F477495
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 723 | 358 | 717 | 307 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10072887|Ga0207693_100728872 |
| Length | 302 |
| Sequence | MKIAVPDLISNSYFPAVAAVALGFLEQEGLDVSLELIFPVDEAYRAMRDGRVHFVAGSAHSALAAFPEWQGAKLLCAQAQGMYWFLVMRADLGACRIGAAPWVEMGLRRLLIEAGLDLERDGVTIAPVPGASGTTVNFGLTAAKALEEGKIDGFWANGMGTEVAVRRGVGTVVLDVRRGDGPKPCFNYTMASVAATDRLIDSSPETAAAVICAVVKTHAALKADPERAAEVGRKLFPPSETSLIAELIRRDLPYYDAAISPEFVAGMNQFARDVGILHGDVPYDRLVATRFAPLWHAKPVAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 3 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 4 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 5 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 6 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 99 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 336 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 355 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 358 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.03 |
| Metatranscriptomes | 0.14 |
| Isolates | 0.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0 |
| Rhizoplane | 7.19 |
| Rhizosphere | 87.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1016012 | 3300001915 | Unclassified | 1230 |
| 2 | JGI24752J21851_1007905 | 3300001976 | Unclassified | 1386 |
| 3 | JGI24746J21847_1000301 | 3300001977 | Bacteria | 7066 |
| 4 | JGI24747J21853_1002506 | 3300001978 | Unclassified | 1506 |
| 5 | JGI24745J21846_1003175 | 3300002073 | Unclassified | 1709 |
| 6 | JGI24738J21930_10016245 | 3300002075 | Unclassified | 1575 |
| 7 | JGI24034J26672_10002166 | 3300002239 | Plasmid | 2677 |
| 8 | JGI24742J22300_10004840 | 3300002244 | Unclassified | 2211 |
| 9 | Ga0058859_11802100 | 3300004798 | Unclassified | 1931 |
| 10 | Ga0065715_10119142 | 3300005293 | Bacteria | 2277 |
| 11 | Ga0065707_10082650 | 3300005295 | Bacteria | 13052 |
| 12 | Ga0070676_10005715 | 3300005328 | Bacteria | 6629 |
| 13 | Ga0070683_100001578 | 3300005329 | Bacteria | 17633 |
| 14 | Ga0070690_100063540 | 3300005330 | Bacteria | 2383 |
| 15 | Ga0070666_10037539 | 3300005335 | Bacteria | 3222 |
| 16 | Ga0070680_100014147 | 3300005336 | Bacteria | 6232 |
| 17 | Ga0070680_100036470 | 3300005336 | Bacteria | 3972 |
| 18 | Ga0070680_100210102 | 3300005336 | Bacteria | 1642 |
| 19 | Ga0070680_100312712 | 3300005336 | Bacteria | 1333 |
| 20 | Ga0070682_100006267 | 3300005337 | Bacteria | 6672 |
| 21 | Ga0068868_100003154 | 3300005338 | Bacteria | 11476 |
| 22 | Ga0070660_100053034 | 3300005339 | Bacteria | 3127 |
| 23 | Ga0070689_100002987 | 3300005340 | Bacteria | 11119 |
| 24 | Ga0070691_10046178 | 3300005341 | Bacteria | 2068 |
| 25 | Ga0070687_100002357 | 3300005343 | Bacteria | 7043 |
| 26 | Ga0070661_100004564 | 3300005344 | Bacteria | 9524 |
| 27 | Ga0070692_10003415 | 3300005345 | Bacteria | 6438 |
| 28 | Ga0070668_100011260 | 3300005347 | Bacteria | 6662 |
| 29 | Ga0070669_100014076 | 3300005353 | Bacteria | 5689 |
| 30 | Ga0070675_100141682 | 3300005354 | Bacteria | 2055 |
| 31 | Ga0070671_100038743 | 3300005355 | Bacteria | 3955 |
| 32 | Ga0070674_100004148 | 3300005356 | Bacteria | 8229 |
| 33 | Ga0070688_100008074 | 3300005365 | Bacteria | 5699 |
| 34 | Ga0070709_10019395 | 3300005434 | Bacteria | 3930 |
| 35 | Ga0070709_10079206 | 3300005434 | Bacteria | 2140 |
| 36 | Ga0070714_100009461 | 3300005435 | Bacteria | 7663 |
| 37 | Ga0070714_100164535 | 3300005435 | Bacteria | 2009 |
| 38 | Ga0070714_100358363 | 3300005435 | Bacteria | 1371 |
| 39 | Ga0070713_100033716 | 3300005436 | Bacteria | 4105 |
| 40 | Ga0070713_100039319 | 3300005436 | Bacteria | 3839 |
| 41 | Ga0070713_100040285 | 3300005436 | Bacteria | 3797 |
| 42 | Ga0070713_100488542 | 3300005436 | Unclassified | 1160 |
| 43 | Ga0070710_10006151 | 3300005437 | Bacteria | 5741 |
| 44 | Ga0070710_10075675 | 3300005437 | Bacteria | 1952 |
| 45 | Ga0070710_10108696 | 3300005437 | Bacteria | 1663 |
| 46 | Ga0070701_10000656 | 3300005438 | Bacteria | 12133 |
| 47 | Ga0070711_100036195 | 3300005439 | Bacteria | 3306 |
| 48 | Ga0070711_100048091 | 3300005439 | Bacteria | 2915 |
| 49 | Ga0070705_100433827 | 3300005440 | Bacteria | 981 |
| 50 | Ga0070694_100231608 | 3300005444 | Bacteria | 1390 |
| 51 | Ga0070708_100128849 | 3300005445 | Bacteria | 2341 |
| 52 | Ga0070708_100168880 | 3300005445 | Bacteria | 2041 |
| 53 | Ga0070663_100010818 | 3300005455 | Bacteria | 5699 |
| 54 | Ga0070663_100375651 | 3300005455 | Bacteria | 1156 |
| 55 | Ga0070678_100010317 | 3300005456 | Bacteria | 5699 |
| 56 | Ga0070678_100377794 | 3300005456 | Unclassified | 1225 |
| 57 | Ga0070678_100435626 | 3300005456 | Bacteria | 1145 |
| 58 | Ga0070662_100029865 | 3300005457 | Bacteria | 3808 |
| 59 | Ga0070662_100087405 | 3300005457 | Bacteria | 2334 |
| 60 | Ga0070681_10006391 | 3300005458 | Bacteria | 11459 |
| 61 | Ga0070681_10007202 | 3300005458 | Bacteria | 10845 |
| 62 | Ga0070681_10038375 | 3300005458 | Bacteria | 4802 |
| 63 | Ga0070681_10041787 | 3300005458 | Bacteria | 4596 |
| 64 | Ga0070681_10302655 | 3300005458 | Bacteria | 1508 |
| 65 | Ga0068867_100007228 | 3300005459 | Bacteria | 7851 |
| 66 | Ga0070685_10001672 | 3300005466 | Bacteria | 11650 |
| 67 | Ga0070706_100006024 | 3300005467 | Bacteria | 11462 |
| 68 | Ga0070707_100217166 | 3300005468 | Bacteria | 1863 |
| 69 | Ga0070707_100425846 | 3300005468 | Bacteria | 1288 |
| 70 | Ga0070698_100000549 | 3300005471 | Bacteria | 40084 |
| 71 | Ga0070698_100005315 | 3300005471 | Bacteria | 14094 |
| 72 | Ga0070698_100023653 | 3300005471 | Bacteria | 6419 |
| 73 | Ga0070699_100005284 | 3300005518 | Bacteria | 11329 |
| 74 | Ga0070699_100201415 | 3300005518 | Bacteria | 1770 |
| 75 | Ga0070699_100610114 | 3300005518 | Bacteria | 995 |
| 76 | Ga0070679_100001104 | 3300005530 | Bacteria | 23597 |
| 77 | Ga0070679_100026366 | 3300005530 | Bacteria | 5709 |
| 78 | Ga0070679_100061318 | 3300005530 | Bacteria | 3748 |
| 79 | Ga0070684_100018816 | 3300005535 | Bacteria | 5699 |
| 80 | Ga0070697_100168027 | 3300005536 | Bacteria | 1855 |
| 81 | Ga0070672_100070423 | 3300005543 | Bacteria | 2779 |
| 82 | Ga0070672_100511339 | 3300005543 | Bacteria | 1040 |
| 83 | Ga0070695_100004843 | 3300005545 | Bacteria | 7925 |
| 84 | Ga0070695_100036667 | 3300005545 | Bacteria | 3086 |
| 85 | Ga0070696_100011714 | 3300005546 | Bacteria | 5877 |
| 86 | Ga0070696_100029786 | 3300005546 | Bacteria | 3734 |
| 87 | Ga0070696_100099229 | 3300005546 | Bacteria | 2084 |
| 88 | Ga0070693_100008306 | 3300005547 | Bacteria | 5109 |
| 89 | Ga0070693_100045480 | 3300005547 | Bacteria | 2488 |
| 90 | Ga0070704_100010246 | 3300005549 | Bacteria | 5699 |
| 91 | Ga0070704_100015795 | 3300005549 | Bacteria | 4753 |
| 92 | Ga0068855_100042947 | 3300005563 | Bacteria | 5357 |
| 93 | Ga0070664_100008431 | 3300005564 | Bacteria | 8334 |
| 94 | Ga0070664_100123951 | 3300005564 | Unclassified | 2265 |
| 95 | Ga0068857_100000358 | 3300005577 | Bacteria | 31869 |
| 96 | Ga0068854_100005944 | 3300005578 | Bacteria | 7732 |
| 97 | Ga0068856_100133704 | 3300005614 | Bacteria | 2486 |
| 98 | Ga0070702_100002690 | 3300005615 | Bacteria | 7766 |
| 99 | Ga0070702_100060302 | 3300005615 | Unclassified | 2205 |
| 100 | Ga0068852_100006913 | 3300005616 | Bacteria | 8251 |
| 101 | Ga0068852_100557160 | 3300005616 | Bacteria | 1147 |
| 102 | Ga0068859_100009678 | 3300005617 | Bacteria | 9729 |
| 103 | Ga0068864_100002272 | 3300005618 | Bacteria | 15889 |
| 104 | Ga0068866_10000358 | 3300005718 | Bacteria | 21438 |
| 105 | Ga0068870_10000025 | 3300005840 | Bacteria | 46848 |
| 106 | Ga0068863_100018070 | 3300005841 | Bacteria | 6753 |
| 107 | Ga0068858_100007959 | 3300005842 | Bacteria | 10215 |
| 108 | Ga0068858_100055290 | 3300005842 | Bacteria | 3669 |
| 109 | Ga0068858_100055381 | 3300005842 | Bacteria | 3666 |
| 110 | Ga0068860_100008914 | 3300005843 | Bacteria | 9996 |
| 111 | Ga0068860_100265278 | 3300005843 | Unclassified | 1675 |
| 112 | Ga0068862_100019145 | 3300005844 | Bacteria | 5708 |
| 113 | Ga0081455_10030414 | 3300005937 | Bacteria | 4904 |
| 114 | Ga0081455_10062371 | 3300005937 | Bacteria | 3133 |
| 115 | Ga0081538_10035222 | 3300005981 | Bacteria | 3293 |
| 116 | Ga0081540_1000038 | 3300005983 | Bacteria | 138179 |
| 117 | Ga0081540_1014076 | 3300005983 | Bacteria | 5153 |
| 118 | Ga0081539_10018128 | 3300005985 | Bacteria | 4902 |
| 119 | Ga0070717_10064905 | 3300006028 | Bacteria | 3034 |
| 120 | Ga0075365_10031838 | 3300006038 | Bacteria | 3386 |
| 121 | Ga0075365_10047058 | 3300006038 | Bacteria | 2834 |
| 122 | Ga0070715_10000933 | 3300006163 | Bacteria | 8140 |
| 123 | Ga0070715_10048925 | 3300006163 | Bacteria | 1810 |
| 124 | Ga0075362_10023720 | 3300006177 | Bacteria | 2598 |
| 125 | Ga0075367_10115850 | 3300006178 | Bacteria | 1648 |
| 126 | Ga0068871_100002009 | 3300006358 | Bacteria | 13770 |
| 127 | Ga0068871_100005001 | 3300006358 | Bacteria | 9264 |
| 128 | Ga0075428_100004974 | 3300006844 | Bacteria | 14757 |
| 129 | Ga0075428_100182136 | 3300006844 | Bacteria | 2273 |
| 130 | Ga0075428_100294626 | 3300006844 | Bacteria | 1745 |
| 131 | Ga0075430_100034845 | 3300006846 | Bacteria | 4273 |
| 132 | Ga0075431_100070049 | 3300006847 | Bacteria | 3618 |
| 133 | Ga0075433_10317121 | 3300006852 | Bacteria | 1379 |
| 134 | Ga0075434_100034134 | 3300006871 | Bacteria | 5023 |
| 135 | Ga0075434_100156525 | 3300006871 | Bacteria | 2298 |
| 136 | Ga0075434_100214377 | 3300006871 | Bacteria | 1945 |
| 137 | Ga0075434_100262183 | 3300006871 | Bacteria | 1747 |
| 138 | Ga0075429_100089118 | 3300006880 | Bacteria | 2689 |
| 139 | Ga0075429_100127863 | 3300006880 | Bacteria | 2222 |
| 140 | Ga0068865_100322860 | 3300006881 | Bacteria | 1242 |
| 141 | Ga0097620_100009681 | 3300006931 | Bacteria | 9729 |
| 142 | Ga0075435_100015827 | 3300007076 | Bacteria | 5677 |
| 143 | Ga0075435_100047682 | 3300007076 | Bacteria | 3440 |
| 144 | Ga0099794_10015673 | 3300007265 | Bacteria | 3350 |
| 145 | Ga0105244_10097084 | 3300009036 | Bacteria | 1444 |
| 146 | Ga0105250_10041125 | 3300009092 | Bacteria | 1853 |
| 147 | Ga0105240_10070146 | 3300009093 | Bacteria | 4336 |
| 148 | Ga0111539_10028243 | 3300009094 | Bacteria | 6847 |
| 149 | Ga0111539_10098897 | 3300009094 | Bacteria | 3426 |
| 150 | Ga0111539_10476150 | 3300009094 | Bacteria | 1454 |
| 151 | Ga0105245_10030201 | 3300009098 | Bacteria | 4792 |
| 152 | Ga0105245_10534173 | 3300009098 | Bacteria | 1193 |
| 153 | Ga0105247_10020813 | 3300009101 | Plasmid | 3945 |
| 154 | Ga0114129_10076945 | 3300009147 | Bacteria | 4643 |
| 155 | Ga0114129_10078797 | 3300009147 | Bacteria | 4582 |
| 156 | Ga0105243_10011552 | 3300009148 | Bacteria | 6681 |
| 157 | Ga0105243_10057438 | 3300009148 | Bacteria | 3099 |
| 158 | Ga0105241_10003634 | 3300009174 | Bacteria | 11459 |
| 159 | Ga0105242_10056242 | 3300009176 | Bacteria | 3219 |
| 160 | Ga0105242_10119232 | 3300009176 | Bacteria | 2261 |
| 161 | Ga0105237_10016489 | 3300009545 | Bacteria | 7674 |
| 162 | Ga0105237_10180294 | 3300009545 | Bacteria | 2113 |
| 163 | Ga0105249_10022058 | 3300009553 | Bacteria | 5702 |
| 164 | Ga0105249_10050755 | 3300009553 | Bacteria | 3781 |
| 165 | Ga0099796_10017613 | 3300010159 | Bacteria | 2131 |
| 166 | Ga0105239_10188965 | 3300010375 | Bacteria | 2306 |
| 167 | Ga0105246_10071004 | 3300011119 | Bacteria | 2451 |
| 168 | Ga0157373_10136941 | 3300013100 | Bacteria | 1722 |
| 169 | Ga0157370_10046630 | 3300013104 | Bacteria | 4155 |
| 170 | Ga0157370_10062445 | 3300013104 | Bacteria | 3533 |
| 171 | Ga0157378_10011414 | 3300013297 | Bacteria | 7778 |
| 172 | Ga0163162_10167354 | 3300013306 | Bacteria | 2322 |
| 173 | Ga0163162_10167770 | 3300013306 | Bacteria | 2319 |
| 174 | Ga0163162_10481309 | 3300013306 | Bacteria | 1373 |
| 175 | Ga0157372_10030789 | 3300013307 | Bacteria | 5871 |
| 176 | Ga0157372_10083535 | 3300013307 | Bacteria | 3618 |
| 177 | Ga0157375_10023326 | 3300013308 | Bacteria | 5709 |
| 178 | Ga0157375_10525459 | 3300013308 | Bacteria | 1346 |
| 179 | Ga0157375_10662276 | 3300013308 | Unclassified | 1200 |
| 180 | Ga0163163_10013913 | 3300014325 | Bacteria | 7381 |
| 181 | Ga0163163_10399489 | 3300014325 | Bacteria | 1433 |
| 182 | Ga0157380_10236524 | 3300014326 | Bacteria | 1644 |
| 183 | Ga0157377_10108000 | 3300014745 | Bacteria | 1669 |
| 184 | Ga0157379_10056306 | 3300014968 | Bacteria | 3513 |
| 185 | Ga0157379_10065106 | 3300014968 | Plasmid | 3258 |
| 186 | Ga0157379_10294091 | 3300014968 | Bacteria | 1479 |
| 187 | Ga0157376_10143494 | 3300014969 | Bacteria | 2145 |
| 188 | Ga0163161_10112856 | 3300017792 | Bacteria | 2034 |
| 189 | Ga0213876_10071428 | 3300021384 | Bacteria | 1833 |
| 190 | Ga0213876_10078342 | 3300021384 | Bacteria | 1746 |
| 191 | Ga0213875_10000116 | 3300021388 | Bacteria | 90170 |
| 192 | Ga0207666_1000252 | 3300025271 | Bacteria | 7908 |
| 193 | Ga0207682_10000607 | 3300025893 | Bacteria | 16670 |
| 194 | Ga0207692_10019860 | 3300025898 | Bacteria | 3045 |
| 195 | Ga0207692_10147747 | 3300025898 | Bacteria | 1343 |
| 196 | Ga0207685_10012768 | 3300025905 | Bacteria | 2575 |
| 197 | Ga0207685_10090399 | 3300025905 | Bacteria | 1288 |
| 198 | Ga0207685_10106290 | 3300025905 | Bacteria | 1209 |
| 199 | Ga0207643_10000397 | 3300025908 | Bacteria | 29056 |
| 200 | Ga0207684_10005624 | 3300025910 | Bacteria | 11522 |
| 201 | Ga0207707_10002788 | 3300025912 | Bacteria | 15578 |
| 202 | Ga0207695_10077085 | 3300025913 | Bacteria | 3387 |
| 203 | Ga0207693_10001021 | 3300025915 | Bacteria | 25052 |
| 204 | Ga0207693_10004915 | 3300025915 | Bacteria | 11232 |
| 205 | Ga0207693_10050585 | 3300025915 | Bacteria | 3263 |
| 206 | Ga0207693_10072887 | 3300025915 | Bacteria | 2688 |
| 207 | Ga0207693_10087581 | 3300025915 | Unclassified | 2440 |
| 208 | Ga0207693_10243292 | 3300025915 | Bacteria | 1412 |
| 209 | Ga0207663_10029253 | 3300025916 | Bacteria | 3234 |
| 210 | Ga0207663_10041700 | 3300025916 | Bacteria | 2799 |
| 211 | Ga0207663_10053074 | 3300025916 | Unclassified | 2531 |
| 212 | Ga0207663_10090505 | 3300025916 | Bacteria | 2029 |
| 213 | Ga0207660_10105034 | 3300025917 | Bacteria | 2116 |
| 214 | Ga0207660_10134951 | 3300025917 | Bacteria | 1882 |
| 215 | Ga0207662_10038596 | 3300025918 | Bacteria | 2799 |
| 216 | Ga0207649_10001199 | 3300025920 | Bacteria | 15630 |
| 217 | Ga0207652_10001750 | 3300025921 | Bacteria | 18954 |
| 218 | Ga0207652_10002218 | 3300025921 | Bacteria | 16572 |
| 219 | Ga0207652_10021390 | 3300025921 | Bacteria | 5340 |
| 220 | Ga0207681_10002243 | 3300025923 | Bacteria | 12288 |
| 221 | Ga0207681_10002492 | 3300025923 | Bacteria | 11695 |
| 222 | Ga0207681_10132362 | 3300025923 | Bacteria | 1846 |
| 223 | Ga0207650_10005388 | 3300025925 | Bacteria | 8726 |
| 224 | Ga0207659_10000923 | 3300025926 | Bacteria | 17507 |
| 225 | Ga0207687_10005521 | 3300025927 | Bacteria | 8365 |
| 226 | Ga0207687_10143912 | 3300025927 | Bacteria | 1812 |
| 227 | Ga0207700_10025030 | 3300025928 | Bacteria | 4139 |
| 228 | Ga0207700_10028263 | 3300025928 | Bacteria | 3940 |
| 229 | Ga0207700_10083576 | 3300025928 | Bacteria | 2500 |
| 230 | Ga0207700_10176206 | 3300025928 | Bacteria | 1787 |
| 231 | Ga0207700_10364418 | 3300025928 | Bacteria | 1261 |
| 232 | Ga0207664_10138137 | 3300025929 | Bacteria | 2058 |
| 233 | Ga0207644_10000439 | 3300025931 | Bacteria | 26923 |
| 234 | Ga0207644_10040018 | 3300025931 | Bacteria | 3311 |
| 235 | Ga0207690_10003249 | 3300025932 | Bacteria | 9751 |
| 236 | Ga0207690_10030533 | 3300025932 | Bacteria | 3439 |
| 237 | Ga0207690_10163835 | 3300025932 | Bacteria | 1660 |
| 238 | Ga0207706_10016044 | 3300025933 | Bacteria | 6770 |
| 239 | Ga0207686_10002903 | 3300025934 | Bacteria | 9241 |
| 240 | Ga0207686_10027193 | 3300025934 | Bacteria | 3347 |
| 241 | Ga0207709_10001261 | 3300025935 | Bacteria | 18148 |
| 242 | Ga0207670_10008671 | 3300025936 | Bacteria | 5754 |
| 243 | Ga0207669_10000616 | 3300025937 | Bacteria | 15473 |
| 244 | Ga0207669_10049627 | 3300025937 | Bacteria | 2503 |
| 245 | Ga0207704_10009900 | 3300025938 | Bacteria | 4623 |
| 246 | Ga0207665_10025929 | 3300025939 | Bacteria | 3867 |
| 247 | Ga0207665_10117286 | 3300025939 | Bacteria | 1877 |
| 248 | Ga0207691_10106580 | 3300025940 | Bacteria | 2496 |
| 249 | Ga0207691_10229119 | 3300025940 | Bacteria | 1609 |
| 250 | Ga0207711_10166791 | 3300025941 | Bacteria | 1996 |
| 251 | Ga0207661_10008182 | 3300025944 | Bacteria | 7464 |
| 252 | Ga0207679_10000624 | 3300025945 | Bacteria | 23633 |
| 253 | Ga0207679_10002602 | 3300025945 | Bacteria | 11113 |
| 254 | Ga0207679_10070676 | 3300025945 | Bacteria | 2631 |
| 255 | Ga0207679_10144205 | 3300025945 | Unclassified | 1929 |
| 256 | Ga0207651_10192564 | 3300025960 | Bacteria | 1628 |
| 257 | Ga0207712_10021901 | 3300025961 | Bacteria | 4200 |
| 258 | Ga0207668_10007113 | 3300025972 | Bacteria | 6639 |
| 259 | Ga0207668_10474778 | 3300025972 | Bacteria | 1071 |
| 260 | Ga0207640_10004625 | 3300025981 | Bacteria | 7471 |
| 261 | Ga0207658_10022934 | 3300025986 | Bacteria | 4350 |
| 262 | Ga0207677_10001740 | 3300026023 | Bacteria | 11549 |
| 263 | Ga0207703_10004099 | 3300026035 | Bacteria | 12027 |
| 264 | Ga0207639_10106772 | 3300026041 | Bacteria | 2273 |
| 265 | Ga0207708_10200306 | 3300026075 | Bacteria | 1593 |
| 266 | Ga0207702_10074432 | 3300026078 | Bacteria | 2931 |
| 267 | Ga0207641_10012663 | 3300026088 | Bacteria | 6915 |
| 268 | Ga0207676_10003096 | 3300026095 | Bacteria | 11864 |
| 269 | Ga0207674_10001342 | 3300026116 | Bacteria | 31848 |
| 270 | Ga0207675_100539688 | 3300026118 | Bacteria | 1164 |
| 271 | Ga0207683_10037184 | 3300026121 | Bacteria | 4239 |
| 272 | Ga0207698_10024262 | 3300026142 | Bacteria | 4253 |
| 273 | Ga0207698_10523414 | 3300026142 | Bacteria | 1158 |
| 274 | Ga0209179_1029408 | 3300027512 | Bacteria | 1118 |
| 275 | Ga0207428_10005539 | 3300027907 | Bacteria | 11762 |
| 276 | Ga0268266_10254039 | 3300028379 | Unclassified | 1627 |
| 277 | Ga0268265_10023842 | 3300028380 | Bacteria | 4319 |
| 278 | Ga0268264_10030329 | 3300028381 | Bacteria | 4432 |
| 279 | Ga0268264_10166773 | 3300028381 | Bacteria | 1989 |
| 280 | Ga0265337_1000392 | 3300028556 | Bacteria | 23495 |
| 281 | Ga0265337_1000720 | 3300028556 | Bacteria | 17410 |
| 282 | Ga0265334_10001597 | 3300028573 | Bacteria | 10898 |
| 283 | Ga0265338_10009296 | 3300028800 | Bacteria | 11747 |
| 284 | Ga0265338_10012307 | 3300028800 | Bacteria | 9764 |
| 285 | Ga0265338_10092514 | 3300028800 | Bacteria | 2494 |
| 286 | Ga0265330_10003304 | 3300031235 | Bacteria | 8484 |
| 287 | Ga0265332_10001684 | 3300031238 | Bacteria | 12079 |
| 288 | Ga0265325_10000030 | 3300031241 | Bacteria | 103532 |
| 289 | Ga0265325_10007651 | 3300031241 | Bacteria | 6456 |
| 290 | Ga0265325_10010445 | 3300031241 | Bacteria | 5376 |
| 291 | Ga0265325_10100121 | 3300031241 | Bacteria | 1420 |
| 292 | Ga0265329_10004865 | 3300031242 | Bacteria | 5508 |
| 293 | Ga0265340_10010922 | 3300031247 | Bacteria | 4844 |
| 294 | Ga0265340_10022391 | 3300031247 | Bacteria | 3231 |
| 295 | Ga0265339_10014749 | 3300031249 | Bacteria | 4703 |
| 296 | Ga0265339_10033522 | 3300031249 | Bacteria | 2890 |
| 297 | Ga0265339_10034146 | 3300031249 | Bacteria | 2859 |
| 298 | Ga0265331_10010420 | 3300031250 | Bacteria | 5146 |
| 299 | Ga0265316_10034358 | 3300031344 | Bacteria | 4120 |
| 300 | Ga0265316_10092760 | 3300031344 | Bacteria | 2302 |
| 301 | Ga0265316_10239069 | 3300031344 | Bacteria | 1335 |
| 302 | Ga0307408_100000406 | 3300031548 | Bacteria | 38727 |
| 303 | Ga0265313_10006079 | 3300031595 | Bacteria | 8701 |
| 304 | Ga0265313_10009247 | 3300031595 | Bacteria | 6419 |
| 305 | Ga0265313_10018585 | 3300031595 | Bacteria | 3897 |
| 306 | Ga0265313_10127312 | 3300031595 | Bacteria | 1106 |
| 307 | Ga0265313_10140348 | 3300031595 | Bacteria | 1039 |
| 308 | Ga0265314_10050143 | 3300031711 | Bacteria | 2918 |
| 309 | Ga0265314_10059681 | 3300031711 | Bacteria | 2608 |
| 310 | Ga0265342_10001892 | 3300031712 | Bacteria | 18842 |
| 311 | Ga0265342_10007645 | 3300031712 | Bacteria | 7876 |
| 312 | Ga0265342_10015998 | 3300031712 | Bacteria | 4915 |
| 313 | Ga0307412_10000207 | 3300031911 | Bacteria | 40047 |
| 314 | Ga0307411_10000086 | 3300032005 | Bacteria | 28813 |
| 315 | Ga0373930_0010544 | 3300034816 | Bacteria | 1654 |
| 316 | Ga0373958_0002820 | 3300034819 | Bacteria | 2472 |
| 317 | Ga0373928_0004182 | 3300035084 | Bacteria | 2750 |
| 318 | Ga0373934_0014474 | 3300035086 | Bacteria | 2990 |
| 319 | Ga0373944_0003655 | 3300035089 | Bacteria | 3976 |
| 320 | Ga0373944_0026075 | 3300035089 | Bacteria | 1724 |
| 321 | Ga0373949_0001922 | 3300035090 | Bacteria | 5607 |
| 322 | Ga0373952_0002747 | 3300035092 | Bacteria | 3180 |
| 323 | Ga0373923_0016515 | 3300035111 | Bacteria | 2807 |
| 324 | Ga0373923_0020432 | 3300035111 | Bacteria | 2573 |
| 325 | Ga0373923_0092203 | 3300035111 | Bacteria | 1326 |
| 326 | Ga0373932_0070550 | 3300035112 | Bacteria | 1083 |
| 327 | Ga0373936_0009931 | 3300035113 | Bacteria | 3592 |
| 328 | Ga0373936_0067196 | 3300035113 | Bacteria | 1473 |
| 329 | Ga0373941_0004877 | 3300035115 | Bacteria | 3127 |
| 330 | Ga0373945_0007252 | 3300035116 | Bacteria | 3589 |
| 331 | Ga0373953_0022038 | 3300035117 | Bacteria | 2397 |
| 332 | Ga0373953_0032731 | 3300035117 | Bacteria | 2030 |
| 333 | Ga0373956_0005163 | 3300035119 | Bacteria | 5228 |
| 334 | Ga0373956_0030239 | 3300035119 | Bacteria | 2366 |
| 335 | Ga0373956_0033078 | 3300035119 | Bacteria | 2272 |
| 336 | Ga0373957_0019480 | 3300035120 | Bacteria | 2388 |
| 337 | Ga0373960_0002981 | 3300035121 | Bacteria | 3830 |
| 338 | Ga0373943_0000467 | 3300035170 | Bacteria | 17171 |
| 339 | Ga0373943_0010322 | 3300035170 | Bacteria | 4188 |
| 340 | Ga0373943_0029721 | 3300035170 | Bacteria | 2582 |
| 341 | Ga0373943_0059214 | 3300035170 | Bacteria | 1908 |
| 342 | Ga0373943_0150925 | 3300035170 | Bacteria | 1259 |
| 343 | Ga0373946_0000643 | 3300035171 | Bacteria | 11673 |
| 344 | Ga0373946_0004320 | 3300035171 | Bacteria | 5081 |
| 345 | Ga0373946_0189506 | 3300035171 | Bacteria | 980 |
| 346 | Ga0373955_0003642 | 3300035172 | Bacteria | 6781 |
| 347 | Ga0373955_0019547 | 3300035172 | Bacteria | 3388 |
| 348 | Ga0373955_0255867 | 3300035172 | Bacteria | 1050 |
| 349 | Ga0373961_0001004 | 3300035241 | Bacteria | 9210 |
| 350 | Ga0373962_0000894 | 3300035242 | Bacteria | 6824 |
| 351 | Ga0373924_0011363 | 3300035410 | Bacteria | 3306 |
| 352 | Ga0373924_0013011 | 3300035410 | Bacteria | 3120 |
| 353 | Ga0373924_0053351 | 3300035410 | Bacteria | 1679 |
| 354 | Ga0373931_0001241 | 3300035691 | Bacteria | 10893 |
| 355 | Ga0373931_0228569 | 3300035691 | Bacteria | 1123 |
| 356 | Ga0373935_0008851 | 3300035692 | Bacteria | 6024 |
| 357 | Ga0373935_0008860 | 3300035692 | Bacteria | 6021 |
| 358 | Ga0373935_0024495 | 3300035692 | Bacteria | 3715 |
| 359 | Ga0373935_0025807 | 3300035692 | Bacteria | 3622 |
| 360 | Ga0373935_0036486 | 3300035692 | Bacteria | 3073 |
| 361 | Ga0373935_0286332 | 3300035692 | Bacteria | 1161 |
| 362 | Ga0373935_0379097 | 3300035692 | Unclassified | 1012 |
| 363 | Ga0373927_0002618 | 3300035695 | Bacteria | 13120 |
| 364 | Ga0373927_0017140 | 3300035695 | Bacteria | 4773 |
| 365 | Ga0373927_0020010 | 3300035695 | Bacteria | 4390 |
| 366 | Ga0373927_0043471 | 3300035695 | Bacteria | 2908 |
| 367 | Ga0373927_0094989 | 3300035695 | Bacteria | 1937 |
| 368 | Ga0373927_0278626 | 3300035695 | Bacteria | 1100 |
| 369 | Ga0373933_0002265 | 3300035724 | Bacteria | 10966 |
| 370 | Ga0373947_0010245 | 3300035725 | Bacteria | 5380 |
| 371 | Ga0373947_0021082 | 3300035725 | Bacteria | 3769 |
| 372 | Ga0373947_0079939 | 3300035725 | Bacteria | 2022 |
| 373 | Ga0373947_0147302 | 3300035725 | Bacteria | 1514 |
| 374 | Ga0373947_0222156 | 3300035725 | Unclassified | 1242 |
| 375 | Ga0373937_0005767 | 3300036401 | Bacteria | 10644 |
| 376 | Ga0373937_0017542 | 3300036401 | Bacteria | 6380 |
| 377 | Ga0373937_0074636 | 3300036401 | Bacteria | 3129 |
| 378 | Ga0373937_0091544 | 3300036401 | Bacteria | 2818 |
| 379 | Ga0373937_0165276 | 3300036401 | Bacteria | 2075 |
| 380 | Ga0373925_0002414 | 3300037068 | Bacteria | 14986 |
| 381 | Ga0373925_0010109 | 3300037068 | Bacteria | 6855 |
| 382 | Ga0373925_0028889 | 3300037068 | Bacteria | 4065 |
| 383 | Ga0373925_0116732 | 3300037068 | Bacteria | 2067 |
| 384 | Ga0436364_0043682 | 3300037853 | Bacteria | 4781 |
| 385 | Ga0436364_0075263 | 3300037853 | Bacteria | 2328 |
| 386 | Ga0436364_0510596 | 3300037853 | Bacteria | 1451 |
| 387 | Ga0436364_0886859 | 3300037853 | Bacteria | 20187 |
| 388 | Ga0436364_1245875 | 3300037853 | Bacteria | 5557 |
| 389 | Ga0436365_0281080 | 3300039437 | Bacteria | 15740 |
| 390 | Ga0436365_0534961 | 3300039437 | Bacteria | 3890 |
| 391 | Ga0436365_0634949 | 3300039437 | Bacteria | 4392 |
| 392 | Ga0436365_0642359 | 3300039437 | Bacteria | 3837 |
| 393 | Ga0436365_0787440 | 3300039437 | Bacteria | 2245 |
| 394 | Ga0436360_0003318 | 3300039438 | Bacteria | 1028 |
| 395 | Ga0436360_0141957 | 3300039438 | Bacteria | 1074 |
| 396 | Ga0436360_0627708 | 3300039438 | Bacteria | 1952 |
| 397 | Ga0436360_1105762 | 3300039438 | Bacteria | 1539 |
| 398 | Ga0436361_0017372 | 3300039447 | Bacteria | 5859 |
| 399 | Ga0436361_0193119 | 3300039447 | Bacteria | 1623 |
| 400 | Ga0436362_0556527 | 3300039453 | Bacteria | 2149 |
| 401 | Ga0436362_0718952 | 3300039453 | Bacteria | 2410 |
| 402 | Ga0436362_0881111 | 3300039453 | Bacteria | 1699 |
| 403 | Ga0436362_1245208 | 3300039453 | Bacteria | 2213 |
| 404 | Ga0436362_1294643 | 3300039453 | Bacteria | 1077 |
| 405 | Ga0466966_0047858 | 3300044684 | Bacteria | 2725 |
| 406 | Ga0466961_0200253 | 3300044693 | Bacteria | 1235 |
| 407 | Ga0466963_0101326 | 3300044694 | Bacteria | 1971 |
| 408 | Ga0466963_0388925 | 3300044694 | Bacteria | 983 |
| 409 | Ga0466957_0072254 | 3300044842 | Bacteria | 2135 |
| 410 | Ga0466959_0014641 | 3300045049 | Bacteria | 5706 |
| 411 | Ga0451576_0317321 | 3300045051 | Unclassified | 1631 |
| 412 | Ga0466958_0109428 | 3300045836 | Bacteria | 1724 |
| 413 | Ga0466967_0095636 | 3300045976 | Bacteria | 2708 |
| 414 | Ga0466967_0192925 | 3300045976 | Bacteria | 1926 |
| 415 | Ga0495592_0012135 | 3300046454 | Bacteria | 6538 |
| 416 | Ga0495592_0034140 | 3300046454 | Bacteria | 3835 |
| 417 | Ga0495592_0103422 | 3300046454 | Bacteria | 2026 |
| 418 | Ga0495603_0010593 | 3300046455 | Bacteria | 5586 |
| 419 | Ga0495603_0067645 | 3300046455 | Bacteria | 2102 |
| 420 | Ga0495590_0057668 | 3300046457 | Bacteria | 1358 |
| 421 | Ga0495629_0027369 | 3300046459 | Bacteria | 4047 |
| 422 | Ga0495629_0068543 | 3300046459 | Bacteria | 2476 |
| 423 | Ga0495629_0105303 | 3300046459 | Bacteria | 1967 |
| 424 | Ga0495629_0217994 | 3300046459 | Unclassified | 1317 |
| 425 | Ga0495638_0009313 | 3300046460 | Bacteria | 6903 |
| 426 | Ga0495641_0010583 | 3300046461 | Bacteria | 5327 |
| 427 | Ga0495651_0007302 | 3300046462 | Bacteria | 8449 |
| 428 | Ga0495651_0033242 | 3300046462 | Bacteria | 4023 |
| 429 | Ga0495651_0046027 | 3300046462 | Bacteria | 3378 |
| 430 | Ga0495653_0052056 | 3300046463 | Bacteria | 3140 |
| 431 | Ga0495653_0064367 | 3300046463 | Bacteria | 2763 |
| 432 | Ga0495653_0089703 | 3300046463 | Bacteria | 2252 |
| 433 | Ga0495653_0104006 | 3300046463 | Bacteria | 2052 |
| 434 | Ga0495653_0195142 | 3300046463 | Bacteria | 1378 |
| 435 | Ga0495580_0018920 | 3300046472 | Bacteria | 5124 |
| 436 | Ga0495580_0024257 | 3300046472 | Bacteria | 4444 |
| 437 | Ga0495580_0082379 | 3300046472 | Bacteria | 2242 |
| 438 | Ga0495582_0012893 | 3300046473 | Bacteria | 4605 |
| 439 | Ga0495639_0029020 | 3300046475 | Bacteria | 2454 |
| 440 | Ga0495639_0068423 | 3300046475 | Bacteria | 1637 |
| 441 | Ga0495662_0003675 | 3300046476 | Bacteria | 7734 |
| 442 | Ga0495662_0006819 | 3300046476 | Bacteria | 5682 |
| 443 | Ga0495662_0014553 | 3300046476 | Bacteria | 3825 |
| 444 | Ga0495662_0066293 | 3300046476 | Bacteria | 1746 |
| 445 | Ga0495664_0000959 | 3300046477 | Bacteria | 14810 |
| 446 | Ga0495664_0002260 | 3300046477 | Bacteria | 10317 |
| 447 | Ga0495664_0011371 | 3300046477 | Bacteria | 5017 |
| 448 | Ga0495664_0118166 | 3300046477 | Bacteria | 1603 |
| 449 | Ga0495584_0010207 | 3300046491 | Bacteria | 4823 |
| 450 | Ga0495584_0019599 | 3300046491 | Bacteria | 3436 |
| 451 | Ga0495584_0045760 | 3300046491 | Bacteria | 2207 |
| 452 | Ga0495585_0032795 | 3300046492 | Bacteria | 2941 |
| 453 | Ga0495594_0015238 | 3300046499 | Bacteria | 4038 |
| 454 | Ga0495607_0046310 | 3300046501 | Bacteria | 2555 |
| 455 | Ga0495608_0005826 | 3300046511 | Bacteria | 8777 |
| 456 | Ga0495608_0042818 | 3300046511 | Bacteria | 3027 |
| 457 | Ga0495608_0052624 | 3300046511 | Bacteria | 2695 |
| 458 | Ga0495608_0113703 | 3300046511 | Bacteria | 1739 |
| 459 | Ga0495618_0002051 | 3300046514 | Bacteria | 13237 |
| 460 | Ga0495618_0048487 | 3300046514 | Bacteria | 2681 |
| 461 | Ga0495618_0053716 | 3300046514 | Bacteria | 2547 |
| 462 | Ga0495618_0092656 | 3300046514 | Bacteria | 1932 |
| 463 | Ga0495618_0098854 | 3300046514 | Bacteria | 1867 |
| 464 | Ga0495628_0005312 | 3300046516 | Bacteria | 11303 |
| 465 | Ga0495628_0036834 | 3300046516 | Bacteria | 3924 |
| 466 | Ga0495628_0094735 | 3300046516 | Bacteria | 2307 |
| 467 | Ga0495628_0200468 | 3300046516 | Unclassified | 1504 |
| 468 | Ga0495630_0038183 | 3300046517 | Bacteria | 3592 |
| 469 | Ga0495630_0044480 | 3300046517 | Bacteria | 3318 |
| 470 | Ga0495630_0165190 | 3300046517 | Bacteria | 1685 |
| 471 | Ga0495666_0012458 | 3300046526 | Bacteria | 4238 |
| 472 | Ga0495666_0014911 | 3300046526 | Bacteria | 3868 |
| 473 | Ga0495642_0095646 | 3300046528 | Bacteria | 1260 |
| 474 | Ga0495652_0005594 | 3300046529 | Bacteria | 11799 |
| 475 | Ga0495652_0022506 | 3300046529 | Bacteria | 5593 |
| 476 | Ga0495652_0047146 | 3300046529 | Bacteria | 3696 |
| 477 | Ga0495652_0135282 | 3300046529 | Bacteria | 1945 |
| 478 | Ga0495665_0005874 | 3300046531 | Bacteria | 6615 |
| 479 | Ga0495665_0084294 | 3300046531 | Bacteria | 1670 |
| 480 | Ga0495640_0007932 | 3300046533 | Bacteria | 8348 |
| 481 | Ga0495640_0022861 | 3300046533 | Bacteria | 4565 |
| 482 | Ga0495640_0023762 | 3300046533 | Bacteria | 4460 |
| 483 | Ga0495640_0033467 | 3300046533 | Bacteria | 3649 |
| 484 | Ga0495640_0130544 | 3300046533 | Bacteria | 1626 |
| 485 | Ga0495640_0130775 | 3300046533 | Bacteria | 1625 |
| 486 | Ga0495640_0158976 | 3300046533 | Unclassified | 1449 |
| 487 | Ga0495586_0009074 | 3300046535 | Bacteria | 5290 |
| 488 | Ga0495586_0015460 | 3300046535 | Bacteria | 4060 |
| 489 | Ga0495586_0042139 | 3300046535 | Bacteria | 2459 |
| 490 | Ga0495587_0023570 | 3300046536 | Bacteria | 3782 |
| 491 | Ga0495598_0026592 | 3300046537 | Bacteria | 1588 |
| 492 | Ga0495645_0001619 | 3300046543 | Bacteria | 15237 |
| 493 | Ga0495645_0047035 | 3300046543 | Bacteria | 3144 |
| 494 | Ga0495645_0105489 | 3300046543 | Bacteria | 1999 |
| 495 | Ga0495645_0130473 | 3300046543 | Bacteria | 1762 |
| 496 | Ga0495645_0210678 | 3300046543 | Bacteria | 1312 |
| 497 | Ga0495622_0031552 | 3300046557 | Bacteria | 2476 |
| 498 | Ga0495667_0006860 | 3300046559 | Bacteria | 7731 |
| 499 | Ga0495667_0009135 | 3300046559 | Bacteria | 6731 |
| 500 | Ga0495667_0039716 | 3300046559 | Bacteria | 3128 |
| 501 | Ga0495667_0043732 | 3300046559 | Bacteria | 2967 |
| 502 | Ga0495634_0009583 | 3300046642 | Bacteria | 7137 |
| 503 | Ga0495634_0023770 | 3300046642 | Bacteria | 4305 |
| 504 | Ga0495634_0246008 | 3300046642 | Bacteria | 1095 |
| 505 | Ga0495635_0003347 | 3300046663 | Bacteria | 11080 |
| 506 | Ga0495635_0006683 | 3300046663 | Bacteria | 8057 |
| 507 | Ga0495635_0047122 | 3300046663 | Bacteria | 2974 |
| 508 | Ga0495635_0072599 | 3300046663 | Bacteria | 2357 |
| 509 | Ga0495635_0094348 | 3300046663 | Bacteria | 2046 |
| 510 | Ga0495635_0167339 | 3300046663 | Bacteria | 1495 |
| 511 | Ga0495659_0003234 | 3300046664 | Bacteria | 5220 |
| 512 | Ga0495659_0007612 | 3300046664 | Bacteria | 3433 |
| 513 | Ga0495659_0018418 | 3300046664 | Bacteria | 2326 |
| 514 | Ga0495588_0017207 | 3300046674 | Bacteria | 3506 |
| 515 | Ga0495657_0046789 | 3300046675 | Bacteria | 2927 |
| 516 | Ga0495599_0003169 | 3300046678 | Bacteria | 9578 |
| 517 | Ga0495623_0004051 | 3300046679 | Bacteria | 9648 |
| 518 | Ga0495623_0166777 | 3300046679 | Bacteria | 1290 |
| 519 | Ga0495646_0030081 | 3300046680 | Bacteria | 3392 |
| 520 | Ga0495646_0048267 | 3300046680 | Bacteria | 2587 |
| 521 | Ga0495646_0119096 | 3300046680 | Bacteria | 1495 |
| 522 | Ga0495647_0003780 | 3300046681 | Bacteria | 4871 |
| 523 | Ga0495647_0046530 | 3300046681 | Bacteria | 1671 |
| 524 | Ga0495658_0022254 | 3300046683 | Bacteria | 3349 |
| 525 | Ga0495658_0048722 | 3300046683 | Bacteria | 2390 |
| 526 | Ga0495669_0083771 | 3300046684 | Bacteria | 1466 |
| 527 | Ga0495613_0008689 | 3300046689 | Bacteria | 7532 |
| 528 | Ga0495613_0039460 | 3300046689 | Bacteria | 3501 |
| 529 | Ga0495613_0323786 | 3300046689 | Bacteria | 1063 |
| 530 | Ga0495624_0009872 | 3300046690 | Bacteria | 6602 |
| 531 | Ga0495624_0091596 | 3300046690 | Bacteria | 1875 |
| 532 | Ga0495624_0195461 | 3300046690 | Bacteria | 1229 |
| 533 | Ga0495670_0052458 | 3300046691 | Bacteria | 2042 |
| 534 | Ga0495671_0123816 | 3300046692 | Bacteria | 1261 |
| 535 | Ga0495600_0000464 | 3300046809 | Bacteria | 21076 |
| 536 | Ga0495600_0010301 | 3300046809 | Bacteria | 5800 |
| 537 | Ga0495600_0050315 | 3300046809 | Bacteria | 2719 |
| 538 | Ga0495600_0095554 | 3300046809 | Bacteria | 1938 |
| 539 | Ga0495600_0141967 | 3300046809 | Bacteria | 1558 |
| 540 | Ga0495581_0021361 | 3300047315 | Bacteria | 3753 |
| 541 | Ga0495581_0044753 | 3300047315 | Bacteria | 2559 |
| 542 | Ga0495604_0004562 | 3300047317 | Bacteria | 10974 |
| 543 | Ga0495604_0008733 | 3300047317 | Bacteria | 8009 |
| 544 | Ga0495604_0158914 | 3300047317 | Bacteria | 1598 |
| 545 | Ga0495636_0011501 | 3300047318 | Bacteria | 3502 |
| 546 | Ga0495674_0006423 | 3300047319 | Bacteria | 11271 |
| 547 | Ga0495674_0011078 | 3300047319 | Bacteria | 8513 |
| 548 | Ga0495674_0024220 | 3300047319 | Bacteria | 5581 |
| 549 | Ga0495674_0068120 | 3300047319 | Bacteria | 3081 |
| 550 | Ga0495674_0441322 | 3300047319 | Bacteria | 1047 |
| 551 | Ga0495676_0019355 | 3300047321 | Bacteria | 5988 |
| 552 | Ga0495676_0123944 | 3300047321 | Bacteria | 1875 |
| 553 | Ga0495680_0006696 | 3300047322 | Bacteria | 10666 |
| 554 | Ga0495680_0007490 | 3300047322 | Bacteria | 10000 |
| 555 | Ga0495680_0017094 | 3300047322 | Bacteria | 6206 |
| 556 | Ga0495680_0024923 | 3300047322 | Bacteria | 4954 |
| 557 | Ga0495680_0191104 | 3300047322 | Bacteria | 1473 |
| 558 | Ga0495680_0272499 | 3300047322 | Unclassified | 1195 |
| 559 | Ga0495675_0005984 | 3300047444 | Bacteria | 7437 |
| 560 | Ga0495675_0133131 | 3300047444 | Unclassified | 1545 |
| 561 | Ga0495679_045108 | 3300047446 | Bacteria | 1348 |
| 562 | Ga0495685_018054 | 3300047447 | Bacteria | 2419 |
| 563 | Ga0495685_067586 | 3300047447 | Bacteria | 1200 |
| 564 | Ga0495684_0001167 | 3300047471 | Bacteria | 21128 |
| 565 | Ga0495684_0006093 | 3300047471 | Bacteria | 9379 |
| 566 | Ga0495684_0137715 | 3300047471 | Bacteria | 1831 |
| 567 | Ga0495684_0294977 | 3300047471 | Unclassified | 1166 |
| 568 | Ga0495593_0034679 | 3300047673 | Bacteria | 2743 |
| 569 | Ga0495602_0011056 | 3300048088 | Bacteria | 9347 |
| 570 | Ga0495602_0078129 | 3300048088 | Bacteria | 2796 |
| 571 | Ga0495602_0095095 | 3300048088 | Bacteria | 2461 |
| 572 | Ga0496100_0006789 | 3300048903 | Bacteria | 6270 |
| 573 | Ga0496100_0060843 | 3300048903 | Bacteria | 2486 |
| 574 | Ga0496100_0095785 | 3300048903 | Bacteria | 2035 |
| 575 | Ga0496101_0004666 | 3300048904 | Bacteria | 8672 |
| 576 | Ga0496101_0005617 | 3300048904 | Bacteria | 7997 |
| 577 | Ga0496101_0027626 | 3300048904 | Bacteria | 3955 |
| 578 | Ga0496101_0452554 | 3300048904 | Bacteria | 1013 |
| 579 | Ga0496102_0005207 | 3300048905 | Bacteria | 11041 |
| 580 | Ga0496102_0021515 | 3300048905 | Bacteria | 5703 |
| 581 | Ga0496102_0037459 | 3300048905 | Unclassified | 4375 |
| 582 | Ga0496102_0069311 | 3300048905 | Bacteria | 3237 |
| 583 | Ga0496102_0543607 | 3300048905 | Bacteria | 1084 |
| 584 | Ga0496103_0005219 | 3300048906 | Bacteria | 7803 |
| 585 | Ga0496103_0017408 | 3300048906 | Bacteria | 4302 |
| 586 | Ga0496103_0026963 | 3300048906 | Bacteria | 3478 |
| 587 | Ga0496104_0000065 | 3300048907 | Bacteria | 108770 |
| 588 | Ga0496104_0035308 | 3300048907 | Bacteria | 4668 |
| 589 | Ga0496104_0097234 | 3300048907 | Bacteria | 2818 |
| 590 | Ga0496105_0000530 | 3300048908 | Bacteria | 25203 |
| 591 | Ga0496105_0013007 | 3300048908 | Bacteria | 6594 |
| 592 | Ga0496105_0121987 | 3300048908 | Bacteria | 2149 |
| 593 | Ga0496105_0142959 | 3300048908 | Bacteria | 1969 |
| 594 | Ga0496106_0004911 | 3300048909 | Bacteria | 9894 |
| 595 | Ga0496106_0045419 | 3300048909 | Bacteria | 3299 |
| 596 | Ga0496106_0059882 | 3300048909 | Bacteria | 2885 |
| 597 | Ga0496107_0003623 | 3300048910 | Bacteria | 10370 |
| 598 | Ga0496107_0137194 | 3300048910 | Bacteria | 1807 |
| 599 | Ga0496108_0006182 | 3300048911 | Bacteria | 9689 |
| 600 | Ga0496108_0276755 | 3300048911 | Bacteria | 1461 |
| 601 | Ga0496109_0006148 | 3300048912 | Bacteria | 10090 |
| 602 | Ga0496109_0063220 | 3300048912 | Unclassified | 3385 |
| 603 | Ga0496109_0090911 | 3300048912 | Bacteria | 2823 |
| 604 | Ga0496109_0160081 | 3300048912 | Bacteria | 2109 |
| 605 | Ga0496109_0607066 | 3300048912 | Bacteria | 1030 |
| 606 | Ga0496110_0141607 | 3300048913 | Unclassified | 2174 |
| 607 | Ga0496110_0242175 | 3300048913 | Bacteria | 1641 |
| 608 | Ga0496110_0316310 | 3300048913 | Bacteria | 1422 |
| 609 | Ga0496111_0050442 | 3300048914 | Unclassified | 3002 |
| 610 | Ga0496111_0319806 | 3300048914 | Bacteria | 1149 |
| 611 | Ga0496112_0063064 | 3300048915 | Bacteria | 3656 |
| 612 | Ga0496112_0081582 | 3300048915 | Plasmid | 3198 |
| 613 | Ga0496112_0312652 | 3300048915 | Bacteria | 1516 |
| 614 | Ga0496113_0012326 | 3300048916 | Bacteria | 5742 |
| 615 | Ga0496113_0027032 | 3300048916 | Bacteria | 4109 |
| 616 | Ga0496114_0013198 | 3300048917 | Bacteria | 6622 |
| 617 | Ga0496114_0108737 | 3300048917 | Bacteria | 2374 |
| 618 | Ga0496115_0009176 | 3300048918 | Bacteria | 7342 |
| 619 | Ga0496115_0047492 | 3300048918 | Bacteria | 3433 |
| 620 | Ga0496115_0054214 | 3300048918 | Bacteria | 3219 |
| 621 | Ga0496115_0137716 | 3300048918 | Bacteria | 2013 |
| 622 | Ga0496115_0140429 | 3300048918 | Unclassified | 1993 |
| 623 | Ga0496115_0200037 | 3300048918 | Bacteria | 1650 |
| 624 | Ga0496117_0000024 | 3300048920 | Bacteria | 418750 |
| 625 | Ga0496118_0000014 | 3300048921 | Bacteria | 561628 |
| 626 | Ga0496119_0038923 | 3300048922 | Bacteria | 3063 |
| 627 | Ga0496121_0115632 | 3300048924 | Bacteria | 2036 |
| 628 | Ga0496124_0010253 | 3300048927 | Bacteria | 9513 |
| 629 | Ga0496126_0007905 | 3300048929 | Bacteria | 11574 |
| 630 | Ga0496126_0162504 | 3300048929 | Bacteria | 1907 |
| 631 | Ga0501034_0012903 | 3300049571 | Bacteria | 8618 |
| 632 | Ga0501034_0120734 | 3300049571 | Bacteria | 2607 |
| 633 | Ga0501034_0139317 | 3300049571 | Bacteria | 2406 |
| 634 | Ga0501038_0073437 | 3300049574 | Bacteria | 2897 |
| 635 | Ga0501047_0122447 | 3300049581 | Bacteria | 2482 |
| 636 | Ga0501071_0034927 | 3300049587 | Bacteria | 3580 |
| 637 | Ga0501071_0054405 | 3300049587 | Bacteria | 2888 |
| 638 | Ga0501071_0311314 | 3300049587 | Unclassified | 1195 |
| 639 | Ga0501072_0003275 | 3300049588 | Bacteria | 12168 |
| 640 | Ga0501073_0123408 | 3300049589 | Bacteria | 1795 |
| 641 | Ga0501075_0020575 | 3300049591 | Bacteria | 4803 |
| 642 | Ga0501075_0314342 | 3300049591 | Bacteria | 1194 |
| 643 | Ga0501075_0381451 | 3300049591 | Bacteria | 1075 |
| 644 | Ga0501076_0030342 | 3300049592 | Bacteria | 4211 |
| 645 | Ga0501076_0044107 | 3300049592 | Bacteria | 3516 |
| 646 | Ga0501076_0103432 | 3300049592 | Unclassified | 2297 |
| 647 | Ga0501076_0268297 | 3300049592 | Bacteria | 1398 |
| 648 | Ga0501077_0097489 | 3300049593 | Bacteria | 1863 |
| 649 | Ga0501079_0281091 | 3300049741 | Bacteria | 1301 |
| 650 | Ga0501081_0052195 | 3300049743 | Bacteria | 2821 |
| 651 | Ga0501081_0326705 | 3300049743 | Bacteria | 1128 |
| 652 | Ga0501083_0106036 | 3300049744 | Bacteria | 1850 |
| 653 | nmdc:mga00v17_124093_c1 | 3300050491 | Bacteria | 1646 |
| 654 | nmdc:mga0yw44_19721_c1 | 3300050492 | Bacteria | 3725 |
| 655 | nmdc:mga0yw44_37073_c1 | 3300050492 | Bacteria | 2877 |
| 656 | nmdc:mga06z11_137253_c1 | 3300050494 | Bacteria | 1379 |
| 657 | nmdc:mga05p37_1643_c1 | 3300050507 | Bacteria | 25926 |
| 658 | nmdc:mga05p37_232221_c1 | 3300050507 | Bacteria | 2222 |
| 659 | nmdc:mga05p37_26039_c1 | 3300050507 | Bacteria | 7112 |
| 660 | nmdc:mga05p37_263698_c1 | 3300050507 | Bacteria | 2060 |
| 661 | nmdc:mga05p37_41974_c1 | 3300050507 | Bacteria | 4527 |
| 662 | nmdc:mga05p37_447443_c1 | 3300050507 | Bacteria | 1496 |
| 663 | nmdc:mga05p37_65277_c1 | 3300050507 | Bacteria | 4479 |
| 664 | nmdc:mga09592_348162_c1 | 3300050508 | Bacteria | 1282 |
| 665 | nmdc:mga09592_36096_c1 | 3300050508 | Bacteria | 4140 |
| 666 | nmdc:mga06r32_44199_c1 | 3300050510 | Bacteria | 4241 |
| 667 | nmdc:mga08y16_12539_c1 | 3300050511 | Bacteria | 8919 |
| 668 | nmdc:mga08y16_371085_c1 | 3300050511 | Bacteria | 1468 |
| 669 | nmdc:mga0n895_104882_c1 | 3300050512 | Bacteria | 2839 |
| 670 | nmdc:mga0n895_19417_c1 | 3300050512 | Bacteria | 6317 |
| 671 | nmdc:mga0n895_55209_c1 | 3300050512 | Bacteria | 3909 |
| 672 | nmdc:mga0n895_7304_c1 | 3300050512 | Bacteria | 9470 |
| 673 | nmdc:mga0rr50_412421_c1 | 3300050513 | Bacteria | 1142 |
| 674 | nmdc:mga0rr50_54668_c1 | 3300050513 | Bacteria | 2976 |
| 675 | nmdc:mga08x19_8440_c1 | 3300050514 | Bacteria | 6136 |
| 676 | nmdc:mga08x19_85522_c1 | 3300050514 | Bacteria | 2075 |
| 677 | nmdc:mga0a205_303384_c1 | 3300050515 | Bacteria | 1469 |
| 678 | Ga0495601_0000111 | 3300053077 | Bacteria | 44773 |
| 679 | Ga0495601_0000806 | 3300053077 | Bacteria | 16954 |
| 680 | Ga0495601_0001346 | 3300053077 | Bacteria | 13508 |
| 681 | Ga0495601_0002531 | 3300053077 | Bacteria | 10393 |
| 682 | Ga0495601_0004372 | 3300053077 | Bacteria | 8162 |
| 683 | Ga0495601_0021158 | 3300053077 | Bacteria | 3981 |
| 684 | Ga0495601_0081704 | 3300053077 | Bacteria | 2074 |
| 685 | Ga0495601_0152001 | 3300053077 | Bacteria | 1511 |
| 686 | Ga0495612_0000700 | 3300053078 | Bacteria | 13567 |
| 687 | Ga0495612_0001026 | 3300053078 | Bacteria | 11463 |
| 688 | Ga0495612_0003065 | 3300053078 | Bacteria | 6929 |
| 689 | Ga0495612_0010383 | 3300053078 | Bacteria | 3767 |
| 690 | Ga0495612_0032068 | 3300053078 | Bacteria | 2121 |
| 691 | Ga0495595_0000447 | 3300053084 | Bacteria | 15654 |
| 692 | Ga0495595_0018267 | 3300053084 | Bacteria | 3029 |
| 693 | Ga0495595_0021337 | 3300053084 | Bacteria | 2829 |
| 694 | Ga0495595_0048168 | 3300053084 | Bacteria | 1967 |
| 695 | Ga0495595_0085033 | 3300053084 | Bacteria | 1512 |
| 696 | Ga0495619_0000307 | 3300053085 | Bacteria | 34556 |
| 697 | Ga0495619_0000681 | 3300053085 | Bacteria | 22230 |
| 698 | Ga0495619_0001436 | 3300053085 | Bacteria | 15660 |
| 699 | Ga0495619_0002791 | 3300053085 | Bacteria | 11400 |
| 700 | Ga0495619_0018616 | 3300053085 | Bacteria | 4407 |
| 701 | Ga0495619_0024455 | 3300053085 | Bacteria | 3874 |
| 702 | Ga0495619_0096468 | 3300053085 | Bacteria | 2008 |
| 703 | Ga0500566_0018006 | 3300053094 | Bacteria | 4148 |
| 704 | Ga0500593_001418 | 3300053117 | Bacteria | 8624 |
| 705 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 706 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 707 | Ga0500616_0045318 | 3300053153 | Bacteria | 2343 |
| 708 | Ga0500645_000291 | 3300053730 | Bacteria | 35819 |
| 709 | Ga0501084_0401764 | 3300054114 | Bacteria | 1158 |
| 710 | Ga0501082_0012546 | 3300060353 | Bacteria | 7281 |
| 711 | Ga0501082_0082080 | 3300060353 | Bacteria | 2781 |
| 712 | Ga0501082_0117266 | 3300060353 | Unclassified | 2306 |
| 713 | Ga0501082_0248574 | 3300060353 | Bacteria | 1548 |
| 714 | Ga0501082_0485672 | 3300060353 | Bacteria | 1080 |
| 715 | Ga0466962_0181377 | 3300061719 | Bacteria | 1026 |
| 716 | Ga0530510_0100967 | 3300061734 | Bacteria | 2110 |
| 717 | Ga0530510_0200319 | 3300061734 | Bacteria | 1482 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0242175 | Ga0496110_0242175_15_998 | 275 |
| 2 | 3300035170 | Ga0373943_0029721 | Ga0373943_0029721_866_1903 | 285 |
| 3 | 3300035692 | Ga0373935_0036486 | Ga0373935_0036486_402_1466 | 285 |
| 4 | 3300035695 | Ga0373927_0043471 | Ga0373927_0043471_10_1023 | 285 |
| 5 | 3300035725 | Ga0373947_0021082 | Ga0373947_0021082_802_1866 | 285 |
| 6 | 3300046459 | Ga0495629_0105303 | Ga0495629_0105303_439_1503 | 285 |
| 7 | 3300046463 | Ga0495653_0052056 | Ga0495653_0052056_444_1508 | 285 |
| 8 | 3300046476 | Ga0495662_0003675 | Ga0495662_0003675_1133_2197 | 285 |
| 9 | 3300046477 | Ga0495664_0000959 | Ga0495664_0000959_4745_5809 | 285 |
| 10 | 3300046514 | Ga0495618_0002051 | Ga0495618_0002051_3875_4939 | 285 |
| 11 | 3300046529 | Ga0495652_0047146 | Ga0495652_0047146_828_1892 | 285 |
| 12 | 3300046533 | Ga0495640_0033467 | Ga0495640_0033467_712_1776 | 285 |
| 13 | 3300046535 | Ga0495586_0009074 | Ga0495586_0009074_4173_5237 | 285 |
| 14 | 3300046543 | Ga0495645_0047035 | Ga0495645_0047035_1474_2538 | 285 |
| 15 | 3300046642 | Ga0495634_0009583 | Ga0495634_0009583_2170_3234 | 285 |
| 16 | 3300046663 | Ga0495635_0003347 | Ga0495635_0003347_7775_8839 | 285 |
| 17 | 3300046680 | Ga0495646_0119096 | Ga0495646_0119096_29_1093 | 285 |
| 18 | 3300046690 | Ga0495624_0091596 | Ga0495624_0091596_679_1743 | 285 |
| 19 | 3300046809 | Ga0495600_0050315 | Ga0495600_0050315_465_1529 | 285 |
| 20 | 3300047319 | Ga0495674_0006423 | Ga0495674_0006423_7600_8664 | 285 |
| 21 | 3300047322 | Ga0495680_0191104 | Ga0495680_0191104_287_1351 | 285 |
| 22 | 3300047471 | Ga0495684_0006093 | Ga0495684_0006093_529_1593 | 285 |
| 23 | 3300053077 | Ga0495601_0004372 | Ga0495601_0004372_2608_3672 | 285 |
| 24 | 3300053078 | Ga0495612_0000700 | Ga0495612_0000700_1672_2736 | 285 |
| 25 | 3300053085 | Ga0495619_0000681 | Ga0495619_0000681_14266_15330 | 285 |
| 26 | 3300035111 | Ga0373923_0020432 | Ga0373923_0020432_1207_2271 | 287 |
| 27 | 3300005436 | Ga0070713_100033716 | Ga0070713_1000337164 | 291 |
| 28 | 3300005439 | Ga0070711_100036195 | Ga0070711_1000361954 | 291 |
| 29 | 3300006844 | Ga0075428_100294626 | Ga0075428_1002946262 | 291 |
| 30 | 3300009094 | Ga0111539_10476150 | Ga0111539_104761501 | 291 |
| 31 | 3300025915 | Ga0207693_10072887 | Ga0207693_100728872 | 291 |
| 32 | 3300025928 | Ga0207700_10083576 | Ga0207700_100835763 | 291 |
| 33 | 3300025939 | Ga0207665_10117286 | Ga0207665_101172862 | 291 |
| 34 | 3300046691 | Ga0495670_0052458 | Ga0495670_0052458_434_1360 | 292 |
| 35 | 3300047446 | Ga0495679_045108 | Ga0495679_045108_232_1158 | 292 |
| 36 | 3300010159 | Ga0099796_10017613 | Ga0099796_100176132 | 293 |
| 37 | 3300025928 | Ga0207700_10364418 | Ga0207700_103644182 | 294 |
| 38 | 3300035171 | Ga0373946_0189506 | Ga0373946_0189506_67_969 | 294 |
| 39 | 3300048912 | Ga0496109_0607066 | Ga0496109_0607066_16_921 | 294 |
| 40 | 3300027512 | Ga0209179_1029408 | Ga0209179_10294081 | 296 |
| 41 | iso_pu_bacteria | 2643221547 | 2643756841 | 297 |
| 42 | iso_pu_bacteria | 3005409236 | 3005409746 | 297 |
| 43 | 3300005458 | Ga0070681_10302655 | Ga0070681_103026551 | 298 |
| 44 | iso_pu_bacteria | 2828305725 | 2828309155 | 298 |
| 45 | 3300028800 | Ga0265338_10092514 | Ga0265338_100925142 | 299 |
| 46 | 3300031711 | Ga0265314_10059681 | Ga0265314_100596812 | 299 |
| 47 | 3300039447 | Ga0436361_0193119 | Ga0436361_0193119_210_1109 | 299 |
| 48 | iso_pu_bacteria | 2643221672 | 2644401316 | 299 |
| 49 | iso_pu_bacteria | 2842747753 | 2842751589 | 299 |
| 50 | iso_pu_bacteria | 2900634093 | 2900642661 | 299 |
| 51 | 3300005434 | Ga0070709_10019395 | Ga0070709_100193952 | 300 |
| 52 | 3300035111 | Ga0373923_0016515 | Ga0373923_0016515_878_1780 | 300 |
| 53 | 3300035170 | Ga0373943_0010322 | Ga0373943_0010322_2621_3523 | 300 |
| 54 | 3300035171 | Ga0373946_0004320 | Ga0373946_0004320_3838_4740 | 300 |
| 55 | 3300035410 | Ga0373924_0053351 | Ga0373924_0053351_720_1622 | 300 |
| 56 | 3300035692 | Ga0373935_0008860 | Ga0373935_0008860_2101_3003 | 300 |
| 57 | 3300035695 | Ga0373927_0017140 | Ga0373927_0017140_2854_3756 | 300 |
| 58 | 3300035725 | Ga0373947_0010245 | Ga0373947_0010245_3966_4868 | 300 |
| 59 | 3300037068 | Ga0373925_0028889 | Ga0373925_0028889_342_1244 | 300 |
| 60 | 3300046455 | Ga0495603_0010593 | Ga0495603_0010593_1150_2052 | 300 |
| 61 | 3300046461 | Ga0495641_0010583 | Ga0495641_0010583_248_1150 | 300 |
| 62 | 3300046463 | Ga0495653_0064367 | Ga0495653_0064367_188_1090 | 300 |
| 63 | 3300046472 | Ga0495580_0024257 | Ga0495580_0024257_973_1875 | 300 |
| 64 | 3300046473 | Ga0495582_0012893 | Ga0495582_0012893_2818_3720 | 300 |
| 65 | 3300046476 | Ga0495662_0014553 | Ga0495662_0014553_349_1251 | 300 |
| 66 | 3300046477 | Ga0495664_0011371 | Ga0495664_0011371_1161_2063 | 300 |
| 67 | 3300046499 | Ga0495594_0015238 | Ga0495594_0015238_316_1218 | 300 |
| 68 | 3300046514 | Ga0495618_0048487 | Ga0495618_0048487_349_1251 | 300 |
| 69 | 3300046517 | Ga0495630_0038183 | Ga0495630_0038183_74_976 | 300 |
| 70 | 3300046526 | Ga0495666_0014911 | Ga0495666_0014911_2341_3243 | 300 |
| 71 | 3300046529 | Ga0495652_0022506 | Ga0495652_0022506_2744_3646 | 300 |
| 72 | 3300046531 | Ga0495665_0005874 | Ga0495665_0005874_1681_2583 | 300 |
| 73 | 3300046533 | Ga0495640_0022861 | Ga0495640_0022861_3315_4217 | 300 |
| 74 | 3300046535 | Ga0495586_0042139 | Ga0495586_0042139_885_1787 | 300 |
| 75 | 3300046543 | Ga0495645_0130473 | Ga0495645_0130473_620_1522 | 300 |
| 76 | 3300046559 | Ga0495667_0039716 | Ga0495667_0039716_1077_1979 | 300 |
| 77 | 3300046642 | Ga0495634_0023770 | Ga0495634_0023770_3020_3922 | 300 |
| 78 | 3300046680 | Ga0495646_0048267 | Ga0495646_0048267_1485_2387 | 300 |
| 79 | 3300046681 | Ga0495647_0003780 | Ga0495647_0003780_880_1782 | 300 |
| 80 | 3300046683 | Ga0495658_0022254 | Ga0495658_0022254_2403_3305 | 300 |
| 81 | 3300046689 | Ga0495613_0008689 | Ga0495613_0008689_21_923 | 300 |
| 82 | 3300047315 | Ga0495581_0021361 | Ga0495581_0021361_2506_3408 | 300 |
| 83 | 3300047319 | Ga0495674_0024220 | Ga0495674_0024220_2343_3245 | 300 |
| 84 | 3300047321 | Ga0495676_0019355 | Ga0495676_0019355_2790_3692 | 300 |
| 85 | 3300047322 | Ga0495680_0017094 | Ga0495680_0017094_3874_4776 | 300 |
| 86 | 3300047471 | Ga0495684_0137715 | Ga0495684_0137715_264_1166 | 300 |
| 87 | 3300049592 | Ga0501076_0044107 | Ga0501076_0044107_889_1812 | 300 |
| 88 | 3300053077 | Ga0495601_0021158 | Ga0495601_0021158_2740_3642 | 300 |
| 89 | 3300053084 | Ga0495595_0021337 | Ga0495595_0021337_1152_2054 | 300 |
| 90 | 3300053085 | Ga0495619_0018616 | Ga0495619_0018616_2678_3580 | 300 |
| 91 | 3300053094 | Ga0500566_0018006 | Ga0500566_0018006_1800_2702 | 300 |
| 92 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_828523_829425 | 300 |
| 93 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1509004_1509906 | 300 |
| 94 | 3300053153 | Ga0500616_0045318 | Ga0500616_0045318_133_1035 | 300 |
| 95 | 3300053730 | Ga0500645_000291 | Ga0500645_000291_26249_27151 | 300 |
| 96 | 3300054114 | Ga0501084_0401764 | Ga0501084_0401764_108_1031 | 300 |
| 97 | 3300001915 | JGI24741J21665_1016012 | JGI24741J21665_10160122 | 301 |
| 98 | 3300001976 | JGI24752J21851_1007905 | JGI24752J21851_10079052 | 301 |
| 99 | 3300001977 | JGI24746J21847_1000301 | JGI24746J21847_10003012 | 301 |
| 100 | 3300001978 | JGI24747J21853_1002506 | JGI24747J21853_10025062 | 301 |
| 101 | 3300002073 | JGI24745J21846_1003175 | JGI24745J21846_10031752 | 301 |
| 102 | 3300002075 | JGI24738J21930_10016245 | JGI24738J21930_100162452 | 301 |
| 103 | 3300002239 | JGI24034J26672_10002166 | JGI24034J26672_100021663 | 301 |
| 104 | 3300002244 | JGI24742J22300_10004840 | JGI24742J22300_100048402 | 301 |
| 105 | 3300004798 | Ga0058859_11802100 | Ga0058859_118021002 | 301 |
| 106 | 3300005293 | Ga0065715_10119142 | Ga0065715_101191422 | 301 |
| 107 | 3300005295 | Ga0065707_10082650 | Ga0065707_100826505 | 301 |
| 108 | 3300005328 | Ga0070676_10005715 | Ga0070676_100057151 | 301 |
| 109 | 3300005329 | Ga0070683_100001578 | Ga0070683_10000157813 | 301 |
| 110 | 3300005330 | Ga0070690_100063540 | Ga0070690_1000635402 | 301 |
| 111 | 3300005335 | Ga0070666_10037539 | Ga0070666_100375392 | 301 |
| 112 | 3300005336 | Ga0070680_100014147 | Ga0070680_1000141473 | 301 |
| 113 | 3300005336 | Ga0070680_100036470 | Ga0070680_1000364703 | 301 |
| 114 | 3300005336 | Ga0070680_100210102 | Ga0070680_1002101022 | 301 |
| 115 | 3300005336 | Ga0070680_100312712 | Ga0070680_1003127122 | 301 |
| 116 | 3300005337 | Ga0070682_100006267 | Ga0070682_1000062679 | 301 |
| 117 | 3300005338 | Ga0068868_100003154 | Ga0068868_10000315411 | 301 |
| 118 | 3300005339 | Ga0070660_100053034 | Ga0070660_1000530342 | 301 |
| 119 | 3300005340 | Ga0070689_100002987 | Ga0070689_1000029878 | 301 |
| 120 | 3300005341 | Ga0070691_10046178 | Ga0070691_100461782 | 301 |
| 121 | 3300005343 | Ga0070687_100002357 | Ga0070687_1000023578 | 301 |
| 122 | 3300005344 | Ga0070661_100004564 | Ga0070661_1000045644 | 301 |
| 123 | 3300005345 | Ga0070692_10003415 | Ga0070692_100034151 | 301 |
| 124 | 3300005347 | Ga0070668_100011260 | Ga0070668_1000112601 | 301 |
| 125 | 3300005353 | Ga0070669_100014076 | Ga0070669_1000140761 | 301 |
| 126 | 3300005354 | Ga0070675_100141682 | Ga0070675_1001416821 | 301 |
| 127 | 3300005355 | Ga0070671_100038743 | Ga0070671_1000387434 | 301 |
| 128 | 3300005356 | Ga0070674_100004148 | Ga0070674_1000041487 | 301 |
| 129 | 3300005365 | Ga0070688_100008074 | Ga0070688_1000080741 | 301 |
| 130 | 3300005434 | Ga0070709_10079206 | Ga0070709_100792062 | 301 |
| 131 | 3300005435 | Ga0070714_100009461 | Ga0070714_1000094617 | 301 |
| 132 | 3300005435 | Ga0070714_100164535 | Ga0070714_1001645352 | 301 |
| 133 | 3300005435 | Ga0070714_100358363 | Ga0070714_1003583631 | 301 |
| 134 | 3300005436 | Ga0070713_100039319 | Ga0070713_1000393192 | 301 |
| 135 | 3300005436 | Ga0070713_100040285 | Ga0070713_1000402853 | 301 |
| 136 | 3300005436 | Ga0070713_100488542 | Ga0070713_1004885421 | 301 |
| 137 | 3300005437 | Ga0070710_10006151 | Ga0070710_100061512 | 301 |
| 138 | 3300005437 | Ga0070710_10075675 | Ga0070710_100756752 | 301 |
| 139 | 3300005437 | Ga0070710_10108696 | Ga0070710_101086962 | 301 |
| 140 | 3300005438 | Ga0070701_10000656 | Ga0070701_100006567 | 301 |
| 141 | 3300005439 | Ga0070711_100048091 | Ga0070711_1000480912 | 301 |
| 142 | 3300005440 | Ga0070705_100433827 | Ga0070705_1004338271 | 301 |
| 143 | 3300005444 | Ga0070694_100231608 | Ga0070694_1002316082 | 301 |
| 144 | 3300005445 | Ga0070708_100128849 | Ga0070708_1001288493 | 301 |
| 145 | 3300005445 | Ga0070708_100168880 | Ga0070708_1001688802 | 301 |
| 146 | 3300005455 | Ga0070663_100010818 | Ga0070663_1000108181 | 301 |
| 147 | 3300005455 | Ga0070663_100375651 | Ga0070663_1003756511 | 301 |
| 148 | 3300005456 | Ga0070678_100010317 | Ga0070678_1000103171 | 301 |
| 149 | 3300005456 | Ga0070678_100377794 | Ga0070678_1003777942 | 301 |
| 150 | 3300005456 | Ga0070678_100435626 | Ga0070678_1004356261 | 301 |
| 151 | 3300005457 | Ga0070662_100029865 | Ga0070662_1000298653 | 301 |
| 152 | 3300005457 | Ga0070662_100087405 | Ga0070662_1000874052 | 301 |
| 153 | 3300005458 | Ga0070681_10006391 | Ga0070681_100063915 | 301 |
| 154 | 3300005458 | Ga0070681_10007202 | Ga0070681_100072025 | 301 |
| 155 | 3300005458 | Ga0070681_10038375 | Ga0070681_100383752 | 301 |
| 156 | 3300005458 | Ga0070681_10041787 | Ga0070681_100417873 | 301 |
| 157 | 3300005459 | Ga0068867_100007228 | Ga0068867_10000722811 | 301 |
| 158 | 3300005466 | Ga0070685_10001672 | Ga0070685_100016727 | 301 |
| 159 | 3300005467 | Ga0070706_100006024 | Ga0070706_10000602413 | 301 |
| 160 | 3300005468 | Ga0070707_100217166 | Ga0070707_1002171662 | 301 |
| 161 | 3300005468 | Ga0070707_100425846 | Ga0070707_1004258462 | 301 |
| 162 | 3300005471 | Ga0070698_100000549 | Ga0070698_10000054921 | 301 |
| 163 | 3300005471 | Ga0070698_100005315 | Ga0070698_1000053153 | 301 |
| 164 | 3300005471 | Ga0070698_100023653 | Ga0070698_1000236533 | 301 |
| 165 | 3300005518 | Ga0070699_100005284 | Ga0070699_10000528410 | 301 |
| 166 | 3300005518 | Ga0070699_100201415 | Ga0070699_1002014152 | 301 |
| 167 | 3300005518 | Ga0070699_100610114 | Ga0070699_1006101141 | 301 |
| 168 | 3300005530 | Ga0070679_100001104 | Ga0070679_1000011049 | 301 |
| 169 | 3300005530 | Ga0070679_100026366 | Ga0070679_1000263661 | 301 |
| 170 | 3300005530 | Ga0070679_100061318 | Ga0070679_1000613186 | 301 |
| 171 | 3300005535 | Ga0070684_100018816 | Ga0070684_1000188161 | 301 |
| 172 | 3300005536 | Ga0070697_100168027 | Ga0070697_1001680273 | 301 |
| 173 | 3300005543 | Ga0070672_100070423 | Ga0070672_1000704232 | 301 |
| 174 | 3300005543 | Ga0070672_100511339 | Ga0070672_1005113391 | 301 |
| 175 | 3300005545 | Ga0070695_100004843 | Ga0070695_1000048433 | 301 |
| 176 | 3300005545 | Ga0070695_100036667 | Ga0070695_1000366673 | 301 |
| 177 | 3300005546 | Ga0070696_100011714 | Ga0070696_1000117142 | 301 |
| 178 | 3300005546 | Ga0070696_100029786 | Ga0070696_1000297862 | 301 |
| 179 | 3300005546 | Ga0070696_100099229 | Ga0070696_1000992291 | 301 |
| 180 | 3300005547 | Ga0070693_100008306 | Ga0070693_1000083063 | 301 |
| 181 | 3300005547 | Ga0070693_100045480 | Ga0070693_1000454804 | 301 |
| 182 | 3300005549 | Ga0070704_100010246 | Ga0070704_1000102461 | 301 |
| 183 | 3300005549 | Ga0070704_100015795 | Ga0070704_1000157953 | 301 |
| 184 | 3300005563 | Ga0068855_100042947 | Ga0068855_1000429474 | 301 |
| 185 | 3300005564 | Ga0070664_100008431 | Ga0070664_1000084313 | 301 |
| 186 | 3300005564 | Ga0070664_100123951 | Ga0070664_1001239512 | 301 |
| 187 | 3300005577 | Ga0068857_100000358 | Ga0068857_10000035830 | 301 |
| 188 | 3300005578 | Ga0068854_100005944 | Ga0068854_1000059449 | 301 |
| 189 | 3300005614 | Ga0068856_100133704 | Ga0068856_1001337042 | 301 |
| 190 | 3300005615 | Ga0070702_100002690 | Ga0070702_1000026902 | 301 |
| 191 | 3300005615 | Ga0070702_100060302 | Ga0070702_1000603021 | 301 |
| 192 | 3300005616 | Ga0068852_100006913 | Ga0068852_1000069134 | 301 |
| 193 | 3300005616 | Ga0068852_100557160 | Ga0068852_1005571601 | 301 |
| 194 | 3300005617 | Ga0068859_100009678 | Ga0068859_1000096781 | 301 |
| 195 | 3300005618 | Ga0068864_100002272 | Ga0068864_1000022728 | 301 |
| 196 | 3300005718 | Ga0068866_10000358 | Ga0068866_1000035814 | 301 |
| 197 | 3300005840 | Ga0068870_10000025 | Ga0068870_1000002541 | 301 |
| 198 | 3300005841 | Ga0068863_100018070 | Ga0068863_1000180702 | 301 |
| 199 | 3300005842 | Ga0068858_100007959 | Ga0068858_1000079594 | 301 |
| 200 | 3300005842 | Ga0068858_100055290 | Ga0068858_1000552903 | 301 |
| 201 | 3300005842 | Ga0068858_100055381 | Ga0068858_1000553813 | 301 |
| 202 | 3300005843 | Ga0068860_100008914 | Ga0068860_1000089148 | 301 |
| 203 | 3300005843 | Ga0068860_100265278 | Ga0068860_1002652782 | 301 |
| 204 | 3300005844 | Ga0068862_100019145 | Ga0068862_1000191451 | 301 |
| 205 | 3300005937 | Ga0081455_10030414 | Ga0081455_100304145 | 301 |
| 206 | 3300005937 | Ga0081455_10062371 | Ga0081455_100623712 | 301 |
| 207 | 3300005981 | Ga0081538_10035222 | Ga0081538_100352223 | 301 |
| 208 | 3300005983 | Ga0081540_1000038 | Ga0081540_100003882 | 301 |
| 209 | 3300005983 | Ga0081540_1014076 | Ga0081540_10140765 | 301 |
| 210 | 3300005985 | Ga0081539_10018128 | Ga0081539_100181282 | 301 |
| 211 | 3300006028 | Ga0070717_10064905 | Ga0070717_100649053 | 301 |
| 212 | 3300006038 | Ga0075365_10031838 | Ga0075365_100318383 | 301 |
| 213 | 3300006038 | Ga0075365_10047058 | Ga0075365_100470582 | 301 |
| 214 | 3300006163 | Ga0070715_10000933 | Ga0070715_100009339 | 301 |
| 215 | 3300006163 | Ga0070715_10048925 | Ga0070715_100489252 | 301 |
| 216 | 3300006177 | Ga0075362_10023720 | Ga0075362_100237203 | 301 |
| 217 | 3300006178 | Ga0075367_10115850 | Ga0075367_101158502 | 301 |
| 218 | 3300006358 | Ga0068871_100002009 | Ga0068871_1000020098 | 301 |
| 219 | 3300006358 | Ga0068871_100005001 | Ga0068871_10000500110 | 301 |
| 220 | 3300006844 | Ga0075428_100004974 | Ga0075428_10000497412 | 301 |
| 221 | 3300006844 | Ga0075428_100182136 | Ga0075428_1001821362 | 301 |
| 222 | 3300006846 | Ga0075430_100034845 | Ga0075430_1000348453 | 301 |
| 223 | 3300006847 | Ga0075431_100070049 | Ga0075431_1000700493 | 301 |
| 224 | 3300006852 | Ga0075433_10317121 | Ga0075433_103171212 | 301 |
| 225 | 3300006871 | Ga0075434_100034134 | Ga0075434_1000341344 | 301 |
| 226 | 3300006871 | Ga0075434_100156525 | Ga0075434_1001565252 | 301 |
| 227 | 3300006871 | Ga0075434_100214377 | Ga0075434_1002143772 | 301 |
| 228 | 3300006871 | Ga0075434_100262183 | Ga0075434_1002621831 | 301 |
| 229 | 3300006880 | Ga0075429_100089118 | Ga0075429_1000891183 | 301 |
| 230 | 3300006880 | Ga0075429_100127863 | Ga0075429_1001278632 | 301 |
| 231 | 3300006881 | Ga0068865_100322860 | Ga0068865_1003228601 | 301 |
| 232 | 3300006931 | Ga0097620_100009681 | Ga0097620_1000096811 | 301 |
| 233 | 3300007076 | Ga0075435_100015827 | Ga0075435_1000158273 | 301 |
| 234 | 3300007076 | Ga0075435_100047682 | Ga0075435_1000476823 | 301 |
| 235 | 3300007265 | Ga0099794_10015673 | Ga0099794_100156734 | 301 |
| 236 | 3300009036 | Ga0105244_10097084 | Ga0105244_100970841 | 301 |
| 237 | 3300009092 | Ga0105250_10041125 | Ga0105250_100411252 | 301 |
| 238 | 3300009093 | Ga0105240_10070146 | Ga0105240_100701464 | 301 |
| 239 | 3300009094 | Ga0111539_10028243 | Ga0111539_1002824310 | 301 |
| 240 | 3300009094 | Ga0111539_10098897 | Ga0111539_100988972 | 301 |
| 241 | 3300009098 | Ga0105245_10030201 | Ga0105245_100302016 | 301 |
| 242 | 3300009098 | Ga0105245_10534173 | Ga0105245_105341731 | 301 |
| 243 | 3300009101 | Ga0105247_10020813 | Ga0105247_100208133 | 301 |
| 244 | 3300009147 | Ga0114129_10076945 | Ga0114129_100769452 | 301 |
| 245 | 3300009147 | Ga0114129_10078797 | Ga0114129_100787975 | 301 |
| 246 | 3300009148 | Ga0105243_10011552 | Ga0105243_100115524 | 301 |
| 247 | 3300009148 | Ga0105243_10057438 | Ga0105243_100574382 | 301 |
| 248 | 3300009174 | Ga0105241_10003634 | Ga0105241_100036342 | 301 |
| 249 | 3300009176 | Ga0105242_10056242 | Ga0105242_100562422 | 301 |
| 250 | 3300009176 | Ga0105242_10119232 | Ga0105242_101192322 | 301 |
| 251 | 3300009545 | Ga0105237_10016489 | Ga0105237_100164893 | 301 |
| 252 | 3300009545 | Ga0105237_10180294 | Ga0105237_101802942 | 301 |
| 253 | 3300009553 | Ga0105249_10022058 | Ga0105249_100220588 | 301 |
| 254 | 3300009553 | Ga0105249_10050755 | Ga0105249_100507552 | 301 |
| 255 | 3300010375 | Ga0105239_10188965 | Ga0105239_101889652 | 301 |
| 256 | 3300011119 | Ga0105246_10071004 | Ga0105246_100710044 | 301 |
| 257 | 3300013100 | Ga0157373_10136941 | Ga0157373_101369412 | 301 |
| 258 | 3300013104 | Ga0157370_10046630 | Ga0157370_100466303 | 301 |
| 259 | 3300013104 | Ga0157370_10062445 | Ga0157370_100624452 | 301 |
| 260 | 3300013297 | Ga0157378_10011414 | Ga0157378_100114143 | 301 |
| 261 | 3300013306 | Ga0163162_10167354 | Ga0163162_101673543 | 301 |
| 262 | 3300013306 | Ga0163162_10167770 | Ga0163162_101677704 | 301 |
| 263 | 3300013306 | Ga0163162_10481309 | Ga0163162_104813092 | 301 |
| 264 | 3300013307 | Ga0157372_10030789 | Ga0157372_100307892 | 301 |
| 265 | 3300013307 | Ga0157372_10083535 | Ga0157372_100835352 | 301 |
| 266 | 3300013308 | Ga0157375_10023326 | Ga0157375_100233261 | 301 |
| 267 | 3300013308 | Ga0157375_10525459 | Ga0157375_105254592 | 301 |
| 268 | 3300013308 | Ga0157375_10662276 | Ga0157375_106622762 | 301 |
| 269 | 3300014325 | Ga0163163_10013913 | Ga0163163_100139132 | 301 |
| 270 | 3300014325 | Ga0163163_10399489 | Ga0163163_103994892 | 301 |
| 271 | 3300014326 | Ga0157380_10236524 | Ga0157380_102365242 | 301 |
| 272 | 3300014745 | Ga0157377_10108000 | Ga0157377_101080002 | 301 |
| 273 | 3300014968 | Ga0157379_10056306 | Ga0157379_100563062 | 301 |
| 274 | 3300014968 | Ga0157379_10065106 | Ga0157379_100651063 | 301 |
| 275 | 3300014968 | Ga0157379_10294091 | Ga0157379_102940911 | 301 |
| 276 | 3300014969 | Ga0157376_10143494 | Ga0157376_101434943 | 301 |
| 277 | 3300017792 | Ga0163161_10112856 | Ga0163161_101128562 | 301 |
| 278 | 3300021384 | Ga0213876_10071428 | Ga0213876_100714282 | 301 |
| 279 | 3300021384 | Ga0213876_10078342 | Ga0213876_100783422 | 301 |
| 280 | 3300021388 | Ga0213875_10000116 | Ga0213875_1000011665 | 301 |
| 281 | 3300025271 | Ga0207666_1000252 | Ga0207666_100025211 | 301 |
| 282 | 3300025893 | Ga0207682_10000607 | Ga0207682_1000060711 | 301 |
| 283 | 3300025898 | Ga0207692_10019860 | Ga0207692_100198602 | 301 |
| 284 | 3300025898 | Ga0207692_10147747 | Ga0207692_101477472 | 301 |
| 285 | 3300025905 | Ga0207685_10012768 | Ga0207685_100127682 | 301 |
| 286 | 3300025905 | Ga0207685_10090399 | Ga0207685_100903992 | 301 |
| 287 | 3300025905 | Ga0207685_10106290 | Ga0207685_101062901 | 301 |
| 288 | 3300025908 | Ga0207643_10000397 | Ga0207643_1000039721 | 301 |
| 289 | 3300025910 | Ga0207684_10005624 | Ga0207684_100056243 | 301 |
| 290 | 3300025912 | Ga0207707_10002788 | Ga0207707_100027882 | 301 |
| 291 | 3300025913 | Ga0207695_10077085 | Ga0207695_100770854 | 301 |
| 292 | 3300025915 | Ga0207693_10001021 | Ga0207693_100010211 | 301 |
| 293 | 3300025915 | Ga0207693_10004915 | Ga0207693_1000491512 | 301 |
| 294 | 3300025915 | Ga0207693_10050585 | Ga0207693_100505854 | 301 |
| 295 | 3300025915 | Ga0207693_10087581 | Ga0207693_100875811 | 301 |
| 296 | 3300025915 | Ga0207693_10243292 | Ga0207693_102432921 | 301 |
| 297 | 3300025916 | Ga0207663_10029253 | Ga0207663_100292533 | 301 |
| 298 | 3300025916 | Ga0207663_10041700 | Ga0207663_100417002 | 301 |
| 299 | 3300025916 | Ga0207663_10053074 | Ga0207663_100530742 | 301 |
| 300 | 3300025916 | Ga0207663_10090505 | Ga0207663_100905052 | 301 |
| 301 | 3300025917 | Ga0207660_10105034 | Ga0207660_101050341 | 301 |
| 302 | 3300025917 | Ga0207660_10134951 | Ga0207660_101349512 | 301 |
| 303 | 3300025918 | Ga0207662_10038596 | Ga0207662_100385963 | 301 |
| 304 | 3300025920 | Ga0207649_10001199 | Ga0207649_1000119910 | 301 |
| 305 | 3300025921 | Ga0207652_10001750 | Ga0207652_1000175012 | 301 |
| 306 | 3300025921 | Ga0207652_10002218 | Ga0207652_100022189 | 301 |
| 307 | 3300025921 | Ga0207652_10021390 | Ga0207652_100213902 | 301 |
| 308 | 3300025923 | Ga0207681_10002243 | Ga0207681_100022432 | 301 |
| 309 | 3300025923 | Ga0207681_10002492 | Ga0207681_1000249216 | 301 |
| 310 | 3300025923 | Ga0207681_10132362 | Ga0207681_101323621 | 301 |
| 311 | 3300025925 | Ga0207650_10005388 | Ga0207650_100053888 | 301 |
| 312 | 3300025926 | Ga0207659_10000923 | Ga0207659_1000092311 | 301 |
| 313 | 3300025927 | Ga0207687_10005521 | Ga0207687_100055213 | 301 |
| 314 | 3300025927 | Ga0207687_10143912 | Ga0207687_101439122 | 301 |
| 315 | 3300025928 | Ga0207700_10025030 | Ga0207700_100250302 | 301 |
| 316 | 3300025928 | Ga0207700_10028263 | Ga0207700_100282634 | 301 |
| 317 | 3300025928 | Ga0207700_10176206 | Ga0207700_101762062 | 301 |
| 318 | 3300025929 | Ga0207664_10138137 | Ga0207664_101381371 | 301 |
| 319 | 3300025931 | Ga0207644_10000439 | Ga0207644_1000043928 | 301 |
| 320 | 3300025931 | Ga0207644_10040018 | Ga0207644_100400182 | 301 |
| 321 | 3300025932 | Ga0207690_10003249 | Ga0207690_100032491 | 301 |
| 322 | 3300025932 | Ga0207690_10030533 | Ga0207690_100305333 | 301 |
| 323 | 3300025932 | Ga0207690_10163835 | Ga0207690_101638352 | 301 |
| 324 | 3300025933 | Ga0207706_10016044 | Ga0207706_100160444 | 301 |
| 325 | 3300025934 | Ga0207686_10002903 | Ga0207686_1000290310 | 301 |
| 326 | 3300025934 | Ga0207686_10027193 | Ga0207686_100271934 | 301 |
| 327 | 3300025935 | Ga0207709_10001261 | Ga0207709_1000126114 | 301 |
| 328 | 3300025936 | Ga0207670_10008671 | Ga0207670_100086714 | 301 |
| 329 | 3300025937 | Ga0207669_10000616 | Ga0207669_1000061610 | 301 |
| 330 | 3300025937 | Ga0207669_10049627 | Ga0207669_100496272 | 301 |
| 331 | 3300025938 | Ga0207704_10009900 | Ga0207704_100099003 | 301 |
| 332 | 3300025939 | Ga0207665_10025929 | Ga0207665_100259293 | 301 |
| 333 | 3300025940 | Ga0207691_10106580 | Ga0207691_101065802 | 301 |
| 334 | 3300025940 | Ga0207691_10229119 | Ga0207691_102291191 | 301 |
| 335 | 3300025941 | Ga0207711_10166791 | Ga0207711_101667912 | 301 |
| 336 | 3300025944 | Ga0207661_10008182 | Ga0207661_100081823 | 301 |
| 337 | 3300025945 | Ga0207679_10000624 | Ga0207679_100006244 | 301 |
| 338 | 3300025945 | Ga0207679_10002602 | Ga0207679_1000260213 | 301 |
| 339 | 3300025945 | Ga0207679_10070676 | Ga0207679_100706763 | 301 |
| 340 | 3300025945 | Ga0207679_10144205 | Ga0207679_101442052 | 301 |
| 341 | 3300025960 | Ga0207651_10192564 | Ga0207651_101925642 | 301 |
| 342 | 3300025961 | Ga0207712_10021901 | Ga0207712_100219012 | 301 |
| 343 | 3300025972 | Ga0207668_10007113 | Ga0207668_100071131 | 301 |
| 344 | 3300025972 | Ga0207668_10474778 | Ga0207668_104747781 | 301 |
| 345 | 3300025981 | Ga0207640_10004625 | Ga0207640_100046259 | 301 |
| 346 | 3300025986 | Ga0207658_10022934 | Ga0207658_100229342 | 301 |
| 347 | 3300026023 | Ga0207677_10001740 | Ga0207677_100017409 | 301 |
| 348 | 3300026035 | Ga0207703_10004099 | Ga0207703_1000409911 | 301 |
| 349 | 3300026041 | Ga0207639_10106772 | Ga0207639_101067722 | 301 |
| 350 | 3300026075 | Ga0207708_10200306 | Ga0207708_102003062 | 301 |
| 351 | 3300026078 | Ga0207702_10074432 | Ga0207702_100744322 | 301 |
| 352 | 3300026088 | Ga0207641_10012663 | Ga0207641_100126635 | 301 |
| 353 | 3300026095 | Ga0207676_10003096 | Ga0207676_100030963 | 301 |
| 354 | 3300026116 | Ga0207674_10001342 | Ga0207674_1000134228 | 301 |
| 355 | 3300026118 | Ga0207675_100539688 | Ga0207675_1005396881 | 301 |
| 356 | 3300026121 | Ga0207683_10037184 | Ga0207683_100371842 | 301 |
| 357 | 3300026142 | Ga0207698_10024262 | Ga0207698_100242624 | 301 |
| 358 | 3300026142 | Ga0207698_10523414 | Ga0207698_105234141 | 301 |
| 359 | 3300027907 | Ga0207428_10005539 | Ga0207428_1000553914 | 301 |
| 360 | 3300028379 | Ga0268266_10254039 | Ga0268266_102540392 | 301 |
| 361 | 3300028380 | Ga0268265_10023842 | Ga0268265_100238423 | 301 |
| 362 | 3300028381 | Ga0268264_10030329 | Ga0268264_100303292 | 301 |
| 363 | 3300028381 | Ga0268264_10166773 | Ga0268264_101667732 | 301 |
| 364 | 3300028556 | Ga0265337_1000392 | Ga0265337_10003928 | 301 |
| 365 | 3300028556 | Ga0265337_1000720 | Ga0265337_10007207 | 301 |
| 366 | 3300028573 | Ga0265334_10001597 | Ga0265334_100015976 | 301 |
| 367 | 3300028800 | Ga0265338_10009296 | Ga0265338_100092965 | 301 |
| 368 | 3300028800 | Ga0265338_10012307 | Ga0265338_100123076 | 301 |
| 369 | 3300031235 | Ga0265330_10003304 | Ga0265330_100033046 | 301 |
| 370 | 3300031238 | Ga0265332_10001684 | Ga0265332_1000168411 | 301 |
| 371 | 3300031241 | Ga0265325_10000030 | Ga0265325_10000030110 | 301 |
| 372 | 3300031241 | Ga0265325_10007651 | Ga0265325_100076514 | 301 |
| 373 | 3300031241 | Ga0265325_10010445 | Ga0265325_100104451 | 301 |
| 374 | 3300031241 | Ga0265325_10100121 | Ga0265325_101001211 | 301 |
| 375 | 3300031242 | Ga0265329_10004865 | Ga0265329_100048654 | 301 |
| 376 | 3300031247 | Ga0265340_10010922 | Ga0265340_100109223 | 301 |
| 377 | 3300031247 | Ga0265340_10022391 | Ga0265340_100223914 | 301 |
| 378 | 3300031249 | Ga0265339_10014749 | Ga0265339_100147494 | 301 |
| 379 | 3300031249 | Ga0265339_10033522 | Ga0265339_100335222 | 301 |
| 380 | 3300031249 | Ga0265339_10034146 | Ga0265339_100341462 | 301 |
| 381 | 3300031250 | Ga0265331_10010420 | Ga0265331_100104204 | 301 |
| 382 | 3300031344 | Ga0265316_10034358 | Ga0265316_100343585 | 301 |
| 383 | 3300031344 | Ga0265316_10092760 | Ga0265316_100927602 | 301 |
| 384 | 3300031344 | Ga0265316_10239069 | Ga0265316_102390691 | 301 |
| 385 | 3300031548 | Ga0307408_100000406 | Ga0307408_10000040619 | 301 |
| 386 | 3300031595 | Ga0265313_10006079 | Ga0265313_100060795 | 301 |
| 387 | 3300031595 | Ga0265313_10009247 | Ga0265313_100092476 | 301 |
| 388 | 3300031595 | Ga0265313_10018585 | Ga0265313_100185852 | 301 |
| 389 | 3300031595 | Ga0265313_10127312 | Ga0265313_101273121 | 301 |
| 390 | 3300031595 | Ga0265313_10140348 | Ga0265313_101403481 | 301 |
| 391 | 3300031711 | Ga0265314_10050143 | Ga0265314_100501433 | 301 |
| 392 | 3300031712 | Ga0265342_10001892 | Ga0265342_1000189219 | 301 |
| 393 | 3300031712 | Ga0265342_10007645 | Ga0265342_100076457 | 301 |
| 394 | 3300031712 | Ga0265342_10015998 | Ga0265342_100159984 | 301 |
| 395 | 3300031911 | Ga0307412_10000207 | Ga0307412_1000020724 | 301 |
| 396 | 3300032005 | Ga0307411_10000086 | Ga0307411_1000008628 | 301 |
| 397 | 3300034816 | Ga0373930_0010544 | Ga0373930_0010544_680_1585 | 301 |
| 398 | 3300034819 | Ga0373958_0002820 | Ga0373958_0002820_202_1107 | 301 |
| 399 | 3300035084 | Ga0373928_0004182 | Ga0373928_0004182_1117_2022 | 301 |
| 400 | 3300035086 | Ga0373934_0014474 | Ga0373934_0014474_1213_2136 | 301 |
| 401 | 3300035089 | Ga0373944_0003655 | Ga0373944_0003655_2578_3696 | 301 |
| 402 | 3300035089 | Ga0373944_0026075 | Ga0373944_0026075_692_1597 | 301 |
| 403 | 3300035090 | Ga0373949_0001922 | Ga0373949_0001922_2962_3867 | 301 |
| 404 | 3300035092 | Ga0373952_0002747 | Ga0373952_0002747_707_1612 | 301 |
| 405 | 3300035111 | Ga0373923_0092203 | Ga0373923_0092203_95_1000 | 301 |
| 406 | 3300035112 | Ga0373932_0070550 | Ga0373932_0070550_116_1021 | 301 |
| 407 | 3300035113 | Ga0373936_0009931 | Ga0373936_0009931_1880_2998 | 301 |
| 408 | 3300035113 | Ga0373936_0067196 | Ga0373936_0067196_120_1025 | 301 |
| 409 | 3300035115 | Ga0373941_0004877 | Ga0373941_0004877_190_1095 | 301 |
| 410 | 3300035116 | Ga0373945_0007252 | Ga0373945_0007252_1786_2904 | 301 |
| 411 | 3300035117 | Ga0373953_0022038 | Ga0373953_0022038_848_1771 | 301 |
| 412 | 3300035117 | Ga0373953_0032731 | Ga0373953_0032731_525_1430 | 301 |
| 413 | 3300035119 | Ga0373956_0005163 | Ga0373956_0005163_3146_4138 | 301 |
| 414 | 3300035119 | Ga0373956_0030239 | Ga0373956_0030239_292_1215 | 301 |
| 415 | 3300035119 | Ga0373956_0033078 | Ga0373956_0033078_996_1919 | 301 |
| 416 | 3300035120 | Ga0373957_0019480 | Ga0373957_0019480_28_951 | 301 |
| 417 | 3300035121 | Ga0373960_0002981 | Ga0373960_0002981_1628_2533 | 301 |
| 418 | 3300035170 | Ga0373943_0000467 | Ga0373943_0000467_11640_12758 | 301 |
| 419 | 3300035170 | Ga0373943_0059214 | Ga0373943_0059214_517_1422 | 301 |
| 420 | 3300035170 | Ga0373943_0150925 | Ga0373943_0150925_217_1143 | 301 |
| 421 | 3300035171 | Ga0373946_0000643 | Ga0373946_0000643_5631_6749 | 301 |
| 422 | 3300035172 | Ga0373955_0003642 | Ga0373955_0003642_5710_6633 | 301 |
| 423 | 3300035172 | Ga0373955_0019547 | Ga0373955_0019547_2067_2990 | 301 |
| 424 | 3300035172 | Ga0373955_0255867 | Ga0373955_0255867_41_964 | 301 |
| 425 | 3300035241 | Ga0373961_0001004 | Ga0373961_0001004_2837_3742 | 301 |
| 426 | 3300035242 | Ga0373962_0000894 | Ga0373962_0000894_1333_2238 | 301 |
| 427 | 3300035410 | Ga0373924_0011363 | Ga0373924_0011363_473_1396 | 301 |
| 428 | 3300035410 | Ga0373924_0013011 | Ga0373924_0013011_896_1801 | 301 |
| 429 | 3300035691 | Ga0373931_0001241 | Ga0373931_0001241_9567_10472 | 301 |
| 430 | 3300035691 | Ga0373931_0228569 | Ga0373931_0228569_44_949 | 301 |
| 431 | 3300035692 | Ga0373935_0008851 | Ga0373935_0008851_1353_2471 | 301 |
| 432 | 3300035692 | Ga0373935_0024495 | Ga0373935_0024495_1756_2661 | 301 |
| 433 | 3300035692 | Ga0373935_0025807 | Ga0373935_0025807_1192_2115 | 301 |
| 434 | 3300035692 | Ga0373935_0286332 | Ga0373935_0286332_33_956 | 301 |
| 435 | 3300035692 | Ga0373935_0379097 | Ga0373935_0379097_17_940 | 301 |
| 436 | 3300035695 | Ga0373927_0002618 | Ga0373927_0002618_11046_12164 | 301 |
| 437 | 3300035695 | Ga0373927_0020010 | Ga0373927_0020010_3084_3998 | 301 |
| 438 | 3300035695 | Ga0373927_0094989 | Ga0373927_0094989_803_1708 | 301 |
| 439 | 3300035695 | Ga0373927_0278626 | Ga0373927_0278626_152_1075 | 301 |
| 440 | 3300035724 | Ga0373933_0002265 | Ga0373933_0002265_5827_6750 | 301 |
| 441 | 3300035725 | Ga0373947_0079939 | Ga0373947_0079939_467_1393 | 301 |
| 442 | 3300035725 | Ga0373947_0147302 | Ga0373947_0147302_294_1199 | 301 |
| 443 | 3300035725 | Ga0373947_0222156 | Ga0373947_0222156_96_1019 | 301 |
| 444 | 3300036401 | Ga0373937_0005767 | Ga0373937_0005767_5527_6450 | 301 |
| 445 | 3300036401 | Ga0373937_0017542 | Ga0373937_0017542_3678_4601 | 301 |
| 446 | 3300036401 | Ga0373937_0074636 | Ga0373937_0074636_1070_1975 | 301 |
| 447 | 3300036401 | Ga0373937_0091544 | Ga0373937_0091544_1594_2511 | 301 |
| 448 | 3300036401 | Ga0373937_0165276 | Ga0373937_0165276_732_1655 | 301 |
| 449 | 3300037068 | Ga0373925_0002414 | Ga0373925_0002414_2508_3626 | 301 |
| 450 | 3300037068 | Ga0373925_0010109 | Ga0373925_0010109_5843_6766 | 301 |
| 451 | 3300037068 | Ga0373925_0116732 | Ga0373925_0116732_294_1199 | 301 |
| 452 | 3300037853 | Ga0436364_0043682 | Ga0436364_0043682_3447_4370 | 301 |
| 453 | 3300037853 | Ga0436364_0075263 | Ga0436364_0075263_524_1450 | 301 |
| 454 | 3300037853 | Ga0436364_0510596 | Ga0436364_0510596_135_1055 | 301 |
| 455 | 3300037853 | Ga0436364_0886859 | Ga0436364_0886859_3533_4450 | 301 |
| 456 | 3300037853 | Ga0436364_1245875 | Ga0436364_1245875_2192_3112 | 301 |
| 457 | 3300039437 | Ga0436365_0281080 | Ga0436365_0281080_2360_3307 | 301 |
| 458 | 3300039437 | Ga0436365_0534961 | Ga0436365_0534961_2712_3644 | 301 |
| 459 | 3300039437 | Ga0436365_0634949 | Ga0436365_0634949_253_1170 | 301 |
| 460 | 3300039437 | Ga0436365_0642359 | Ga0436365_0642359_2243_3169 | 301 |
| 461 | 3300039437 | Ga0436365_0787440 | Ga0436365_0787440_686_1615 | 301 |
| 462 | 3300039438 | Ga0436360_0003318 | Ga0436360_0003318_65_991 | 301 |
| 463 | 3300039438 | Ga0436360_0141957 | Ga0436360_0141957_51_968 | 301 |
| 464 | 3300039438 | Ga0436360_0627708 | Ga0436360_0627708_911_1834 | 301 |
| 465 | 3300039438 | Ga0436360_1105762 | Ga0436360_1105762_265_1188 | 301 |
| 466 | 3300039447 | Ga0436361_0017372 | Ga0436361_0017372_4724_5650 | 301 |
| 467 | 3300039453 | Ga0436362_0556527 | Ga0436362_0556527_33_959 | 301 |
| 468 | 3300039453 | Ga0436362_0718952 | Ga0436362_0718952_1395_2321 | 301 |
| 469 | 3300039453 | Ga0436362_0881111 | Ga0436362_0881111_15_938 | 301 |
| 470 | 3300039453 | Ga0436362_1245208 | Ga0436362_1245208_587_1534 | 301 |
| 471 | 3300039453 | Ga0436362_1294643 | Ga0436362_1294643_24_941 | 301 |
| 472 | 3300044684 | Ga0466966_0047858 | Ga0466966_0047858_204_1115 | 301 |
| 473 | 3300044693 | Ga0466961_0200253 | Ga0466961_0200253_282_1193 | 301 |
| 474 | 3300044694 | Ga0466963_0101326 | Ga0466963_0101326_724_1635 | 301 |
| 475 | 3300044694 | Ga0466963_0388925 | Ga0466963_0388925_12_926 | 301 |
| 476 | 3300044842 | Ga0466957_0072254 | Ga0466957_0072254_10_921 | 301 |
| 477 | 3300045049 | Ga0466959_0014641 | Ga0466959_0014641_728_1639 | 301 |
| 478 | 3300045051 | Ga0451576_0317321 | Ga0451576_0317321_44_991 | 301 |
| 479 | 3300045836 | Ga0466958_0109428 | Ga0466958_0109428_333_1244 | 301 |
| 480 | 3300045976 | Ga0466967_0095636 | Ga0466967_0095636_1464_2378 | 301 |
| 481 | 3300045976 | Ga0466967_0192925 | Ga0466967_0192925_546_1472 | 301 |
| 482 | 3300046454 | Ga0495592_0012135 | Ga0495592_0012135_1072_1995 | 301 |
| 483 | 3300046454 | Ga0495592_0034140 | Ga0495592_0034140_1582_2487 | 301 |
| 484 | 3300046454 | Ga0495592_0103422 | Ga0495592_0103422_679_1596 | 301 |
| 485 | 3300046455 | Ga0495603_0067645 | Ga0495603_0067645_840_1745 | 301 |
| 486 | 3300046457 | Ga0495590_0057668 | Ga0495590_0057668_289_1215 | 301 |
| 487 | 3300046459 | Ga0495629_0027369 | Ga0495629_0027369_2368_3273 | 301 |
| 488 | 3300046459 | Ga0495629_0068543 | Ga0495629_0068543_1029_1949 | 301 |
| 489 | 3300046459 | Ga0495629_0217994 | Ga0495629_0217994_115_1038 | 301 |
| 490 | 3300046460 | Ga0495638_0009313 | Ga0495638_0009313_1262_2185 | 301 |
| 491 | 3300046462 | Ga0495651_0007302 | Ga0495651_0007302_6318_7241 | 301 |
| 492 | 3300046462 | Ga0495651_0033242 | Ga0495651_0033242_2967_3872 | 301 |
| 493 | 3300046462 | Ga0495651_0046027 | Ga0495651_0046027_439_1362 | 301 |
| 494 | 3300046463 | Ga0495653_0089703 | Ga0495653_0089703_428_1345 | 301 |
| 495 | 3300046463 | Ga0495653_0104006 | Ga0495653_0104006_1059_1964 | 301 |
| 496 | 3300046463 | Ga0495653_0195142 | Ga0495653_0195142_211_1134 | 301 |
| 497 | 3300046472 | Ga0495580_0018920 | Ga0495580_0018920_2746_3864 | 301 |
| 498 | 3300046472 | Ga0495580_0082379 | Ga0495580_0082379_1012_1917 | 301 |
| 499 | 3300046475 | Ga0495639_0029020 | Ga0495639_0029020_1306_2424 | 301 |
| 500 | 3300046475 | Ga0495639_0068423 | Ga0495639_0068423_337_1242 | 301 |
| 501 | 3300046476 | Ga0495662_0006819 | Ga0495662_0006819_4065_5183 | 301 |
| 502 | 3300046476 | Ga0495662_0066293 | Ga0495662_0066293_128_1033 | 301 |
| 503 | 3300046477 | Ga0495664_0002260 | Ga0495664_0002260_468_1460 | 301 |
| 504 | 3300046477 | Ga0495664_0118166 | Ga0495664_0118166_205_1128 | 301 |
| 505 | 3300046491 | Ga0495584_0010207 | Ga0495584_0010207_1091_2014 | 301 |
| 506 | 3300046491 | Ga0495584_0019599 | Ga0495584_0019599_2229_3155 | 301 |
| 507 | 3300046491 | Ga0495584_0045760 | Ga0495584_0045760_1255_2175 | 301 |
| 508 | 3300046492 | Ga0495585_0032795 | Ga0495585_0032795_762_1688 | 301 |
| 509 | 3300046501 | Ga0495607_0046310 | Ga0495607_0046310_293_1219 | 301 |
| 510 | 3300046511 | Ga0495608_0005826 | Ga0495608_0005826_4341_5246 | 301 |
| 511 | 3300046511 | Ga0495608_0042818 | Ga0495608_0042818_329_1252 | 301 |
| 512 | 3300046511 | Ga0495608_0052624 | Ga0495608_0052624_261_1178 | 301 |
| 513 | 3300046511 | Ga0495608_0113703 | Ga0495608_0113703_750_1673 | 301 |
| 514 | 3300046514 | Ga0495618_0053716 | Ga0495618_0053716_774_1679 | 301 |
| 515 | 3300046514 | Ga0495618_0092656 | Ga0495618_0092656_821_1738 | 301 |
| 516 | 3300046514 | Ga0495618_0098854 | Ga0495618_0098854_64_1182 | 301 |
| 517 | 3300046516 | Ga0495628_0005312 | Ga0495628_0005312_4823_5746 | 301 |
| 518 | 3300046516 | Ga0495628_0036834 | Ga0495628_0036834_2901_3824 | 301 |
| 519 | 3300046516 | Ga0495628_0094735 | Ga0495628_0094735_1255_2160 | 301 |
| 520 | 3300046516 | Ga0495628_0200468 | Ga0495628_0200468_560_1486 | 301 |
| 521 | 3300046517 | Ga0495630_0044480 | Ga0495630_0044480_1726_2844 | 301 |
| 522 | 3300046517 | Ga0495630_0165190 | Ga0495630_0165190_241_1146 | 301 |
| 523 | 3300046526 | Ga0495666_0012458 | Ga0495666_0012458_704_1822 | 301 |
| 524 | 3300046528 | Ga0495642_0095646 | Ga0495642_0095646_194_1117 | 301 |
| 525 | 3300046529 | Ga0495652_0005594 | Ga0495652_0005594_10426_11349 | 301 |
| 526 | 3300046529 | Ga0495652_0135282 | Ga0495652_0135282_582_1487 | 301 |
| 527 | 3300046531 | Ga0495665_0084294 | Ga0495665_0084294_454_1359 | 301 |
| 528 | 3300046533 | Ga0495640_0007932 | Ga0495640_0007932_7264_8169 | 301 |
| 529 | 3300046533 | Ga0495640_0023762 | Ga0495640_0023762_1552_2481 | 301 |
| 530 | 3300046533 | Ga0495640_0130544 | Ga0495640_0130544_434_1339 | 301 |
| 531 | 3300046533 | Ga0495640_0130775 | Ga0495640_0130775_267_1190 | 301 |
| 532 | 3300046533 | Ga0495640_0158976 | Ga0495640_0158976_469_1395 | 301 |
| 533 | 3300046535 | Ga0495586_0015460 | Ga0495586_0015460_3106_4026 | 301 |
| 534 | 3300046536 | Ga0495587_0023570 | Ga0495587_0023570_1072_1995 | 301 |
| 535 | 3300046537 | Ga0495598_0026592 | Ga0495598_0026592_367_1290 | 301 |
| 536 | 3300046543 | Ga0495645_0001619 | Ga0495645_0001619_4375_5298 | 301 |
| 537 | 3300046543 | Ga0495645_0105489 | Ga0495645_0105489_111_1103 | 301 |
| 538 | 3300046543 | Ga0495645_0210678 | Ga0495645_0210678_264_1169 | 301 |
| 539 | 3300046557 | Ga0495622_0031552 | Ga0495622_0031552_288_1193 | 301 |
| 540 | 3300046559 | Ga0495667_0006860 | Ga0495667_0006860_1659_2582 | 301 |
| 541 | 3300046559 | Ga0495667_0009135 | Ga0495667_0009135_1540_2463 | 301 |
| 542 | 3300046559 | Ga0495667_0043732 | Ga0495667_0043732_896_1801 | 301 |
| 543 | 3300046642 | Ga0495634_0246008 | Ga0495634_0246008_69_974 | 301 |
| 544 | 3300046663 | Ga0495635_0006683 | Ga0495635_0006683_1356_2261 | 301 |
| 545 | 3300046663 | Ga0495635_0047122 | Ga0495635_0047122_110_1033 | 301 |
| 546 | 3300046663 | Ga0495635_0072599 | Ga0495635_0072599_939_1844 | 301 |
| 547 | 3300046663 | Ga0495635_0094348 | Ga0495635_0094348_626_1549 | 301 |
| 548 | 3300046663 | Ga0495635_0167339 | Ga0495635_0167339_277_1200 | 301 |
| 549 | 3300046664 | Ga0495659_0003234 | Ga0495659_0003234_4141_5064 | 301 |
| 550 | 3300046664 | Ga0495659_0007612 | Ga0495659_0007612_44_967 | 301 |
| 551 | 3300046664 | Ga0495659_0018418 | Ga0495659_0018418_787_1710 | 301 |
| 552 | 3300046674 | Ga0495588_0017207 | Ga0495588_0017207_1678_2583 | 301 |
| 553 | 3300046675 | Ga0495657_0046789 | Ga0495657_0046789_272_1195 | 301 |
| 554 | 3300046678 | Ga0495599_0003169 | Ga0495599_0003169_3170_4093 | 301 |
| 555 | 3300046679 | Ga0495623_0004051 | Ga0495623_0004051_6093_7016 | 301 |
| 556 | 3300046679 | Ga0495623_0166777 | Ga0495623_0166777_36_941 | 301 |
| 557 | 3300046680 | Ga0495646_0030081 | Ga0495646_0030081_733_1638 | 301 |
| 558 | 3300046681 | Ga0495647_0046530 | Ga0495647_0046530_129_1034 | 301 |
| 559 | 3300046683 | Ga0495658_0048722 | Ga0495658_0048722_865_1770 | 301 |
| 560 | 3300046684 | Ga0495669_0083771 | Ga0495669_0083771_186_1091 | 301 |
| 561 | 3300046689 | Ga0495613_0039460 | Ga0495613_0039460_2109_3227 | 301 |
| 562 | 3300046689 | Ga0495613_0323786 | Ga0495613_0323786_90_995 | 301 |
| 563 | 3300046690 | Ga0495624_0009872 | Ga0495624_0009872_4084_5202 | 301 |
| 564 | 3300046690 | Ga0495624_0195461 | Ga0495624_0195461_158_1063 | 301 |
| 565 | 3300046692 | Ga0495671_0123816 | Ga0495671_0123816_158_1084 | 301 |
| 566 | 3300046809 | Ga0495600_0000464 | Ga0495600_0000464_4565_5488 | 301 |
| 567 | 3300046809 | Ga0495600_0010301 | Ga0495600_0010301_481_1386 | 301 |
| 568 | 3300046809 | Ga0495600_0095554 | Ga0495600_0095554_602_1525 | 301 |
| 569 | 3300046809 | Ga0495600_0141967 | Ga0495600_0141967_309_1226 | 301 |
| 570 | 3300047315 | Ga0495581_0044753 | Ga0495581_0044753_995_1918 | 301 |
| 571 | 3300047317 | Ga0495604_0004562 | Ga0495604_0004562_3687_4610 | 301 |
| 572 | 3300047317 | Ga0495604_0008733 | Ga0495604_0008733_1522_2445 | 301 |
| 573 | 3300047317 | Ga0495604_0158914 | Ga0495604_0158914_118_1023 | 301 |
| 574 | 3300047318 | Ga0495636_0011501 | Ga0495636_0011501_1257_2180 | 301 |
| 575 | 3300047319 | Ga0495674_0011078 | Ga0495674_0011078_7520_8425 | 301 |
| 576 | 3300047319 | Ga0495674_0068120 | Ga0495674_0068120_1070_1993 | 301 |
| 577 | 3300047319 | Ga0495674_0441322 | Ga0495674_0441322_67_990 | 301 |
| 578 | 3300047321 | Ga0495676_0123944 | Ga0495676_0123944_796_1701 | 301 |
| 579 | 3300047322 | Ga0495680_0006696 | Ga0495680_0006696_262_1167 | 301 |
| 580 | 3300047322 | Ga0495680_0007490 | Ga0495680_0007490_8025_8948 | 301 |
| 581 | 3300047322 | Ga0495680_0024923 | Ga0495680_0024923_1689_2606 | 301 |
| 582 | 3300047322 | Ga0495680_0272499 | Ga0495680_0272499_138_1061 | 301 |
| 583 | 3300047444 | Ga0495675_0005984 | Ga0495675_0005984_198_1103 | 301 |
| 584 | 3300047444 | Ga0495675_0133131 | Ga0495675_0133131_214_1149 | 301 |
| 585 | 3300047447 | Ga0495685_018054 | Ga0495685_018054_514_1437 | 301 |
| 586 | 3300047447 | Ga0495685_067586 | Ga0495685_067586_206_1129 | 301 |
| 587 | 3300047471 | Ga0495684_0001167 | Ga0495684_0001167_19536_20654 | 301 |
| 588 | 3300047471 | Ga0495684_0294977 | Ga0495684_0294977_98_1015 | 301 |
| 589 | 3300047673 | Ga0495593_0034679 | Ga0495593_0034679_809_1927 | 301 |
| 590 | 3300048088 | Ga0495602_0011056 | Ga0495602_0011056_5532_6455 | 301 |
| 591 | 3300048088 | Ga0495602_0078129 | Ga0495602_0078129_749_1654 | 301 |
| 592 | 3300048088 | Ga0495602_0095095 | Ga0495602_0095095_1343_2266 | 301 |
| 593 | 3300048903 | Ga0496100_0006789 | Ga0496100_0006789_4793_5698 | 301 |
| 594 | 3300048903 | Ga0496100_0060843 | Ga0496100_0060843_604_1509 | 301 |
| 595 | 3300048903 | Ga0496100_0095785 | Ga0496100_0095785_434_1342 | 301 |
| 596 | 3300048904 | Ga0496101_0004666 | Ga0496101_0004666_17_922 | 301 |
| 597 | 3300048904 | Ga0496101_0005617 | Ga0496101_0005617_1285_2190 | 301 |
| 598 | 3300048904 | Ga0496101_0027626 | Ga0496101_0027626_2664_3569 | 301 |
| 599 | 3300048904 | Ga0496101_0452554 | Ga0496101_0452554_14_937 | 301 |
| 600 | 3300048905 | Ga0496102_0005207 | Ga0496102_0005207_9307_10212 | 301 |
| 601 | 3300048905 | Ga0496102_0021515 | Ga0496102_0021515_1510_2415 | 301 |
| 602 | 3300048905 | Ga0496102_0037459 | Ga0496102_0037459_1493_2413 | 301 |
| 603 | 3300048905 | Ga0496102_0069311 | Ga0496102_0069311_820_1725 | 301 |
| 604 | 3300048905 | Ga0496102_0543607 | Ga0496102_0543607_89_994 | 301 |
| 605 | 3300048906 | Ga0496103_0005219 | Ga0496103_0005219_6827_7753 | 301 |
| 606 | 3300048906 | Ga0496103_0017408 | Ga0496103_0017408_707_1612 | 301 |
| 607 | 3300048906 | Ga0496103_0026963 | Ga0496103_0026963_1092_1997 | 301 |
| 608 | 3300048907 | Ga0496104_0000065 | Ga0496104_0000065_21293_22216 | 301 |
| 609 | 3300048907 | Ga0496104_0035308 | Ga0496104_0035308_1129_2034 | 301 |
| 610 | 3300048907 | Ga0496104_0097234 | Ga0496104_0097234_1153_2058 | 301 |
| 611 | 3300048908 | Ga0496105_0000530 | Ga0496105_0000530_18598_19521 | 301 |
| 612 | 3300048908 | Ga0496105_0013007 | Ga0496105_0013007_4266_5171 | 301 |
| 613 | 3300048908 | Ga0496105_0121987 | Ga0496105_0121987_377_1300 | 301 |
| 614 | 3300048908 | Ga0496105_0142959 | Ga0496105_0142959_1004_1909 | 301 |
| 615 | 3300048909 | Ga0496106_0004911 | Ga0496106_0004911_5709_6614 | 301 |
| 616 | 3300048909 | Ga0496106_0045419 | Ga0496106_0045419_163_1068 | 301 |
| 617 | 3300048909 | Ga0496106_0059882 | Ga0496106_0059882_1445_2350 | 301 |
| 618 | 3300048910 | Ga0496107_0003623 | Ga0496107_0003623_7677_8582 | 301 |
| 619 | 3300048910 | Ga0496107_0137194 | Ga0496107_0137194_468_1373 | 301 |
| 620 | 3300048911 | Ga0496108_0006182 | Ga0496108_0006182_3086_4012 | 301 |
| 621 | 3300048911 | Ga0496108_0276755 | Ga0496108_0276755_214_1119 | 301 |
| 622 | 3300048912 | Ga0496109_0006148 | Ga0496109_0006148_2052_2957 | 301 |
| 623 | 3300048912 | Ga0496109_0063220 | Ga0496109_0063220_941_1846 | 301 |
| 624 | 3300048912 | Ga0496109_0090911 | Ga0496109_0090911_1583_2488 | 301 |
| 625 | 3300048912 | Ga0496109_0160081 | Ga0496109_0160081_53_976 | 301 |
| 626 | 3300048913 | Ga0496110_0141607 | Ga0496110_0141607_294_1199 | 301 |
| 627 | 3300048913 | Ga0496110_0316310 | Ga0496110_0316310_305_1210 | 301 |
| 628 | 3300048914 | Ga0496111_0050442 | Ga0496111_0050442_894_1799 | 301 |
| 629 | 3300048914 | Ga0496111_0319806 | Ga0496111_0319806_67_993 | 301 |
| 630 | 3300048915 | Ga0496112_0063064 | Ga0496112_0063064_537_1460 | 301 |
| 631 | 3300048915 | Ga0496112_0081582 | Ga0496112_0081582_452_1357 | 301 |
| 632 | 3300048915 | Ga0496112_0312652 | Ga0496112_0312652_401_1306 | 301 |
| 633 | 3300048916 | Ga0496113_0012326 | Ga0496113_0012326_3797_4702 | 301 |
| 634 | 3300048916 | Ga0496113_0027032 | Ga0496113_0027032_573_1478 | 301 |
| 635 | 3300048917 | Ga0496114_0013198 | Ga0496114_0013198_4997_5905 | 301 |
| 636 | 3300048917 | Ga0496114_0108737 | Ga0496114_0108737_1268_2191 | 301 |
| 637 | 3300048918 | Ga0496115_0009176 | Ga0496115_0009176_4511_5434 | 301 |
| 638 | 3300048918 | Ga0496115_0047492 | Ga0496115_0047492_2484_3389 | 301 |
| 639 | 3300048918 | Ga0496115_0054214 | Ga0496115_0054214_45_950 | 301 |
| 640 | 3300048918 | Ga0496115_0137716 | Ga0496115_0137716_404_1309 | 301 |
| 641 | 3300048918 | Ga0496115_0140429 | Ga0496115_0140429_607_1527 | 301 |
| 642 | 3300048918 | Ga0496115_0200037 | Ga0496115_0200037_265_1170 | 301 |
| 643 | 3300048920 | Ga0496117_0000024 | Ga0496117_0000024_204584_205504 | 301 |
| 644 | 3300048921 | Ga0496118_0000014 | Ga0496118_0000014_213558_214478 | 301 |
| 645 | 3300048922 | Ga0496119_0038923 | Ga0496119_0038923_57_977 | 301 |
| 646 | 3300048924 | Ga0496121_0115632 | Ga0496121_0115632_930_1850 | 301 |
| 647 | 3300048927 | Ga0496124_0010253 | Ga0496124_0010253_317_1237 | 301 |
| 648 | 3300048929 | Ga0496126_0007905 | Ga0496126_0007905_6198_7118 | 301 |
| 649 | 3300048929 | Ga0496126_0162504 | Ga0496126_0162504_532_1455 | 301 |
| 650 | 3300049571 | Ga0501034_0012903 | Ga0501034_0012903_842_1747 | 301 |
| 651 | 3300049571 | Ga0501034_0120734 | Ga0501034_0120734_263_1186 | 301 |
| 652 | 3300049571 | Ga0501034_0139317 | Ga0501034_0139317_1056_1976 | 301 |
| 653 | 3300049574 | Ga0501038_0073437 | Ga0501038_0073437_1474_2394 | 301 |
| 654 | 3300049581 | Ga0501047_0122447 | Ga0501047_0122447_583_1503 | 301 |
| 655 | 3300049587 | Ga0501071_0034927 | Ga0501071_0034927_543_1466 | 301 |
| 656 | 3300049587 | Ga0501071_0054405 | Ga0501071_0054405_252_1181 | 301 |
| 657 | 3300049587 | Ga0501071_0311314 | Ga0501071_0311314_233_1138 | 301 |
| 658 | 3300049588 | Ga0501072_0003275 | Ga0501072_0003275_9788_10711 | 301 |
| 659 | 3300049589 | Ga0501073_0123408 | Ga0501073_0123408_420_1343 | 301 |
| 660 | 3300049591 | Ga0501075_0020575 | Ga0501075_0020575_1045_1968 | 301 |
| 661 | 3300049591 | Ga0501075_0314342 | Ga0501075_0314342_196_1125 | 301 |
| 662 | 3300049591 | Ga0501075_0381451 | Ga0501075_0381451_31_954 | 301 |
| 663 | 3300049592 | Ga0501076_0030342 | Ga0501076_0030342_752_1681 | 301 |
| 664 | 3300049592 | Ga0501076_0103432 | Ga0501076_0103432_516_1439 | 301 |
| 665 | 3300049592 | Ga0501076_0268297 | Ga0501076_0268297_73_996 | 301 |
| 666 | 3300049593 | Ga0501077_0097489 | Ga0501077_0097489_815_1744 | 301 |
| 667 | 3300049741 | Ga0501079_0281091 | Ga0501079_0281091_187_1116 | 301 |
| 668 | 3300049743 | Ga0501081_0052195 | Ga0501081_0052195_49_972 | 301 |
| 669 | 3300049743 | Ga0501081_0326705 | Ga0501081_0326705_34_963 | 301 |
| 670 | 3300049744 | Ga0501083_0106036 | Ga0501083_0106036_422_1342 | 301 |
| 671 | 3300050491 | nmdc:mga00v17_124093_c1 | nmdc:mga00v17_124093_c1_293_1219 | 301 |
| 672 | 3300050492 | nmdc:mga0yw44_19721_c1 | nmdc:mga0yw44_19721_c1_2509_3444 | 301 |
| 673 | 3300050492 | nmdc:mga0yw44_37073_c1 | nmdc:mga0yw44_37073_c1_1427_2353 | 301 |
| 674 | 3300050494 | nmdc:mga06z11_137253_c1 | nmdc:mga06z11_137253_c1_101_1036 | 301 |
| 675 | 3300050507 | nmdc:mga05p37_1643_c1 | nmdc:mga05p37_1643_c1_21379_22314 | 301 |
| 676 | 3300050507 | nmdc:mga05p37_232221_c1 | nmdc:mga05p37_232221_c1_274_1257 | 301 |
| 677 | 3300050507 | nmdc:mga05p37_26039_c1 | nmdc:mga05p37_26039_c1_1628_2560 | 301 |
| 678 | 3300050507 | nmdc:mga05p37_263698_c1 | nmdc:mga05p37_263698_c1_393_1316 | 301 |
| 679 | 3300050507 | nmdc:mga05p37_41974_c1 | nmdc:mga05p37_41974_c1_110_1042 | 301 |
| 680 | 3300050507 | nmdc:mga05p37_447443_c1 | nmdc:mga05p37_447443_c1_202_1128 | 301 |
| 681 | 3300050507 | nmdc:mga05p37_65277_c1 | nmdc:mga05p37_65277_c1_740_1663 | 301 |
| 682 | 3300050508 | nmdc:mga09592_348162_c1 | nmdc:mga09592_348162_c1_240_1163 | 301 |
| 683 | 3300050508 | nmdc:mga09592_36096_c1 | nmdc:mga09592_36096_c1_2361_3293 | 301 |
| 684 | 3300050510 | nmdc:mga06r32_44199_c1 | nmdc:mga06r32_44199_c1_1635_2558 | 301 |
| 685 | 3300050511 | nmdc:mga08y16_12539_c1 | nmdc:mga08y16_12539_c1_48_953 | 301 |
| 686 | 3300050511 | nmdc:mga08y16_371085_c1 | nmdc:mga08y16_371085_c1_114_1037 | 301 |
| 687 | 3300050512 | nmdc:mga0n895_104882_c1 | nmdc:mga0n895_104882_c1_1410_2333 | 301 |
| 688 | 3300050512 | nmdc:mga0n895_19417_c1 | nmdc:mga0n895_19417_c1_3576_4499 | 301 |
| 689 | 3300050512 | nmdc:mga0n895_55209_c1 | nmdc:mga0n895_55209_c1_1285_2190 | 301 |
| 690 | 3300050512 | nmdc:mga0n895_7304_c1 | nmdc:mga0n895_7304_c1_1573_2478 | 301 |
| 691 | 3300050513 | nmdc:mga0rr50_412421_c1 | nmdc:mga0rr50_412421_c1_207_1130 | 301 |
| 692 | 3300050513 | nmdc:mga0rr50_54668_c1 | nmdc:mga0rr50_54668_c1_1935_2858 | 301 |
| 693 | 3300050514 | nmdc:mga08x19_8440_c1 | nmdc:mga08x19_8440_c1_2999_3922 | 301 |
| 694 | 3300050514 | nmdc:mga08x19_85522_c1 | nmdc:mga08x19_85522_c1_482_1405 | 301 |
| 695 | 3300050515 | nmdc:mga0a205_303384_c1 | nmdc:mga0a205_303384_c1_161_1093 | 301 |
| 696 | 3300053077 | Ga0495601_0000111 | Ga0495601_0000111_38751_39674 | 301 |
| 697 | 3300053077 | Ga0495601_0000806 | Ga0495601_0000806_10781_11698 | 301 |
| 698 | 3300053077 | Ga0495601_0001346 | Ga0495601_0001346_5465_6388 | 301 |
| 699 | 3300053077 | Ga0495601_0002531 | Ga0495601_0002531_5887_6792 | 301 |
| 700 | 3300053077 | Ga0495601_0081704 | Ga0495601_0081704_805_1731 | 301 |
| 701 | 3300053077 | Ga0495601_0152001 | Ga0495601_0152001_53_976 | 301 |
| 702 | 3300053078 | Ga0495612_0001026 | Ga0495612_0001026_8328_9251 | 301 |
| 703 | 3300053078 | Ga0495612_0003065 | Ga0495612_0003065_1127_2050 | 301 |
| 704 | 3300053078 | Ga0495612_0010383 | Ga0495612_0010383_2066_2983 | 301 |
| 705 | 3300053078 | Ga0495612_0032068 | Ga0495612_0032068_725_1630 | 301 |
| 706 | 3300053084 | Ga0495595_0000447 | Ga0495595_0000447_9861_10784 | 301 |
| 707 | 3300053084 | Ga0495595_0018267 | Ga0495595_0018267_23_928 | 301 |
| 708 | 3300053084 | Ga0495595_0048168 | Ga0495595_0048168_314_1222 | 301 |
| 709 | 3300053084 | Ga0495595_0085033 | Ga0495595_0085033_484_1410 | 301 |
| 710 | 3300053085 | Ga0495619_0000307 | Ga0495619_0000307_25362_26279 | 301 |
| 711 | 3300053085 | Ga0495619_0001436 | Ga0495619_0001436_9363_10286 | 301 |
| 712 | 3300053085 | Ga0495619_0002791 | Ga0495619_0002791_9940_10845 | 301 |
| 713 | 3300053085 | Ga0495619_0024455 | Ga0495619_0024455_2111_3016 | 301 |
| 714 | 3300053085 | Ga0495619_0096468 | Ga0495619_0096468_298_1221 | 301 |
| 715 | 3300053117 | Ga0500593_001418 | Ga0500593_001418_843_1763 | 301 |
| 716 | 3300060353 | Ga0501082_0012546 | Ga0501082_0012546_3924_4847 | 301 |
| 717 | 3300060353 | Ga0501082_0082080 | Ga0501082_0082080_585_1505 | 301 |
| 718 | 3300060353 | Ga0501082_0117266 | Ga0501082_0117266_865_1770 | 301 |
| 719 | 3300060353 | Ga0501082_0248574 | Ga0501082_0248574_325_1245 | 301 |
| 720 | 3300060353 | Ga0501082_0485672 | Ga0501082_0485672_125_1048 | 301 |
| 721 | 3300061719 | Ga0466962_0181377 | Ga0466962_0181377_34_945 | 301 |
| 722 | 3300061734 | Ga0530510_0100967 | Ga0530510_0100967_855_1781 | 301 |
| 723 | 3300061734 | Ga0530510_0200319 | Ga0530510_0200319_324_1253 | 301 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ksx-assembly1.cif.gz_A | the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops | 0.7927 | 1 | 287 |
| 3un6-assembly1.cif.gz_A | 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound | 0.7792 | 1 | 297 |
| 4h6d-assembly4.cif.gz_E | crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae | 0.7737 | 1 | 297 |
| 4nmy-assembly2.cif.gz_B | crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile | 0.773 | 1 | 298 |
| 4h6d-assembly2.cif.gz_B | crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae | 0.7655 | 1 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4h6dB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8118 | 1 | 297 | 3.40.190.10 |
| 3k2dB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.793 | 1 | 58 | 3.40.190.10 |
| 3ix1B01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7691 | 1 | 298 | 3.40.190.10 |
| 1xs5A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.7521 | 2 | 82 | 3.40.190.10 |
| af_Q869K3_189_310_3.40.190.80 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; | 0.7519 | 1 | 56 | 3.40.190.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F9G1K0-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9907 | 1 | 281 |
|
| AF-A0A1F9G1K0-F1-model_v4 | Nitrate ABC transporter substrate-binding protein | 0.9837 | 1 | 281 |
|
| AF-A0A536SR51-F1-model_v4 | ABC transporter substrate-binding protein | 0.9834 | 1 | 298 |
|
| AF-A0A536SR51-F1-model_v4 | ABC transporter substrate-binding protein | 0.9608 | 1 | 298 |
|
| AF-A0A536WG91-F1-model_v4 | ABC transporter substrate-binding protein | 0.9531 | 1 | 190 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar