ga0451577_0083155 | Ga0451577_0083155_380_1933 | 482 |
| 610 | 3300049580 | Ga0501046_0035807 | Ga0501046_0035807_1738_3297 | 482 |
| 611 | 3300050491 | nmdc:mga00v17_3991_c1 | nmdc:mga00v17_3991_c1_1957_3516 | 482 |
| 612 | iso_pu_bacteria | 2945909444 | 2945914593 | 482 |
| 613 | iso_pu_bacteria | 2945984333 | 2945990006 | 482 |
| 614 | iso_pu_bacteria | 8057101203 | 8057102815 | 482 |
| 615 | 3300006847 | Ga0075431_100032592 | Ga0075431_1000325923 | 483 |
| 616 | 3300006880 | Ga0075429_100021787 | Ga0075429_1000217873 | 483 |
| 617 | 3300009147 | Ga0114129_10028864 | Ga0114129_100288646 | 483 |
| 618 | 3300031616 | Ga0307508_10026744 | Ga0307508_100267445 | 483 |
| 619 | 3300048928 | Ga0496125_0003687 | Ga0496125_0003687_92_1672 | 483 |
| 620 | 3300048929 | Ga0496126_0025832 | Ga0496126_0025832_2811_4391 | 483 |
| 621 | 3300049583 | Ga0501067_0051568 | Ga0501067_0051568_459_2018 | 483 |
| 622 | 3300050507 | nmdc:mga05p37_6701_c1 | nmdc:mga05p37_6701_c1_10602_12161 | 483 |
| 623 | 3300050510 | nmdc:mga06r32_31467_c1 | nmdc:mga06r32_31467_c1_1091_2650 | 483 |
| 624 | 3300005985 | Ga0081539_10005615 | Ga0081539_100056157 | 484 |
| 625 | 3300021388 | Ga0213875_10001633 | Ga0213875_100016338 | 484 |
| 626 | 3300037312 | Ga0395899_0000091 | Ga0395899_0000091_150914_152455 | 484 |
| 627 | 3300037418 | Ga0395900_0000008 | Ga0395900_0000008_476593_478134 | 484 |
| 628 | 3300037466 | Ga0395898_0017952 | Ga0395898_0017952_2326_3867 | 484 |
| 629 | 3300037471 | Ga0395905_0046457 | Ga0395905_0046457_1225_2766 | 484 |
| 630 | 3300037853 | Ga0436364_0103177 | Ga0436364_0103177_52144_53793 | 484 |
| 631 | 3300038443 | Ga0395901_0000008 | Ga0395901_0000008_2326_3867 | 484 |
| 632 | 3300048905 | Ga0496102_0000597 | Ga0496102_0000597_4359_5924 | 484 |
| 633 | 3300049583 | Ga0501067_0054191 | Ga0501067_0054191_131_1720 | 484 |
| 634 | iso_pu_bacteria | 2513237165 | 2514045617 | 484 |
| 635 | iso_pu_bacteria | 2885198086 | 2885201522 | 484 |
| 636 | iso_pu_bacteria | 2885211737 | 2885215767 | 484 |
| 637 | iso_pu_bacteria | 8011350971 | 8011353305 | 484 |
| 638 | 3300005471 | Ga0070698_100022808 | Ga0070698_1000228081 | 485 |
| 639 | 3300005842 | Ga0068858_100002113 | Ga0068858_10000211311 | 485 |
| 640 | 3300009098 | Ga0105245_10000529 | Ga0105245_1000052921 | 485 |
| 641 | 3300009148 | Ga0105243_10047640 | Ga0105243_100476402 | 485 |
| 642 | 3300013296 | Ga0157374_10153738 | Ga0157374_101537381 | 485 |
| 643 | 3300013308 | Ga0157375_10037218 | Ga0157375_100372185 | 485 |
| 644 | 3300025229 | Ga0209147_100368 | Ga0209147_10036816 | 485 |
| 645 | 3300025927 | Ga0207687_10102872 | Ga0207687_101028721 | 485 |
| 646 | 3300026035 | Ga0207703_10001637 | Ga0207703_100016379 | 485 |
| 647 | 3300031616 | Ga0307508_10002212 | Ga0307508_1000221214 | 485 |
| 648 | 3300033180 | Ga0307510_10003235 | Ga0307510_100032359 | 485 |
| 649 | 3300046453 | Ga0495627_000078 | Ga0495627_000078_68973_70535 | 485 |
| 650 | 3300046453 | Ga0495627_000939 | Ga0495627_000939_3132_4694 | 485 |
| 651 | 3300046506 | Ga0495583_0004588 | Ga0495583_0004588_3025_4587 | 485 |
| 652 | 3300046512 | Ga0495610_0001502 | Ga0495610_0001502_15847_17409 | 485 |
| 653 | 3300046519 | Ga0495632_0000001 | Ga0495632_0000001_508104_509666 | 485 |
| 654 | 3300046520 | Ga0495637_0000088 | Ga0495637_0000088_26315_27877 | 485 |
| 655 | 3300046520 | Ga0495637_0004718 | Ga0495637_0004718_2874_4436 | 485 |
| 656 | 3300046522 | Ga0495643_0000006 | Ga0495643_0000006_198501_200063 | 485 |
| 657 | 3300046524 | Ga0495648_0002964 | Ga0495648_0002964_1415_2977 | 485 |
| 658 | 3300046524 | Ga0495648_0025371 | Ga0495648_0025371_353_1915 | 485 |
| 659 | 3300046525 | Ga0495663_0000001 | Ga0495663_0000001_363630_365192 | 485 |
| 660 | 3300046558 | Ga0495633_0000053 | Ga0495633_0000053_58744_60306 | 485 |
| 661 | 3300046558 | Ga0495633_0000424 | Ga0495633_0000424_15764_17326 | 485 |
| 662 | 3300046660 | Ga0495625_0000014 | Ga0495625_0000014_191795_193357 | 485 |
| 663 | 3300046691 | Ga0495670_0001666 | Ga0495670_0001666_7753_9315 | 485 |
| 664 | 3300046692 | Ga0495671_0000008 | Ga0495671_0000008_198501_200063 | 485 |
| 665 | 3300047320 | Ga0495672_0015785 | Ga0495672_0015785_2684_4246 | 485 |
| 666 | 3300047445 | Ga0495677_0001245 | Ga0495677_0001245_4416_5978 | 485 |
| 667 | 3300047470 | Ga0495681_0000022 | Ga0495681_0000022_147957_149519 | 485 |
| 668 | 3300047470 | Ga0495681_0002045 | Ga0495681_0002045_2055_3617 | 485 |
| 669 | 3300047472 | Ga0495686_0008331 | Ga0495686_0008331_3127_4689 | 485 |
| 670 | 3300047472 | Ga0495686_0036614 | Ga0495686_0036614_69_1631 | 485 |
| 671 | 3300047472 | Ga0495686_0039467 | Ga0495686_0039467_1275_2837 | 485 |
| 672 | 3300053087 | Ga0500643_000221 | Ga0500643_000221_12421_13983 | 485 |
| 673 | 3300053139 | Ga0500568_0030813 | Ga0500568_0030813_228_1790 | 485 |
| 674 | 3300005354 | Ga0070675_100053540 | Ga0070675_1000535402 | 486 |
| 675 | 3300005435 | Ga0070714_100182209 | Ga0070714_1001822091 | 486 |
| 676 | 3300005548 | Ga0070665_100000011 | Ga0070665_10000001156 | 486 |
| 677 | 3300005563 | Ga0068855_100000032 | Ga0068855_10000003257 | 486 |
| 678 | 3300005564 | Ga0070664_100085635 | Ga0070664_1000856352 | 486 |
| 679 | 3300005577 | Ga0068857_100023384 | Ga0068857_1000233845 | 486 |
| 680 | 3300005614 | Ga0068856_100013762 | Ga0068856_1000137622 | 486 |
| 681 | 3300005841 | Ga0068863_100071883 | Ga0068863_1000718832 | 486 |
| 682 | 3300009551 | Ga0105238_10080063 | Ga0105238_100800632 | 486 |
| 683 | 3300013105 | Ga0157369_10003669 | Ga0157369_1000366918 | 486 |
| 684 | 3300013307 | Ga0157372_10080788 | Ga0157372_100807883 | 486 |
| 685 | 3300026088 | Ga0207641_10101803 | Ga0207641_101018032 | 486 |
| 686 | 3300028379 | Ga0268266_10000063 | Ga0268266_1000006353 | 486 |
| 687 | 3300031240 | Ga0265320_10000631 | Ga0265320_1000063113 | 486 |
| 688 | 3300031711 | Ga0265314_10001042 | Ga0265314_1000104211 | 486 |
| 689 | 3300031995 | Ga0307409_100159216 | Ga0307409_1001592161 | 486 |
| 690 | 3300039437 | Ga0436365_1885236 | Ga0436365_1885236_1173_2735 | 486 |
| 691 | 3300046692 | Ga0495671_0029544 | Ga0495671_0029544_348_1913 | 486 |
| 692 | 3300053118 | Ga0500594_0006883 | Ga0500594_0006883_180_1745 | 486 |
| 693 | 3300053139 | Ga0500568_0001089 | Ga0500568_0001089_3427_4986 | 486 |
| 694 | 3300053151 | Ga0500604_0000011 | Ga0500604_0000011_47685_49244 | 486 |
| 695 | 3300053153 | Ga0500616_0000123 | Ga0500616_0000123_68566_70125 | 486 |
| 696 | 3300003792 | Ga0055540_1007428 | Ga0055540_10074282 | 488 |
| 697 | 3300025292 | Ga0209676_1001329 | Ga0209676_10013293 | 488 |
| 698 | 3300025303 | Ga0209051_1000413 | Ga0209051_100041310 | 488 |
| 699 | 3300025303 | Ga0209051_1011091 | Ga0209051_10110915 | 488 |
| 700 | 3300046692 | Ga0495671_0006971 | Ga0495671_0006971_3850_5406 | 488 |
| 701 | 3300006846 | Ga0075430_100067423 | Ga0075430_1000674233 | 489 |
| 702 | 3300006880 | Ga0075429_100003204 | Ga0075429_1000032042 | 489 |
| 703 | 3300035410 | Ga0373924_0004493 | Ga0373924_0004493_126_1685 | 489 |
| 704 | 3300050508 | nmdc:mga09592_71_c1 | nmdc:mga09592_71_c1_21310_22869 | 489 |
| 705 | 3300050509 | nmdc:mga0qj67_6384_c1 | nmdc:mga0qj67_6384_c1_4707_6266 | 489 |
| 706 | 3300032004 | Ga0307414_10182977 | Ga0307414_101829771 | 490 |
| 707 | 3300001904 | JGI24736J21556_1000082 | JGI24736J21556_100008217 | 512 |
| 708 | 3300001979 | JGI24740J21852_10003927 | JGI24740J21852_100039276 | 512 |
| 709 | 3300001989 | JGI24739J22299_10005208 | JGI24739J22299_100052082 | 512 |
| 710 | 3300002075 | JGI24738J21930_10008269 | JGI24738J21930_100082692 | 512 |
| 711 | 3300005366 | Ga0070659_100004221 | Ga0070659_1000042215 | 512 |
| 712 | 3300005455 | Ga0070663_100005868 | Ga0070663_1000058684 | 512 |
| 713 | 3300005457 | Ga0070662_100022891 | Ga0070662_1000228912 | 512 |
| 714 | 3300005564 | Ga0070664_100006782 | Ga0070664_1000067826 | 512 |
| 715 | 3300005577 | Ga0068857_100028137 | Ga0068857_1000281373 | 512 |
| 716 | 3300025904 | Ga0207647_10003799 | Ga0207647_100037996 | 512 |
| 717 | 3300025914 | Ga0207671_10001110 | Ga0207671_1000111026 | 512 |
| 718 | 3300025919 | Ga0207657_10061524 | Ga0207657_100615242 | 512 |
| 719 | 3300025933 | Ga0207706_10065345 | Ga0207706_100653452 | 512 |
| 720 | 3300025949 | Ga0207667_10012779 | Ga0207667_100127796 | 512 |
| 721 | 3300026067 | Ga0207678_10015276 | Ga0207678_100152765 | 512 |
| 722 | 3300026078 | Ga0207702_10001744 | Ga0207702_1000174412 | 512 |
| 723 | 3300026116 | Ga0207674_10083033 | Ga0207674_100830332 | 512 |
| 724 | 3300031911 | Ga0307412_10013256 | Ga0307412_100132563 | 512 |
| 725 | 3300032004 | Ga0307414_10003714 | Ga0307414_100037144 | 512 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ivr-assembly1.cif.gz_B | crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 | 0.9219 | 5 | 412 |
| 3ivr-assembly1.cif.gz_B | crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 | 0.9129 | 5 | 412 |
| 5zrn-assembly1.cif.gz_A | inhibitor bound crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis | 0.9101 | 5 | 412 |
| 3t5c-assembly2.cif.gz_B | crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis in different space group c2 | 0.9084 | 5 | 411 |
| 3t5c-assembly2.cif.gz_B | crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis in different space group c2 | 0.9061 | 5 | 411 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u95D03 | Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 | 0.9419 | 340 | 412 | 2.30.38.10 |
| af_O05819_776_852_2.30.38.10 | Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 | 0.9419 | 344 | 410 | 2.30.38.10 |
| 2d1qA01 | Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 | 0.9363 | 338 | 412 | 2.30.38.10 |
| af_Q2G1H9_722_797_2.30.38.10 | Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 | 0.9278 | 340 | 410 | 2.30.38.10 |
| 3ivrB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain | 0.9219 | 5 | 412 | 3.40.50.12780 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X0Y3T5-F1-model_v4 | AMP-dependent synthetase/ligase domain-containing protein | 0.9449 | 338 | 410 |
|
| AF-A0A538IHP9-F1-model_v4 | Fatty acid--CoA ligase family protein | 0.9402 | 7 | 107 |
GO:0016874
|
| AF-A0A1M5BJV3-F1-model_v4 | AMP-binding enzyme | 0.9273 | 6 | 116 |
|
| AF-A0A0F4IVL8-F1-model_v4 | deleted | 0.9148 | 1 | 107 |
|
| AF-A0A533VPQ0-F1-model_v4 | Long-chain fatty acid--CoA ligase | 0.9071 | 6 | 413 |
GO:0016874
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar