F477495

General Info

Members Datasets Scaffolds Average Seq Length
723 358 717 307

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10072887|Ga0207693_100728872
Length 302
Sequence MKIAVPDLISNSYFPAVAAVALGFLEQEGLDVSLELIFPVDEAYRAMRDGRVHFVAGSAHSALAAFPEWQGAKLLCAQAQGMYWFLVMRADLGACRIGAAPWVEMGLRRLLIEAGLDLERDGVTIAPVPGASGTTVNFGLTAAKALEEGKIDGFWANGMGTEVAVRRGVGTVVLDVRRGDGPKPCFNYTMASVAATDRLIDSSPETAAAVICAVVKTHAALKADPERAAEVGRKLFPPSETSLIAELIRRDLPYYDAAISPEFVAGMNQFARDVGILHGDVPYDRLVATRFAPLWHAKPVAR

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2643221672 Variovorax sp. Root434 Isolate Unclassified
3 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
4 2842747753 Variovorax sp. R-72060 Isolate Unclassified
5 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
6 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
200 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
286 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
287 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
336 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
337 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
352 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
355 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.03
Metatranscriptomes 0.14
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0
Rhizoplane 7.19
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1016012 3300001915 Unclassified 1230
2 JGI24752J21851_1007905 3300001976 Unclassified 1386
3 JGI24746J21847_1000301 3300001977 Bacteria 7066
4 JGI24747J21853_1002506 3300001978 Unclassified 1506
5 JGI24745J21846_1003175 3300002073 Unclassified 1709
6 JGI24738J21930_10016245 3300002075 Unclassified 1575
7 JGI24034J26672_10002166 3300002239 Plasmid 2677
8 JGI24742J22300_10004840 3300002244 Unclassified 2211
9 Ga0058859_11802100 3300004798 Unclassified 1931
10 Ga0065715_10119142 3300005293 Bacteria 2277
11 Ga0065707_10082650 3300005295 Bacteria 13052
12 Ga0070676_10005715 3300005328 Bacteria 6629
13 Ga0070683_100001578 3300005329 Bacteria 17633
14 Ga0070690_100063540 3300005330 Bacteria 2383
15 Ga0070666_10037539 3300005335 Bacteria 3222
16 Ga0070680_100014147 3300005336 Bacteria 6232
17 Ga0070680_100036470 3300005336 Bacteria 3972
18 Ga0070680_100210102 3300005336 Bacteria 1642
19 Ga0070680_100312712 3300005336 Bacteria 1333
20 Ga0070682_100006267 3300005337 Bacteria 6672
21 Ga0068868_100003154 3300005338 Bacteria 11476
22 Ga0070660_100053034 3300005339 Bacteria 3127
23 Ga0070689_100002987 3300005340 Bacteria 11119
24 Ga0070691_10046178 3300005341 Bacteria 2068
25 Ga0070687_100002357 3300005343 Bacteria 7043
26 Ga0070661_100004564 3300005344 Bacteria 9524
27 Ga0070692_10003415 3300005345 Bacteria 6438
28 Ga0070668_100011260 3300005347 Bacteria 6662
29 Ga0070669_100014076 3300005353 Bacteria 5689
30 Ga0070675_100141682 3300005354 Bacteria 2055
31 Ga0070671_100038743 3300005355 Bacteria 3955
32 Ga0070674_100004148 3300005356 Bacteria 8229
33 Ga0070688_100008074 3300005365 Bacteria 5699
34 Ga0070709_10019395 3300005434 Bacteria 3930
35 Ga0070709_10079206 3300005434 Bacteria 2140
36 Ga0070714_100009461 3300005435 Bacteria 7663
37 Ga0070714_100164535 3300005435 Bacteria 2009
38 Ga0070714_100358363 3300005435 Bacteria 1371
39 Ga0070713_100033716 3300005436 Bacteria 4105
40 Ga0070713_100039319 3300005436 Bacteria 3839
41 Ga0070713_100040285 3300005436 Bacteria 3797
42 Ga0070713_100488542 3300005436 Unclassified 1160
43 Ga0070710_10006151 3300005437 Bacteria 5741
44 Ga0070710_10075675 3300005437 Bacteria 1952
45 Ga0070710_10108696 3300005437 Bacteria 1663
46 Ga0070701_10000656 3300005438 Bacteria 12133
47 Ga0070711_100036195 3300005439 Bacteria 3306
48 Ga0070711_100048091 3300005439 Bacteria 2915
49 Ga0070705_100433827 3300005440 Bacteria 981
50 Ga0070694_100231608 3300005444 Bacteria 1390
51 Ga0070708_100128849 3300005445 Bacteria 2341
52 Ga0070708_100168880 3300005445 Bacteria 2041
53 Ga0070663_100010818 3300005455 Bacteria 5699
54 Ga0070663_100375651 3300005455 Bacteria 1156
55 Ga0070678_100010317 3300005456 Bacteria 5699
56 Ga0070678_100377794 3300005456 Unclassified 1225
57 Ga0070678_100435626 3300005456 Bacteria 1145
58 Ga0070662_100029865 3300005457 Bacteria 3808
59 Ga0070662_100087405 3300005457 Bacteria 2334
60 Ga0070681_10006391 3300005458 Bacteria 11459
61 Ga0070681_10007202 3300005458 Bacteria 10845
62 Ga0070681_10038375 3300005458 Bacteria 4802
63 Ga0070681_10041787 3300005458 Bacteria 4596
64 Ga0070681_10302655 3300005458 Bacteria 1508
65 Ga0068867_100007228 3300005459 Bacteria 7851
66 Ga0070685_10001672 3300005466 Bacteria 11650
67 Ga0070706_100006024 3300005467 Bacteria 11462
68 Ga0070707_100217166 3300005468 Bacteria 1863
69 Ga0070707_100425846 3300005468 Bacteria 1288
70 Ga0070698_100000549 3300005471 Bacteria 40084
71 Ga0070698_100005315 3300005471 Bacteria 14094
72 Ga0070698_100023653 3300005471 Bacteria 6419
73 Ga0070699_100005284 3300005518 Bacteria 11329
74 Ga0070699_100201415 3300005518 Bacteria 1770
75 Ga0070699_100610114 3300005518 Bacteria 995
76 Ga0070679_100001104 3300005530 Bacteria 23597
77 Ga0070679_100026366 3300005530 Bacteria 5709
78 Ga0070679_100061318 3300005530 Bacteria 3748
79 Ga0070684_100018816 3300005535 Bacteria 5699
80 Ga0070697_100168027 3300005536 Bacteria 1855
81 Ga0070672_100070423 3300005543 Bacteria 2779
82 Ga0070672_100511339 3300005543 Bacteria 1040
83 Ga0070695_100004843 3300005545 Bacteria 7925
84 Ga0070695_100036667 3300005545 Bacteria 3086
85 Ga0070696_100011714 3300005546 Bacteria 5877
86 Ga0070696_100029786 3300005546 Bacteria 3734
87 Ga0070696_100099229 3300005546 Bacteria 2084
88 Ga0070693_100008306 3300005547 Bacteria 5109
89 Ga0070693_100045480 3300005547 Bacteria 2488
90 Ga0070704_100010246 3300005549 Bacteria 5699
91 Ga0070704_100015795 3300005549 Bacteria 4753
92 Ga0068855_100042947 3300005563 Bacteria 5357
93 Ga0070664_100008431 3300005564 Bacteria 8334
94 Ga0070664_100123951 3300005564 Unclassified 2265
95 Ga0068857_100000358 3300005577 Bacteria 31869
96 Ga0068854_100005944 3300005578 Bacteria 7732
97 Ga0068856_100133704 3300005614 Bacteria 2486
98 Ga0070702_100002690 3300005615 Bacteria 7766
99 Ga0070702_100060302 3300005615 Unclassified 2205
100 Ga0068852_100006913 3300005616 Bacteria 8251
101 Ga0068852_100557160 3300005616 Bacteria 1147
102 Ga0068859_100009678 3300005617 Bacteria 9729
103 Ga0068864_100002272 3300005618 Bacteria 15889
104 Ga0068866_10000358 3300005718 Bacteria 21438
105 Ga0068870_10000025 3300005840 Bacteria 46848
106 Ga0068863_100018070 3300005841 Bacteria 6753
107 Ga0068858_100007959 3300005842 Bacteria 10215
108 Ga0068858_100055290 3300005842 Bacteria 3669
109 Ga0068858_100055381 3300005842 Bacteria 3666
110 Ga0068860_100008914 3300005843 Bacteria 9996
111 Ga0068860_100265278 3300005843 Unclassified 1675
112 Ga0068862_100019145 3300005844 Bacteria 5708
113 Ga0081455_10030414 3300005937 Bacteria 4904
114 Ga0081455_10062371 3300005937 Bacteria 3133
115 Ga0081538_10035222 3300005981 Bacteria 3293
116 Ga0081540_1000038 3300005983 Bacteria 138179
117 Ga0081540_1014076 3300005983 Bacteria 5153
118 Ga0081539_10018128 3300005985 Bacteria 4902
119 Ga0070717_10064905 3300006028 Bacteria 3034
120 Ga0075365_10031838 3300006038 Bacteria 3386
121 Ga0075365_10047058 3300006038 Bacteria 2834
122 Ga0070715_10000933 3300006163 Bacteria 8140
123 Ga0070715_10048925 3300006163 Bacteria 1810
124 Ga0075362_10023720 3300006177 Bacteria 2598
125 Ga0075367_10115850 3300006178 Bacteria 1648
126 Ga0068871_100002009 3300006358 Bacteria 13770
127 Ga0068871_100005001 3300006358 Bacteria 9264
128 Ga0075428_100004974 3300006844 Bacteria 14757
129 Ga0075428_100182136 3300006844 Bacteria 2273
130 Ga0075428_100294626 3300006844 Bacteria 1745
131 Ga0075430_100034845 3300006846 Bacteria 4273
132 Ga0075431_100070049 3300006847 Bacteria 3618
133 Ga0075433_10317121 3300006852 Bacteria 1379
134 Ga0075434_100034134 3300006871 Bacteria 5023
135 Ga0075434_100156525 3300006871 Bacteria 2298
136 Ga0075434_100214377 3300006871 Bacteria 1945
137 Ga0075434_100262183 3300006871 Bacteria 1747
138 Ga0075429_100089118 3300006880 Bacteria 2689
139 Ga0075429_100127863 3300006880 Bacteria 2222
140 Ga0068865_100322860 3300006881 Bacteria 1242
141 Ga0097620_100009681 3300006931 Bacteria 9729
142 Ga0075435_100015827 3300007076 Bacteria 5677
143 Ga0075435_100047682 3300007076 Bacteria 3440
144 Ga0099794_10015673 3300007265 Bacteria 3350
145 Ga0105244_10097084 3300009036 Bacteria 1444
146 Ga0105250_10041125 3300009092 Bacteria 1853
147 Ga0105240_10070146 3300009093 Bacteria 4336
148 Ga0111539_10028243 3300009094 Bacteria 6847
149 Ga0111539_10098897 3300009094 Bacteria 3426
150 Ga0111539_10476150 3300009094 Bacteria 1454
151 Ga0105245_10030201 3300009098 Bacteria 4792
152 Ga0105245_10534173 3300009098 Bacteria 1193
153 Ga0105247_10020813 3300009101 Plasmid 3945
154 Ga0114129_10076945 3300009147 Bacteria 4643
155 Ga0114129_10078797 3300009147 Bacteria 4582
156 Ga0105243_10011552 3300009148 Bacteria 6681
157 Ga0105243_10057438 3300009148 Bacteria 3099
158 Ga0105241_10003634 3300009174 Bacteria 11459
159 Ga0105242_10056242 3300009176 Bacteria 3219
160 Ga0105242_10119232 3300009176 Bacteria 2261
161 Ga0105237_10016489 3300009545 Bacteria 7674
162 Ga0105237_10180294 3300009545 Bacteria 2113
163 Ga0105249_10022058 3300009553 Bacteria 5702
164 Ga0105249_10050755 3300009553 Bacteria 3781
165 Ga0099796_10017613 3300010159 Bacteria 2131
166 Ga0105239_10188965 3300010375 Bacteria 2306
167 Ga0105246_10071004 3300011119 Bacteria 2451
168 Ga0157373_10136941 3300013100 Bacteria 1722
169 Ga0157370_10046630 3300013104 Bacteria 4155
170 Ga0157370_10062445 3300013104 Bacteria 3533
171 Ga0157378_10011414 3300013297 Bacteria 7778
172 Ga0163162_10167354 3300013306 Bacteria 2322
173 Ga0163162_10167770 3300013306 Bacteria 2319
174 Ga0163162_10481309 3300013306 Bacteria 1373
175 Ga0157372_10030789 3300013307 Bacteria 5871
176 Ga0157372_10083535 3300013307 Bacteria 3618
177 Ga0157375_10023326 3300013308 Bacteria 5709
178 Ga0157375_10525459 3300013308 Bacteria 1346
179 Ga0157375_10662276 3300013308 Unclassified 1200
180 Ga0163163_10013913 3300014325 Bacteria 7381
181 Ga0163163_10399489 3300014325 Bacteria 1433
182 Ga0157380_10236524 3300014326 Bacteria 1644
183 Ga0157377_10108000 3300014745 Bacteria 1669
184 Ga0157379_10056306 3300014968 Bacteria 3513
185 Ga0157379_10065106 3300014968 Plasmid 3258
186 Ga0157379_10294091 3300014968 Bacteria 1479
187 Ga0157376_10143494 3300014969 Bacteria 2145
188 Ga0163161_10112856 3300017792 Bacteria 2034
189 Ga0213876_10071428 3300021384 Bacteria 1833
190 Ga0213876_10078342 3300021384 Bacteria 1746
191 Ga0213875_10000116 3300021388 Bacteria 90170
192 Ga0207666_1000252 3300025271 Bacteria 7908
193 Ga0207682_10000607 3300025893 Bacteria 16670
194 Ga0207692_10019860 3300025898 Bacteria 3045
195 Ga0207692_10147747 3300025898 Bacteria 1343
196 Ga0207685_10012768 3300025905 Bacteria 2575
197 Ga0207685_10090399 3300025905 Bacteria 1288
198 Ga0207685_10106290 3300025905 Bacteria 1209
199 Ga0207643_10000397 3300025908 Bacteria 29056
200 Ga0207684_10005624 3300025910 Bacteria 11522
201 Ga0207707_10002788 3300025912 Bacteria 15578
202 Ga0207695_10077085 3300025913 Bacteria 3387
203 Ga0207693_10001021 3300025915 Bacteria 25052
204 Ga0207693_10004915 3300025915 Bacteria 11232
205 Ga0207693_10050585 3300025915 Bacteria 3263
206 Ga0207693_10072887 3300025915 Bacteria 2688
207 Ga0207693_10087581 3300025915 Unclassified 2440
208 Ga0207693_10243292 3300025915 Bacteria 1412
209 Ga0207663_10029253 3300025916 Bacteria 3234
210 Ga0207663_10041700 3300025916 Bacteria 2799
211 Ga0207663_10053074 3300025916 Unclassified 2531
212 Ga0207663_10090505 3300025916 Bacteria 2029
213 Ga0207660_10105034 3300025917 Bacteria 2116
214 Ga0207660_10134951 3300025917 Bacteria 1882
215 Ga0207662_10038596 3300025918 Bacteria 2799
216 Ga0207649_10001199 3300025920 Bacteria 15630
217 Ga0207652_10001750 3300025921 Bacteria 18954
218 Ga0207652_10002218 3300025921 Bacteria 16572
219 Ga0207652_10021390 3300025921 Bacteria 5340
220 Ga0207681_10002243 3300025923 Bacteria 12288
221 Ga0207681_10002492 3300025923 Bacteria 11695
222 Ga0207681_10132362 3300025923 Bacteria 1846
223 Ga0207650_10005388 3300025925 Bacteria 8726
224 Ga0207659_10000923 3300025926 Bacteria 17507
225 Ga0207687_10005521 3300025927 Bacteria 8365
226 Ga0207687_10143912 3300025927 Bacteria 1812
227 Ga0207700_10025030 3300025928 Bacteria 4139
228 Ga0207700_10028263 3300025928 Bacteria 3940
229 Ga0207700_10083576 3300025928 Bacteria 2500
230 Ga0207700_10176206 3300025928 Bacteria 1787
231 Ga0207700_10364418 3300025928 Bacteria 1261
232 Ga0207664_10138137 3300025929 Bacteria 2058
233 Ga0207644_10000439 3300025931 Bacteria 26923
234 Ga0207644_10040018 3300025931 Bacteria 3311
235 Ga0207690_10003249 3300025932 Bacteria 9751
236 Ga0207690_10030533 3300025932 Bacteria 3439
237 Ga0207690_10163835 3300025932 Bacteria 1660
238 Ga0207706_10016044 3300025933 Bacteria 6770
239 Ga0207686_10002903 3300025934 Bacteria 9241
240 Ga0207686_10027193 3300025934 Bacteria 3347
241 Ga0207709_10001261 3300025935 Bacteria 18148
242 Ga0207670_10008671 3300025936 Bacteria 5754
243 Ga0207669_10000616 3300025937 Bacteria 15473
244 Ga0207669_10049627 3300025937 Bacteria 2503
245 Ga0207704_10009900 3300025938 Bacteria 4623
246 Ga0207665_10025929 3300025939 Bacteria 3867
247 Ga0207665_10117286 3300025939 Bacteria 1877
248 Ga0207691_10106580 3300025940 Bacteria 2496
249 Ga0207691_10229119 3300025940 Bacteria 1609
250 Ga0207711_10166791 3300025941 Bacteria 1996
251 Ga0207661_10008182 3300025944 Bacteria 7464
252 Ga0207679_10000624 3300025945 Bacteria 23633
253 Ga0207679_10002602 3300025945 Bacteria 11113
254 Ga0207679_10070676 3300025945 Bacteria 2631
255 Ga0207679_10144205 3300025945 Unclassified 1929
256 Ga0207651_10192564 3300025960 Bacteria 1628
257 Ga0207712_10021901 3300025961 Bacteria 4200
258 Ga0207668_10007113 3300025972 Bacteria 6639
259 Ga0207668_10474778 3300025972 Bacteria 1071
260 Ga0207640_10004625 3300025981 Bacteria 7471
261 Ga0207658_10022934 3300025986 Bacteria 4350
262 Ga0207677_10001740 3300026023 Bacteria 11549
263 Ga0207703_10004099 3300026035 Bacteria 12027
264 Ga0207639_10106772 3300026041 Bacteria 2273
265 Ga0207708_10200306 3300026075 Bacteria 1593
266 Ga0207702_10074432 3300026078 Bacteria 2931
267 Ga0207641_10012663 3300026088 Bacteria 6915
268 Ga0207676_10003096 3300026095 Bacteria 11864
269 Ga0207674_10001342 3300026116 Bacteria 31848
270 Ga0207675_100539688 3300026118 Bacteria 1164
271 Ga0207683_10037184 3300026121 Bacteria 4239
272 Ga0207698_10024262 3300026142 Bacteria 4253
273 Ga0207698_10523414 3300026142 Bacteria 1158
274 Ga0209179_1029408 3300027512 Bacteria 1118
275 Ga0207428_10005539 3300027907 Bacteria 11762
276 Ga0268266_10254039 3300028379 Unclassified 1627
277 Ga0268265_10023842 3300028380 Bacteria 4319
278 Ga0268264_10030329 3300028381 Bacteria 4432
279 Ga0268264_10166773 3300028381 Bacteria 1989
280 Ga0265337_1000392 3300028556 Bacteria 23495
281 Ga0265337_1000720 3300028556 Bacteria 17410
282 Ga0265334_10001597 3300028573 Bacteria 10898
283 Ga0265338_10009296 3300028800 Bacteria 11747
284 Ga0265338_10012307 3300028800 Bacteria 9764
285 Ga0265338_10092514 3300028800 Bacteria 2494
286 Ga0265330_10003304 3300031235 Bacteria 8484
287 Ga0265332_10001684 3300031238 Bacteria 12079
288 Ga0265325_10000030 3300031241 Bacteria 103532
289 Ga0265325_10007651 3300031241 Bacteria 6456
290 Ga0265325_10010445 3300031241 Bacteria 5376
291 Ga0265325_10100121 3300031241 Bacteria 1420
292 Ga0265329_10004865 3300031242 Bacteria 5508
293 Ga0265340_10010922 3300031247 Bacteria 4844
294 Ga0265340_10022391 3300031247 Bacteria 3231
295 Ga0265339_10014749 3300031249 Bacteria 4703
296 Ga0265339_10033522 3300031249 Bacteria 2890
297 Ga0265339_10034146 3300031249 Bacteria 2859
298 Ga0265331_10010420 3300031250 Bacteria 5146
299 Ga0265316_10034358 3300031344 Bacteria 4120
300 Ga0265316_10092760 3300031344 Bacteria 2302
301 Ga0265316_10239069 3300031344 Bacteria 1335
302 Ga0307408_100000406 3300031548 Bacteria 38727
303 Ga0265313_10006079 3300031595 Bacteria 8701
304 Ga0265313_10009247 3300031595 Bacteria 6419
305 Ga0265313_10018585 3300031595 Bacteria 3897
306 Ga0265313_10127312 3300031595 Bacteria 1106
307 Ga0265313_10140348 3300031595 Bacteria 1039
308 Ga0265314_10050143 3300031711 Bacteria 2918
309 Ga0265314_10059681 3300031711 Bacteria 2608
310 Ga0265342_10001892 3300031712 Bacteria 18842
311 Ga0265342_10007645 3300031712 Bacteria 7876
312 Ga0265342_10015998 3300031712 Bacteria 4915
313 Ga0307412_10000207 3300031911 Bacteria 40047
314 Ga0307411_10000086 3300032005 Bacteria 28813
315 Ga0373930_0010544 3300034816 Bacteria 1654
316 Ga0373958_0002820 3300034819 Bacteria 2472
317 Ga0373928_0004182 3300035084 Bacteria 2750
318 Ga0373934_0014474 3300035086 Bacteria 2990
319 Ga0373944_0003655 3300035089 Bacteria 3976
320 Ga0373944_0026075 3300035089 Bacteria 1724
321 Ga0373949_0001922 3300035090 Bacteria 5607
322 Ga0373952_0002747 3300035092 Bacteria 3180
323 Ga0373923_0016515 3300035111 Bacteria 2807
324 Ga0373923_0020432 3300035111 Bacteria 2573
325 Ga0373923_0092203 3300035111 Bacteria 1326
326 Ga0373932_0070550 3300035112 Bacteria 1083
327 Ga0373936_0009931 3300035113 Bacteria 3592
328 Ga0373936_0067196 3300035113 Bacteria 1473
329 Ga0373941_0004877 3300035115 Bacteria 3127
330 Ga0373945_0007252 3300035116 Bacteria 3589
331 Ga0373953_0022038 3300035117 Bacteria 2397
332 Ga0373953_0032731 3300035117 Bacteria 2030
333 Ga0373956_0005163 3300035119 Bacteria 5228
334 Ga0373956_0030239 3300035119 Bacteria 2366
335 Ga0373956_0033078 3300035119 Bacteria 2272
336 Ga0373957_0019480 3300035120 Bacteria 2388
337 Ga0373960_0002981 3300035121 Bacteria 3830
338 Ga0373943_0000467 3300035170 Bacteria 17171
339 Ga0373943_0010322 3300035170 Bacteria 4188
340 Ga0373943_0029721 3300035170 Bacteria 2582
341 Ga0373943_0059214 3300035170 Bacteria 1908
342 Ga0373943_0150925 3300035170 Bacteria 1259
343 Ga0373946_0000643 3300035171 Bacteria 11673
344 Ga0373946_0004320 3300035171 Bacteria 5081
345 Ga0373946_0189506 3300035171 Bacteria 980
346 Ga0373955_0003642 3300035172 Bacteria 6781
347 Ga0373955_0019547 3300035172 Bacteria 3388
348 Ga0373955_0255867 3300035172 Bacteria 1050
349 Ga0373961_0001004 3300035241 Bacteria 9210
350 Ga0373962_0000894 3300035242 Bacteria 6824
351 Ga0373924_0011363 3300035410 Bacteria 3306
352 Ga0373924_0013011 3300035410 Bacteria 3120
353 Ga0373924_0053351 3300035410 Bacteria 1679
354 Ga0373931_0001241 3300035691 Bacteria 10893
355 Ga0373931_0228569 3300035691 Bacteria 1123
356 Ga0373935_0008851 3300035692 Bacteria 6024
357 Ga0373935_0008860 3300035692 Bacteria 6021
358 Ga0373935_0024495 3300035692 Bacteria 3715
359 Ga0373935_0025807 3300035692 Bacteria 3622
360 Ga0373935_0036486 3300035692 Bacteria 3073
361 Ga0373935_0286332 3300035692 Bacteria 1161
362 Ga0373935_0379097 3300035692 Unclassified 1012
363 Ga0373927_0002618 3300035695 Bacteria 13120
364 Ga0373927_0017140 3300035695 Bacteria 4773
365 Ga0373927_0020010 3300035695 Bacteria 4390
366 Ga0373927_0043471 3300035695 Bacteria 2908
367 Ga0373927_0094989 3300035695 Bacteria 1937
368 Ga0373927_0278626 3300035695 Bacteria 1100
369 Ga0373933_0002265 3300035724 Bacteria 10966
370 Ga0373947_0010245 3300035725 Bacteria 5380
371 Ga0373947_0021082 3300035725 Bacteria 3769
372 Ga0373947_0079939 3300035725 Bacteria 2022
373 Ga0373947_0147302 3300035725 Bacteria 1514
374 Ga0373947_0222156 3300035725 Unclassified 1242
375 Ga0373937_0005767 3300036401 Bacteria 10644
376 Ga0373937_0017542 3300036401 Bacteria 6380
377 Ga0373937_0074636 3300036401 Bacteria 3129
378 Ga0373937_0091544 3300036401 Bacteria 2818
379 Ga0373937_0165276 3300036401 Bacteria 2075
380 Ga0373925_0002414 3300037068 Bacteria 14986
381 Ga0373925_0010109 3300037068 Bacteria 6855
382 Ga0373925_0028889 3300037068 Bacteria 4065
383 Ga0373925_0116732 3300037068 Bacteria 2067
384 Ga0436364_0043682 3300037853 Bacteria 4781
385 Ga0436364_0075263 3300037853 Bacteria 2328
386 Ga0436364_0510596 3300037853 Bacteria 1451
387 Ga0436364_0886859 3300037853 Bacteria 20187
388 Ga0436364_1245875 3300037853 Bacteria 5557
389 Ga0436365_0281080 3300039437 Bacteria 15740
390 Ga0436365_0534961 3300039437 Bacteria 3890
391 Ga0436365_0634949 3300039437 Bacteria 4392
392 Ga0436365_0642359 3300039437 Bacteria 3837
393 Ga0436365_0787440 3300039437 Bacteria 2245
394 Ga0436360_0003318 3300039438 Bacteria 1028
395 Ga0436360_0141957 3300039438 Bacteria 1074
396 Ga0436360_0627708 3300039438 Bacteria 1952
397 Ga0436360_1105762 3300039438 Bacteria 1539
398 Ga0436361_0017372 3300039447 Bacteria 5859
399 Ga0436361_0193119 3300039447 Bacteria 1623
400 Ga0436362_0556527 3300039453 Bacteria 2149
401 Ga0436362_0718952 3300039453 Bacteria 2410
402 Ga0436362_0881111 3300039453 Bacteria 1699
403 Ga0436362_1245208 3300039453 Bacteria 2213
404 Ga0436362_1294643 3300039453 Bacteria 1077
405 Ga0466966_0047858 3300044684 Bacteria 2725
406 Ga0466961_0200253 3300044693 Bacteria 1235
407 Ga0466963_0101326 3300044694 Bacteria 1971
408 Ga0466963_0388925 3300044694 Bacteria 983
409 Ga0466957_0072254 3300044842 Bacteria 2135
410 Ga0466959_0014641 3300045049 Bacteria 5706
411 Ga0451576_0317321 3300045051 Unclassified 1631
412 Ga0466958_0109428 3300045836 Bacteria 1724
413 Ga0466967_0095636 3300045976 Bacteria 2708
414 Ga0466967_0192925 3300045976 Bacteria 1926
415 Ga0495592_0012135 3300046454 Bacteria 6538
416 Ga0495592_0034140 3300046454 Bacteria 3835
417 Ga0495592_0103422 3300046454 Bacteria 2026
418 Ga0495603_0010593 3300046455 Bacteria 5586
419 Ga0495603_0067645 3300046455 Bacteria 2102
420 Ga0495590_0057668 3300046457 Bacteria 1358
421 Ga0495629_0027369 3300046459 Bacteria 4047
422 Ga0495629_0068543 3300046459 Bacteria 2476
423 Ga0495629_0105303 3300046459 Bacteria 1967
424 Ga0495629_0217994 3300046459 Unclassified 1317
425 Ga0495638_0009313 3300046460 Bacteria 6903
426 Ga0495641_0010583 3300046461 Bacteria 5327
427 Ga0495651_0007302 3300046462 Bacteria 8449
428 Ga0495651_0033242 3300046462 Bacteria 4023
429 Ga0495651_0046027 3300046462 Bacteria 3378
430 Ga0495653_0052056 3300046463 Bacteria 3140
431 Ga0495653_0064367 3300046463 Bacteria 2763
432 Ga0495653_0089703 3300046463 Bacteria 2252
433 Ga0495653_0104006 3300046463 Bacteria 2052
434 Ga0495653_0195142 3300046463 Bacteria 1378
435 Ga0495580_0018920 3300046472 Bacteria 5124
436 Ga0495580_0024257 3300046472 Bacteria 4444
437 Ga0495580_0082379 3300046472 Bacteria 2242
438 Ga0495582_0012893 3300046473 Bacteria 4605
439 Ga0495639_0029020 3300046475 Bacteria 2454
440 Ga0495639_0068423 3300046475 Bacteria 1637
441 Ga0495662_0003675 3300046476 Bacteria 7734
442 Ga0495662_0006819 3300046476 Bacteria 5682
443 Ga0495662_0014553 3300046476 Bacteria 3825
444 Ga0495662_0066293 3300046476 Bacteria 1746
445 Ga0495664_0000959 3300046477 Bacteria 14810
446 Ga0495664_0002260 3300046477 Bacteria 10317
447 Ga0495664_0011371 3300046477 Bacteria 5017
448 Ga0495664_0118166 3300046477 Bacteria 1603
449 Ga0495584_0010207 3300046491 Bacteria 4823
450 Ga0495584_0019599 3300046491 Bacteria 3436
451 Ga0495584_0045760 3300046491 Bacteria 2207
452 Ga0495585_0032795 3300046492 Bacteria 2941
453 Ga0495594_0015238 3300046499 Bacteria 4038
454 Ga0495607_0046310 3300046501 Bacteria 2555
455 Ga0495608_0005826 3300046511 Bacteria 8777
456 Ga0495608_0042818 3300046511 Bacteria 3027
457 Ga0495608_0052624 3300046511 Bacteria 2695
458 Ga0495608_0113703 3300046511 Bacteria 1739
459 Ga0495618_0002051 3300046514 Bacteria 13237
460 Ga0495618_0048487 3300046514 Bacteria 2681
461 Ga0495618_0053716 3300046514 Bacteria 2547
462 Ga0495618_0092656 3300046514 Bacteria 1932
463 Ga0495618_0098854 3300046514 Bacteria 1867
464 Ga0495628_0005312 3300046516 Bacteria 11303
465 Ga0495628_0036834 3300046516 Bacteria 3924
466 Ga0495628_0094735 3300046516 Bacteria 2307
467 Ga0495628_0200468 3300046516 Unclassified 1504
468 Ga0495630_0038183 3300046517 Bacteria 3592
469 Ga0495630_0044480 3300046517 Bacteria 3318
470 Ga0495630_0165190 3300046517 Bacteria 1685
471 Ga0495666_0012458 3300046526 Bacteria 4238
472 Ga0495666_0014911 3300046526 Bacteria 3868
473 Ga0495642_0095646 3300046528 Bacteria 1260
474 Ga0495652_0005594 3300046529 Bacteria 11799
475 Ga0495652_0022506 3300046529 Bacteria 5593
476 Ga0495652_0047146 3300046529 Bacteria 3696
477 Ga0495652_0135282 3300046529 Bacteria 1945
478 Ga0495665_0005874 3300046531 Bacteria 6615
479 Ga0495665_0084294 3300046531 Bacteria 1670
480 Ga0495640_0007932 3300046533 Bacteria 8348
481 Ga0495640_0022861 3300046533 Bacteria 4565
482 Ga0495640_0023762 3300046533 Bacteria 4460
483 Ga0495640_0033467 3300046533 Bacteria 3649
484 Ga0495640_0130544 3300046533 Bacteria 1626
485 Ga0495640_0130775 3300046533 Bacteria 1625
486 Ga0495640_0158976 3300046533 Unclassified 1449
487 Ga0495586_0009074 3300046535 Bacteria 5290
488 Ga0495586_0015460 3300046535 Bacteria 4060
489 Ga0495586_0042139 3300046535 Bacteria 2459
490 Ga0495587_0023570 3300046536 Bacteria 3782
491 Ga0495598_0026592 3300046537 Bacteria 1588
492 Ga0495645_0001619 3300046543 Bacteria 15237
493 Ga0495645_0047035 3300046543 Bacteria 3144
494 Ga0495645_0105489 3300046543 Bacteria 1999
495 Ga0495645_0130473 3300046543 Bacteria 1762
496 Ga0495645_0210678 3300046543 Bacteria 1312
497 Ga0495622_0031552 3300046557 Bacteria 2476
498 Ga0495667_0006860 3300046559 Bacteria 7731
499 Ga0495667_0009135 3300046559 Bacteria 6731
500 Ga0495667_0039716 3300046559 Bacteria 3128
501 Ga0495667_0043732 3300046559 Bacteria 2967
502 Ga0495634_0009583 3300046642 Bacteria 7137
503 Ga0495634_0023770 3300046642 Bacteria 4305
504 Ga0495634_0246008 3300046642 Bacteria 1095
505 Ga0495635_0003347 3300046663 Bacteria 11080
506 Ga0495635_0006683 3300046663 Bacteria 8057
507 Ga0495635_0047122 3300046663 Bacteria 2974
508 Ga0495635_0072599 3300046663 Bacteria 2357
509 Ga0495635_0094348 3300046663 Bacteria 2046
510 Ga0495635_0167339 3300046663 Bacteria 1495
511 Ga0495659_0003234 3300046664 Bacteria 5220
512 Ga0495659_0007612 3300046664 Bacteria 3433
513 Ga0495659_0018418 3300046664 Bacteria 2326
514 Ga0495588_0017207 3300046674 Bacteria 3506
515 Ga0495657_0046789 3300046675 Bacteria 2927
516 Ga0495599_0003169 3300046678 Bacteria 9578
517 Ga0495623_0004051 3300046679 Bacteria 9648
518 Ga0495623_0166777 3300046679 Bacteria 1290
519 Ga0495646_0030081 3300046680 Bacteria 3392
520 Ga0495646_0048267 3300046680 Bacteria 2587
521 Ga0495646_0119096 3300046680 Bacteria 1495
522 Ga0495647_0003780 3300046681 Bacteria 4871
523 Ga0495647_0046530 3300046681 Bacteria 1671
524 Ga0495658_0022254 3300046683 Bacteria 3349
525 Ga0495658_0048722 3300046683 Bacteria 2390
526 Ga0495669_0083771 3300046684 Bacteria 1466
527 Ga0495613_0008689 3300046689 Bacteria 7532
528 Ga0495613_0039460 3300046689 Bacteria 3501
529 Ga0495613_0323786 3300046689 Bacteria 1063
530 Ga0495624_0009872 3300046690 Bacteria 6602
531 Ga0495624_0091596 3300046690 Bacteria 1875
532 Ga0495624_0195461 3300046690 Bacteria 1229
533 Ga0495670_0052458 3300046691 Bacteria 2042
534 Ga0495671_0123816 3300046692 Bacteria 1261
535 Ga0495600_0000464 3300046809 Bacteria 21076
536 Ga0495600_0010301 3300046809 Bacteria 5800
537 Ga0495600_0050315 3300046809 Bacteria 2719
538 Ga0495600_0095554 3300046809 Bacteria 1938
539 Ga0495600_0141967 3300046809 Bacteria 1558
540 Ga0495581_0021361 3300047315 Bacteria 3753
541 Ga0495581_0044753 3300047315 Bacteria 2559
542 Ga0495604_0004562 3300047317 Bacteria 10974
543 Ga0495604_0008733 3300047317 Bacteria 8009
544 Ga0495604_0158914 3300047317 Bacteria 1598
545 Ga0495636_0011501 3300047318 Bacteria 3502
546 Ga0495674_0006423 3300047319 Bacteria 11271
547 Ga0495674_0011078 3300047319 Bacteria 8513
548 Ga0495674_0024220 3300047319 Bacteria 5581
549 Ga0495674_0068120 3300047319 Bacteria 3081
550 Ga0495674_0441322 3300047319 Bacteria 1047
551 Ga0495676_0019355 3300047321 Bacteria 5988
552 Ga0495676_0123944 3300047321 Bacteria 1875
553 Ga0495680_0006696 3300047322 Bacteria 10666
554 Ga0495680_0007490 3300047322 Bacteria 10000
555 Ga0495680_0017094 3300047322 Bacteria 6206
556 Ga0495680_0024923 3300047322 Bacteria 4954
557 Ga0495680_0191104 3300047322 Bacteria 1473
558 Ga0495680_0272499 3300047322 Unclassified 1195
559 Ga0495675_0005984 3300047444 Bacteria 7437
560 Ga0495675_0133131 3300047444 Unclassified 1545
561 Ga0495679_045108 3300047446 Bacteria 1348
562 Ga0495685_018054 3300047447 Bacteria 2419
563 Ga0495685_067586 3300047447 Bacteria 1200
564 Ga0495684_0001167 3300047471 Bacteria 21128
565 Ga0495684_0006093 3300047471 Bacteria 9379
566 Ga0495684_0137715 3300047471 Bacteria 1831
567 Ga0495684_0294977 3300047471 Unclassified 1166
568 Ga0495593_0034679 3300047673 Bacteria 2743
569 Ga0495602_0011056 3300048088 Bacteria 9347
570 Ga0495602_0078129 3300048088 Bacteria 2796
571 Ga0495602_0095095 3300048088 Bacteria 2461
572 Ga0496100_0006789 3300048903 Bacteria 6270
573 Ga0496100_0060843 3300048903 Bacteria 2486
574 Ga0496100_0095785 3300048903 Bacteria 2035
575 Ga0496101_0004666 3300048904 Bacteria 8672
576 Ga0496101_0005617 3300048904 Bacteria 7997
577 Ga0496101_0027626 3300048904 Bacteria 3955
578 Ga0496101_0452554 3300048904 Bacteria 1013
579 Ga0496102_0005207 3300048905 Bacteria 11041
580 Ga0496102_0021515 3300048905 Bacteria 5703
581 Ga0496102_0037459 3300048905 Unclassified 4375
582 Ga0496102_0069311 3300048905 Bacteria 3237
583 Ga0496102_0543607 3300048905 Bacteria 1084
584 Ga0496103_0005219 3300048906 Bacteria 7803
585 Ga0496103_0017408 3300048906 Bacteria 4302
586 Ga0496103_0026963 3300048906 Bacteria 3478
587 Ga0496104_0000065 3300048907 Bacteria 108770
588 Ga0496104_0035308 3300048907 Bacteria 4668
589 Ga0496104_0097234 3300048907 Bacteria 2818
590 Ga0496105_0000530 3300048908 Bacteria 25203
591 Ga0496105_0013007 3300048908 Bacteria 6594
592 Ga0496105_0121987 3300048908 Bacteria 2149
593 Ga0496105_0142959 3300048908 Bacteria 1969
594 Ga0496106_0004911 3300048909 Bacteria 9894
595 Ga0496106_0045419 3300048909 Bacteria 3299
596 Ga0496106_0059882 3300048909 Bacteria 2885
597 Ga0496107_0003623 3300048910 Bacteria 10370
598 Ga0496107_0137194 3300048910 Bacteria 1807
599 Ga0496108_0006182 3300048911 Bacteria 9689
600 Ga0496108_0276755 3300048911 Bacteria 1461
601 Ga0496109_0006148 3300048912 Bacteria 10090
602 Ga0496109_0063220 3300048912 Unclassified 3385
603 Ga0496109_0090911 3300048912 Bacteria 2823
604 Ga0496109_0160081 3300048912 Bacteria 2109
605 Ga0496109_0607066 3300048912 Bacteria 1030
606 Ga0496110_0141607 3300048913 Unclassified 2174
607 Ga0496110_0242175 3300048913 Bacteria 1641
608 Ga0496110_0316310 3300048913 Bacteria 1422
609 Ga0496111_0050442 3300048914 Unclassified 3002
610 Ga0496111_0319806 3300048914 Bacteria 1149
611 Ga0496112_0063064 3300048915 Bacteria 3656
612 Ga0496112_0081582 3300048915 Plasmid 3198
613 Ga0496112_0312652 3300048915 Bacteria 1516
614 Ga0496113_0012326 3300048916 Bacteria 5742
615 Ga0496113_0027032 3300048916 Bacteria 4109
616 Ga0496114_0013198 3300048917 Bacteria 6622
617 Ga0496114_0108737 3300048917 Bacteria 2374
618 Ga0496115_0009176 3300048918 Bacteria 7342
619 Ga0496115_0047492 3300048918 Bacteria 3433
620 Ga0496115_0054214 3300048918 Bacteria 3219
621 Ga0496115_0137716 3300048918 Bacteria 2013
622 Ga0496115_0140429 3300048918 Unclassified 1993
623 Ga0496115_0200037 3300048918 Bacteria 1650
624 Ga0496117_0000024 3300048920 Bacteria 418750
625 Ga0496118_0000014 3300048921 Bacteria 561628
626 Ga0496119_0038923 3300048922 Bacteria 3063
627 Ga0496121_0115632 3300048924 Bacteria 2036
628 Ga0496124_0010253 3300048927 Bacteria 9513
629 Ga0496126_0007905 3300048929 Bacteria 11574
630 Ga0496126_0162504 3300048929 Bacteria 1907
631 Ga0501034_0012903 3300049571 Bacteria 8618
632 Ga0501034_0120734 3300049571 Bacteria 2607
633 Ga0501034_0139317 3300049571 Bacteria 2406
634 Ga0501038_0073437 3300049574 Bacteria 2897
635 Ga0501047_0122447 3300049581 Bacteria 2482
636 Ga0501071_0034927 3300049587 Bacteria 3580
637 Ga0501071_0054405 3300049587 Bacteria 2888
638 Ga0501071_0311314 3300049587 Unclassified 1195
639 Ga0501072_0003275 3300049588 Bacteria 12168
640 Ga0501073_0123408 3300049589 Bacteria 1795
641 Ga0501075_0020575 3300049591 Bacteria 4803
642 Ga0501075_0314342 3300049591 Bacteria 1194
643 Ga0501075_0381451 3300049591 Bacteria 1075
644 Ga0501076_0030342 3300049592 Bacteria 4211
645 Ga0501076_0044107 3300049592 Bacteria 3516
646 Ga0501076_0103432 3300049592 Unclassified 2297
647 Ga0501076_0268297 3300049592 Bacteria 1398
648 Ga0501077_0097489 3300049593 Bacteria 1863
649 Ga0501079_0281091 3300049741 Bacteria 1301
650 Ga0501081_0052195 3300049743 Bacteria 2821
651 Ga0501081_0326705 3300049743 Bacteria 1128
652 Ga0501083_0106036 3300049744 Bacteria 1850
653 nmdc:mga00v17_124093_c1 3300050491 Bacteria 1646
654 nmdc:mga0yw44_19721_c1 3300050492 Bacteria 3725
655 nmdc:mga0yw44_37073_c1 3300050492 Bacteria 2877
656 nmdc:mga06z11_137253_c1 3300050494 Bacteria 1379
657 nmdc:mga05p37_1643_c1 3300050507 Bacteria 25926
658 nmdc:mga05p37_232221_c1 3300050507 Bacteria 2222
659 nmdc:mga05p37_26039_c1 3300050507 Bacteria 7112
660 nmdc:mga05p37_263698_c1 3300050507 Bacteria 2060
661 nmdc:mga05p37_41974_c1 3300050507 Bacteria 4527
662 nmdc:mga05p37_447443_c1 3300050507 Bacteria 1496
663 nmdc:mga05p37_65277_c1 3300050507 Bacteria 4479
664 nmdc:mga09592_348162_c1 3300050508 Bacteria 1282
665 nmdc:mga09592_36096_c1 3300050508 Bacteria 4140
666 nmdc:mga06r32_44199_c1 3300050510 Bacteria 4241
667 nmdc:mga08y16_12539_c1 3300050511 Bacteria 8919
668 nmdc:mga08y16_371085_c1 3300050511 Bacteria 1468
669 nmdc:mga0n895_104882_c1 3300050512 Bacteria 2839
670 nmdc:mga0n895_19417_c1 3300050512 Bacteria 6317
671 nmdc:mga0n895_55209_c1 3300050512 Bacteria 3909
672 nmdc:mga0n895_7304_c1 3300050512 Bacteria 9470
673 nmdc:mga0rr50_412421_c1 3300050513 Bacteria 1142
674 nmdc:mga0rr50_54668_c1 3300050513 Bacteria 2976
675 nmdc:mga08x19_8440_c1 3300050514 Bacteria 6136
676 nmdc:mga08x19_85522_c1 3300050514 Bacteria 2075
677 nmdc:mga0a205_303384_c1 3300050515 Bacteria 1469
678 Ga0495601_0000111 3300053077 Bacteria 44773
679 Ga0495601_0000806 3300053077 Bacteria 16954
680 Ga0495601_0001346 3300053077 Bacteria 13508
681 Ga0495601_0002531 3300053077 Bacteria 10393
682 Ga0495601_0004372 3300053077 Bacteria 8162
683 Ga0495601_0021158 3300053077 Bacteria 3981
684 Ga0495601_0081704 3300053077 Bacteria 2074
685 Ga0495601_0152001 3300053077 Bacteria 1511
686 Ga0495612_0000700 3300053078 Bacteria 13567
687 Ga0495612_0001026 3300053078 Bacteria 11463
688 Ga0495612_0003065 3300053078 Bacteria 6929
689 Ga0495612_0010383 3300053078 Bacteria 3767
690 Ga0495612_0032068 3300053078 Bacteria 2121
691 Ga0495595_0000447 3300053084 Bacteria 15654
692 Ga0495595_0018267 3300053084 Bacteria 3029
693 Ga0495595_0021337 3300053084 Bacteria 2829
694 Ga0495595_0048168 3300053084 Bacteria 1967
695 Ga0495595_0085033 3300053084 Bacteria 1512
696 Ga0495619_0000307 3300053085 Bacteria 34556
697 Ga0495619_0000681 3300053085 Bacteria 22230
698 Ga0495619_0001436 3300053085 Bacteria 15660
699 Ga0495619_0002791 3300053085 Bacteria 11400
700 Ga0495619_0018616 3300053085 Bacteria 4407
701 Ga0495619_0024455 3300053085 Bacteria 3874
702 Ga0495619_0096468 3300053085 Bacteria 2008
703 Ga0500566_0018006 3300053094 Bacteria 4148
704 Ga0500593_001418 3300053117 Bacteria 8624
705 Ga0500595_000002 3300053119 Bacteria 1074388
706 Ga0500616_0000001 3300053153 Bacteria 1986011
707 Ga0500616_0045318 3300053153 Bacteria 2343
708 Ga0500645_000291 3300053730 Bacteria 35819
709 Ga0501084_0401764 3300054114 Bacteria 1158
710 Ga0501082_0012546 3300060353 Bacteria 7281
711 Ga0501082_0082080 3300060353 Bacteria 2781
712 Ga0501082_0117266 3300060353 Unclassified 2306
713 Ga0501082_0248574 3300060353 Bacteria 1548
714 Ga0501082_0485672 3300060353 Bacteria 1080
715 Ga0466962_0181377 3300061719 Bacteria 1026
716 Ga0530510_0100967 3300061734 Bacteria 2110
717 Ga0530510_0200319 3300061734 Bacteria 1482

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0242175 Ga0496110_0242175_15_998 275
2 3300035170 Ga0373943_0029721 Ga0373943_0029721_866_1903 285
3 3300035692 Ga0373935_0036486 Ga0373935_0036486_402_1466 285
4 3300035695 Ga0373927_0043471 Ga0373927_0043471_10_1023 285
5 3300035725 Ga0373947_0021082 Ga0373947_0021082_802_1866 285
6 3300046459 Ga0495629_0105303 Ga0495629_0105303_439_1503 285
7 3300046463 Ga0495653_0052056 Ga0495653_0052056_444_1508 285
8 3300046476 Ga0495662_0003675 Ga0495662_0003675_1133_2197 285
9 3300046477 Ga0495664_0000959 Ga0495664_0000959_4745_5809 285
10 3300046514 Ga0495618_0002051 Ga0495618_0002051_3875_4939 285
11 3300046529 Ga0495652_0047146 Ga0495652_0047146_828_1892 285
12 3300046533 Ga0495640_0033467 Ga0495640_0033467_712_1776 285
13 3300046535 Ga0495586_0009074 Ga0495586_0009074_4173_5237 285
14 3300046543 Ga0495645_0047035 Ga0495645_0047035_1474_2538 285
15 3300046642 Ga0495634_0009583 Ga0495634_0009583_2170_3234 285
16 3300046663 Ga0495635_0003347 Ga0495635_0003347_7775_8839 285
17 3300046680 Ga0495646_0119096 Ga0495646_0119096_29_1093 285
18 3300046690 Ga0495624_0091596 Ga0495624_0091596_679_1743 285
19 3300046809 Ga0495600_0050315 Ga0495600_0050315_465_1529 285
20 3300047319 Ga0495674_0006423 Ga0495674_0006423_7600_8664 285
21 3300047322 Ga0495680_0191104 Ga0495680_0191104_287_1351 285
22 3300047471 Ga0495684_0006093 Ga0495684_0006093_529_1593 285
23 3300053077 Ga0495601_0004372 Ga0495601_0004372_2608_3672 285
24 3300053078 Ga0495612_0000700 Ga0495612_0000700_1672_2736 285
25 3300053085 Ga0495619_0000681 Ga0495619_0000681_14266_15330 285
26 3300035111 Ga0373923_0020432 Ga0373923_0020432_1207_2271 287
27 3300005436 Ga0070713_100033716 Ga0070713_1000337164 291
28 3300005439 Ga0070711_100036195 Ga0070711_1000361954 291
29 3300006844 Ga0075428_100294626 Ga0075428_1002946262 291
30 3300009094 Ga0111539_10476150 Ga0111539_104761501 291
31 3300025915 Ga0207693_10072887 Ga0207693_100728872 291
32 3300025928 Ga0207700_10083576 Ga0207700_100835763 291
33 3300025939 Ga0207665_10117286 Ga0207665_101172862 291
34 3300046691 Ga0495670_0052458 Ga0495670_0052458_434_1360 292
35 3300047446 Ga0495679_045108 Ga0495679_045108_232_1158 292
36 3300010159 Ga0099796_10017613 Ga0099796_100176132 293
37 3300025928 Ga0207700_10364418 Ga0207700_103644182 294
38 3300035171 Ga0373946_0189506 Ga0373946_0189506_67_969 294
39 3300048912 Ga0496109_0607066 Ga0496109_0607066_16_921 294
40 3300027512 Ga0209179_1029408 Ga0209179_10294081 296
41 iso_pu_bacteria 2643221547 2643756841 297
42 iso_pu_bacteria 3005409236 3005409746 297
43 3300005458 Ga0070681_10302655 Ga0070681_103026551 298
44 iso_pu_bacteria 2828305725 2828309155 298
45 3300028800 Ga0265338_10092514 Ga0265338_100925142 299
46 3300031711 Ga0265314_10059681 Ga0265314_100596812 299
47 3300039447 Ga0436361_0193119 Ga0436361_0193119_210_1109 299
48 iso_pu_bacteria 2643221672 2644401316 299
49 iso_pu_bacteria 2842747753 2842751589 299
50 iso_pu_bacteria 2900634093 2900642661 299
51 3300005434 Ga0070709_10019395 Ga0070709_100193952 300
52 3300035111 Ga0373923_0016515 Ga0373923_0016515_878_1780 300
53 3300035170 Ga0373943_0010322 Ga0373943_0010322_2621_3523 300
54 3300035171 Ga0373946_0004320 Ga0373946_0004320_3838_4740 300
55 3300035410 Ga0373924_0053351 Ga0373924_0053351_720_1622 300
56 3300035692 Ga0373935_0008860 Ga0373935_0008860_2101_3003 300
57 3300035695 Ga0373927_0017140 Ga0373927_0017140_2854_3756 300
58 3300035725 Ga0373947_0010245 Ga0373947_0010245_3966_4868 300
59 3300037068 Ga0373925_0028889 Ga0373925_0028889_342_1244 300
60 3300046455 Ga0495603_0010593 Ga0495603_0010593_1150_2052 300
61 3300046461 Ga0495641_0010583 Ga0495641_0010583_248_1150 300
62 3300046463 Ga0495653_0064367 Ga0495653_0064367_188_1090 300
63 3300046472 Ga0495580_0024257 Ga0495580_0024257_973_1875 300
64 3300046473 Ga0495582_0012893 Ga0495582_0012893_2818_3720 300
65 3300046476 Ga0495662_0014553 Ga0495662_0014553_349_1251 300
66 3300046477 Ga0495664_0011371 Ga0495664_0011371_1161_2063 300
67 3300046499 Ga0495594_0015238 Ga0495594_0015238_316_1218 300
68 3300046514 Ga0495618_0048487 Ga0495618_0048487_349_1251 300
69 3300046517 Ga0495630_0038183 Ga0495630_0038183_74_976 300
70 3300046526 Ga0495666_0014911 Ga0495666_0014911_2341_3243 300
71 3300046529 Ga0495652_0022506 Ga0495652_0022506_2744_3646 300
72 3300046531 Ga0495665_0005874 Ga0495665_0005874_1681_2583 300
73 3300046533 Ga0495640_0022861 Ga0495640_0022861_3315_4217 300
74 3300046535 Ga0495586_0042139 Ga0495586_0042139_885_1787 300
75 3300046543 Ga0495645_0130473 Ga0495645_0130473_620_1522 300
76 3300046559 Ga0495667_0039716 Ga0495667_0039716_1077_1979 300
77 3300046642 Ga0495634_0023770 Ga0495634_0023770_3020_3922 300
78 3300046680 Ga0495646_0048267 Ga0495646_0048267_1485_2387 300
79 3300046681 Ga0495647_0003780 Ga0495647_0003780_880_1782 300
80 3300046683 Ga0495658_0022254 Ga0495658_0022254_2403_3305 300
81 3300046689 Ga0495613_0008689 Ga0495613_0008689_21_923 300
82 3300047315 Ga0495581_0021361 Ga0495581_0021361_2506_3408 300
83 3300047319 Ga0495674_0024220 Ga0495674_0024220_2343_3245 300
84 3300047321 Ga0495676_0019355 Ga0495676_0019355_2790_3692 300
85 3300047322 Ga0495680_0017094 Ga0495680_0017094_3874_4776 300
86 3300047471 Ga0495684_0137715 Ga0495684_0137715_264_1166 300
87 3300049592 Ga0501076_0044107 Ga0501076_0044107_889_1812 300
88 3300053077 Ga0495601_0021158 Ga0495601_0021158_2740_3642 300
89 3300053084 Ga0495595_0021337 Ga0495595_0021337_1152_2054 300
90 3300053085 Ga0495619_0018616 Ga0495619_0018616_2678_3580 300
91 3300053094 Ga0500566_0018006 Ga0500566_0018006_1800_2702 300
92 3300053119 Ga0500595_000002 Ga0500595_000002_828523_829425 300
93 3300053153 Ga0500616_0000001 Ga0500616_0000001_1509004_1509906 300
94 3300053153 Ga0500616_0045318 Ga0500616_0045318_133_1035 300
95 3300053730 Ga0500645_000291 Ga0500645_000291_26249_27151 300
96 3300054114 Ga0501084_0401764 Ga0501084_0401764_108_1031 300
97 3300001915 JGI24741J21665_1016012 JGI24741J21665_10160122 301
98 3300001976 JGI24752J21851_1007905 JGI24752J21851_10079052 301
99 3300001977 JGI24746J21847_1000301 JGI24746J21847_10003012 301
100 3300001978 JGI24747J21853_1002506 JGI24747J21853_10025062 301
101 3300002073 JGI24745J21846_1003175 JGI24745J21846_10031752 301
102 3300002075 JGI24738J21930_10016245 JGI24738J21930_100162452 301
103 3300002239 JGI24034J26672_10002166 JGI24034J26672_100021663 301
104 3300002244 JGI24742J22300_10004840 JGI24742J22300_100048402 301
105 3300004798 Ga0058859_11802100 Ga0058859_118021002 301
106 3300005293 Ga0065715_10119142 Ga0065715_101191422 301
107 3300005295 Ga0065707_10082650 Ga0065707_100826505 301
108 3300005328 Ga0070676_10005715 Ga0070676_100057151 301
109 3300005329 Ga0070683_100001578 Ga0070683_10000157813 301
110 3300005330 Ga0070690_100063540 Ga0070690_1000635402 301
111 3300005335 Ga0070666_10037539 Ga0070666_100375392 301
112 3300005336 Ga0070680_100014147 Ga0070680_1000141473 301
113 3300005336 Ga0070680_100036470 Ga0070680_1000364703 301
114 3300005336 Ga0070680_100210102 Ga0070680_1002101022 301
115 3300005336 Ga0070680_100312712 Ga0070680_1003127122 301
116 3300005337 Ga0070682_100006267 Ga0070682_1000062679 301
117 3300005338 Ga0068868_100003154 Ga0068868_10000315411 301
118 3300005339 Ga0070660_100053034 Ga0070660_1000530342 301
119 3300005340 Ga0070689_100002987 Ga0070689_1000029878 301
120 3300005341 Ga0070691_10046178 Ga0070691_100461782 301
121 3300005343 Ga0070687_100002357 Ga0070687_1000023578 301
122 3300005344 Ga0070661_100004564 Ga0070661_1000045644 301
123 3300005345 Ga0070692_10003415 Ga0070692_100034151 301
124 3300005347 Ga0070668_100011260 Ga0070668_1000112601 301
125 3300005353 Ga0070669_100014076 Ga0070669_1000140761 301
126 3300005354 Ga0070675_100141682 Ga0070675_1001416821 301
127 3300005355 Ga0070671_100038743 Ga0070671_1000387434 301
128 3300005356 Ga0070674_100004148 Ga0070674_1000041487 301
129 3300005365 Ga0070688_100008074 Ga0070688_1000080741 301
130 3300005434 Ga0070709_10079206 Ga0070709_100792062 301
131 3300005435 Ga0070714_100009461 Ga0070714_1000094617 301
132 3300005435 Ga0070714_100164535 Ga0070714_1001645352 301
133 3300005435 Ga0070714_100358363 Ga0070714_1003583631 301
134 3300005436 Ga0070713_100039319 Ga0070713_1000393192 301
135 3300005436 Ga0070713_100040285 Ga0070713_1000402853 301
136 3300005436 Ga0070713_100488542 Ga0070713_1004885421 301
137 3300005437 Ga0070710_10006151 Ga0070710_100061512 301
138 3300005437 Ga0070710_10075675 Ga0070710_100756752 301
139 3300005437 Ga0070710_10108696 Ga0070710_101086962 301
140 3300005438 Ga0070701_10000656 Ga0070701_100006567 301
141 3300005439 Ga0070711_100048091 Ga0070711_1000480912 301
142 3300005440 Ga0070705_100433827 Ga0070705_1004338271 301
143 3300005444 Ga0070694_100231608 Ga0070694_1002316082 301
144 3300005445 Ga0070708_100128849 Ga0070708_1001288493 301
145 3300005445 Ga0070708_100168880 Ga0070708_1001688802 301
146 3300005455 Ga0070663_100010818 Ga0070663_1000108181 301
147 3300005455 Ga0070663_100375651 Ga0070663_1003756511 301
148 3300005456 Ga0070678_100010317 Ga0070678_1000103171 301
149 3300005456 Ga0070678_100377794 Ga0070678_1003777942 301
150 3300005456 Ga0070678_100435626 Ga0070678_1004356261 301
151 3300005457 Ga0070662_100029865 Ga0070662_1000298653 301
152 3300005457 Ga0070662_100087405 Ga0070662_1000874052 301
153 3300005458 Ga0070681_10006391 Ga0070681_100063915 301
154 3300005458 Ga0070681_10007202 Ga0070681_100072025 301
155 3300005458 Ga0070681_10038375 Ga0070681_100383752 301
156 3300005458 Ga0070681_10041787 Ga0070681_100417873 301
157 3300005459 Ga0068867_100007228 Ga0068867_10000722811 301
158 3300005466 Ga0070685_10001672 Ga0070685_100016727 301
159 3300005467 Ga0070706_100006024 Ga0070706_10000602413 301
160 3300005468 Ga0070707_100217166 Ga0070707_1002171662 301
161 3300005468 Ga0070707_100425846 Ga0070707_1004258462 301
162 3300005471 Ga0070698_100000549 Ga0070698_10000054921 301
163 3300005471 Ga0070698_100005315 Ga0070698_1000053153 301
164 3300005471 Ga0070698_100023653 Ga0070698_1000236533 301
165 3300005518 Ga0070699_100005284 Ga0070699_10000528410 301
166 3300005518 Ga0070699_100201415 Ga0070699_1002014152 301
167 3300005518 Ga0070699_100610114 Ga0070699_1006101141 301
168 3300005530 Ga0070679_100001104 Ga0070679_1000011049 301
169 3300005530 Ga0070679_100026366 Ga0070679_1000263661 301
170 3300005530 Ga0070679_100061318 Ga0070679_1000613186 301
171 3300005535 Ga0070684_100018816 Ga0070684_1000188161 301
172 3300005536 Ga0070697_100168027 Ga0070697_1001680273 301
173 3300005543 Ga0070672_100070423 Ga0070672_1000704232 301
174 3300005543 Ga0070672_100511339 Ga0070672_1005113391 301
175 3300005545 Ga0070695_100004843 Ga0070695_1000048433 301
176 3300005545 Ga0070695_100036667 Ga0070695_1000366673 301
177 3300005546 Ga0070696_100011714 Ga0070696_1000117142 301
178 3300005546 Ga0070696_100029786 Ga0070696_1000297862 301
179 3300005546 Ga0070696_100099229 Ga0070696_1000992291 301
180 3300005547 Ga0070693_100008306 Ga0070693_1000083063 301
181 3300005547 Ga0070693_100045480 Ga0070693_1000454804 301
182 3300005549 Ga0070704_100010246 Ga0070704_1000102461 301
183 3300005549 Ga0070704_100015795 Ga0070704_1000157953 301
184 3300005563 Ga0068855_100042947 Ga0068855_1000429474 301
185 3300005564 Ga0070664_100008431 Ga0070664_1000084313 301
186 3300005564 Ga0070664_100123951 Ga0070664_1001239512 301
187 3300005577 Ga0068857_100000358 Ga0068857_10000035830 301
188 3300005578 Ga0068854_100005944 Ga0068854_1000059449 301
189 3300005614 Ga0068856_100133704 Ga0068856_1001337042 301
190 3300005615 Ga0070702_100002690 Ga0070702_1000026902 301
191 3300005615 Ga0070702_100060302 Ga0070702_1000603021 301
192 3300005616 Ga0068852_100006913 Ga0068852_1000069134 301
193 3300005616 Ga0068852_100557160 Ga0068852_1005571601 301
194 3300005617 Ga0068859_100009678 Ga0068859_1000096781 301
195 3300005618 Ga0068864_100002272 Ga0068864_1000022728 301
196 3300005718 Ga0068866_10000358 Ga0068866_1000035814 301
197 3300005840 Ga0068870_10000025 Ga0068870_1000002541 301
198 3300005841 Ga0068863_100018070 Ga0068863_1000180702 301
199 3300005842 Ga0068858_100007959 Ga0068858_1000079594 301
200 3300005842 Ga0068858_100055290 Ga0068858_1000552903 301
201 3300005842 Ga0068858_100055381 Ga0068858_1000553813 301
202 3300005843 Ga0068860_100008914 Ga0068860_1000089148 301
203 3300005843 Ga0068860_100265278 Ga0068860_1002652782 301
204 3300005844 Ga0068862_100019145 Ga0068862_1000191451 301
205 3300005937 Ga0081455_10030414 Ga0081455_100304145 301
206 3300005937 Ga0081455_10062371 Ga0081455_100623712 301
207 3300005981 Ga0081538_10035222 Ga0081538_100352223 301
208 3300005983 Ga0081540_1000038 Ga0081540_100003882 301
209 3300005983 Ga0081540_1014076 Ga0081540_10140765 301
210 3300005985 Ga0081539_10018128 Ga0081539_100181282 301
211 3300006028 Ga0070717_10064905 Ga0070717_100649053 301
212 3300006038 Ga0075365_10031838 Ga0075365_100318383 301
213 3300006038 Ga0075365_10047058 Ga0075365_100470582 301
214 3300006163 Ga0070715_10000933 Ga0070715_100009339 301
215 3300006163 Ga0070715_10048925 Ga0070715_100489252 301
216 3300006177 Ga0075362_10023720 Ga0075362_100237203 301
217 3300006178 Ga0075367_10115850 Ga0075367_101158502 301
218 3300006358 Ga0068871_100002009 Ga0068871_1000020098 301
219 3300006358 Ga0068871_100005001 Ga0068871_10000500110 301
220 3300006844 Ga0075428_100004974 Ga0075428_10000497412 301
221 3300006844 Ga0075428_100182136 Ga0075428_1001821362 301
222 3300006846 Ga0075430_100034845 Ga0075430_1000348453 301
223 3300006847 Ga0075431_100070049 Ga0075431_1000700493 301
224 3300006852 Ga0075433_10317121 Ga0075433_103171212 301
225 3300006871 Ga0075434_100034134 Ga0075434_1000341344 301
226 3300006871 Ga0075434_100156525 Ga0075434_1001565252 301
227 3300006871 Ga0075434_100214377 Ga0075434_1002143772 301
228 3300006871 Ga0075434_100262183 Ga0075434_1002621831 301
229 3300006880 Ga0075429_100089118 Ga0075429_1000891183 301
230 3300006880 Ga0075429_100127863 Ga0075429_1001278632 301
231 3300006881 Ga0068865_100322860 Ga0068865_1003228601 301
232 3300006931 Ga0097620_100009681 Ga0097620_1000096811 301
233 3300007076 Ga0075435_100015827 Ga0075435_1000158273 301
234 3300007076 Ga0075435_100047682 Ga0075435_1000476823 301
235 3300007265 Ga0099794_10015673 Ga0099794_100156734 301
236 3300009036 Ga0105244_10097084 Ga0105244_100970841 301
237 3300009092 Ga0105250_10041125 Ga0105250_100411252 301
238 3300009093 Ga0105240_10070146 Ga0105240_100701464 301
239 3300009094 Ga0111539_10028243 Ga0111539_1002824310 301
240 3300009094 Ga0111539_10098897 Ga0111539_100988972 301
241 3300009098 Ga0105245_10030201 Ga0105245_100302016 301
242 3300009098 Ga0105245_10534173 Ga0105245_105341731 301
243 3300009101 Ga0105247_10020813 Ga0105247_100208133 301
244 3300009147 Ga0114129_10076945 Ga0114129_100769452 301
245 3300009147 Ga0114129_10078797 Ga0114129_100787975 301
246 3300009148 Ga0105243_10011552 Ga0105243_100115524 301
247 3300009148 Ga0105243_10057438 Ga0105243_100574382 301
248 3300009174 Ga0105241_10003634 Ga0105241_100036342 301
249 3300009176 Ga0105242_10056242 Ga0105242_100562422 301
250 3300009176 Ga0105242_10119232 Ga0105242_101192322 301
251 3300009545 Ga0105237_10016489 Ga0105237_100164893 301
252 3300009545 Ga0105237_10180294 Ga0105237_101802942 301
253 3300009553 Ga0105249_10022058 Ga0105249_100220588 301
254 3300009553 Ga0105249_10050755 Ga0105249_100507552 301
255 3300010375 Ga0105239_10188965 Ga0105239_101889652 301
256 3300011119 Ga0105246_10071004 Ga0105246_100710044 301
257 3300013100 Ga0157373_10136941 Ga0157373_101369412 301
258 3300013104 Ga0157370_10046630 Ga0157370_100466303 301
259 3300013104 Ga0157370_10062445 Ga0157370_100624452 301
260 3300013297 Ga0157378_10011414 Ga0157378_100114143 301
261 3300013306 Ga0163162_10167354 Ga0163162_101673543 301
262 3300013306 Ga0163162_10167770 Ga0163162_101677704 301
263 3300013306 Ga0163162_10481309 Ga0163162_104813092 301
264 3300013307 Ga0157372_10030789 Ga0157372_100307892 301
265 3300013307 Ga0157372_10083535 Ga0157372_100835352 301
266 3300013308 Ga0157375_10023326 Ga0157375_100233261 301
267 3300013308 Ga0157375_10525459 Ga0157375_105254592 301
268 3300013308 Ga0157375_10662276 Ga0157375_106622762 301
269 3300014325 Ga0163163_10013913 Ga0163163_100139132 301
270 3300014325 Ga0163163_10399489 Ga0163163_103994892 301
271 3300014326 Ga0157380_10236524 Ga0157380_102365242 301
272 3300014745 Ga0157377_10108000 Ga0157377_101080002 301
273 3300014968 Ga0157379_10056306 Ga0157379_100563062 301
274 3300014968 Ga0157379_10065106 Ga0157379_100651063 301
275 3300014968 Ga0157379_10294091 Ga0157379_102940911 301
276 3300014969 Ga0157376_10143494 Ga0157376_101434943 301
277 3300017792 Ga0163161_10112856 Ga0163161_101128562 301
278 3300021384 Ga0213876_10071428 Ga0213876_100714282 301
279 3300021384 Ga0213876_10078342 Ga0213876_100783422 301
280 3300021388 Ga0213875_10000116 Ga0213875_1000011665 301
281 3300025271 Ga0207666_1000252 Ga0207666_100025211 301
282 3300025893 Ga0207682_10000607 Ga0207682_1000060711 301
283 3300025898 Ga0207692_10019860 Ga0207692_100198602 301
284 3300025898 Ga0207692_10147747 Ga0207692_101477472 301
285 3300025905 Ga0207685_10012768 Ga0207685_100127682 301
286 3300025905 Ga0207685_10090399 Ga0207685_100903992 301
287 3300025905 Ga0207685_10106290 Ga0207685_101062901 301
288 3300025908 Ga0207643_10000397 Ga0207643_1000039721 301
289 3300025910 Ga0207684_10005624 Ga0207684_100056243 301
290 3300025912 Ga0207707_10002788 Ga0207707_100027882 301
291 3300025913 Ga0207695_10077085 Ga0207695_100770854 301
292 3300025915 Ga0207693_10001021 Ga0207693_100010211 301
293 3300025915 Ga0207693_10004915 Ga0207693_1000491512 301
294 3300025915 Ga0207693_10050585 Ga0207693_100505854 301
295 3300025915 Ga0207693_10087581 Ga0207693_100875811 301
296 3300025915 Ga0207693_10243292 Ga0207693_102432921 301
297 3300025916 Ga0207663_10029253 Ga0207663_100292533 301
298 3300025916 Ga0207663_10041700 Ga0207663_100417002 301
299 3300025916 Ga0207663_10053074 Ga0207663_100530742 301
300 3300025916 Ga0207663_10090505 Ga0207663_100905052 301
301 3300025917 Ga0207660_10105034 Ga0207660_101050341 301
302 3300025917 Ga0207660_10134951 Ga0207660_101349512 301
303 3300025918 Ga0207662_10038596 Ga0207662_100385963 301
304 3300025920 Ga0207649_10001199 Ga0207649_1000119910 301
305 3300025921 Ga0207652_10001750 Ga0207652_1000175012 301
306 3300025921 Ga0207652_10002218 Ga0207652_100022189 301
307 3300025921 Ga0207652_10021390 Ga0207652_100213902 301
308 3300025923 Ga0207681_10002243 Ga0207681_100022432 301
309 3300025923 Ga0207681_10002492 Ga0207681_1000249216 301
310 3300025923 Ga0207681_10132362 Ga0207681_101323621 301
311 3300025925 Ga0207650_10005388 Ga0207650_100053888 301
312 3300025926 Ga0207659_10000923 Ga0207659_1000092311 301
313 3300025927 Ga0207687_10005521 Ga0207687_100055213 301
314 3300025927 Ga0207687_10143912 Ga0207687_101439122 301
315 3300025928 Ga0207700_10025030 Ga0207700_100250302 301
316 3300025928 Ga0207700_10028263 Ga0207700_100282634 301
317 3300025928 Ga0207700_10176206 Ga0207700_101762062 301
318 3300025929 Ga0207664_10138137 Ga0207664_101381371 301
319 3300025931 Ga0207644_10000439 Ga0207644_1000043928 301
320 3300025931 Ga0207644_10040018 Ga0207644_100400182 301
321 3300025932 Ga0207690_10003249 Ga0207690_100032491 301
322 3300025932 Ga0207690_10030533 Ga0207690_100305333 301
323 3300025932 Ga0207690_10163835 Ga0207690_101638352 301
324 3300025933 Ga0207706_10016044 Ga0207706_100160444 301
325 3300025934 Ga0207686_10002903 Ga0207686_1000290310 301
326 3300025934 Ga0207686_10027193 Ga0207686_100271934 301
327 3300025935 Ga0207709_10001261 Ga0207709_1000126114 301
328 3300025936 Ga0207670_10008671 Ga0207670_100086714 301
329 3300025937 Ga0207669_10000616 Ga0207669_1000061610 301
330 3300025937 Ga0207669_10049627 Ga0207669_100496272 301
331 3300025938 Ga0207704_10009900 Ga0207704_100099003 301
332 3300025939 Ga0207665_10025929 Ga0207665_100259293 301
333 3300025940 Ga0207691_10106580 Ga0207691_101065802 301
334 3300025940 Ga0207691_10229119 Ga0207691_102291191 301
335 3300025941 Ga0207711_10166791 Ga0207711_101667912 301
336 3300025944 Ga0207661_10008182 Ga0207661_100081823 301
337 3300025945 Ga0207679_10000624 Ga0207679_100006244 301
338 3300025945 Ga0207679_10002602 Ga0207679_1000260213 301
339 3300025945 Ga0207679_10070676 Ga0207679_100706763 301
340 3300025945 Ga0207679_10144205 Ga0207679_101442052 301
341 3300025960 Ga0207651_10192564 Ga0207651_101925642 301
342 3300025961 Ga0207712_10021901 Ga0207712_100219012 301
343 3300025972 Ga0207668_10007113 Ga0207668_100071131 301
344 3300025972 Ga0207668_10474778 Ga0207668_104747781 301
345 3300025981 Ga0207640_10004625 Ga0207640_100046259 301
346 3300025986 Ga0207658_10022934 Ga0207658_100229342 301
347 3300026023 Ga0207677_10001740 Ga0207677_100017409 301
348 3300026035 Ga0207703_10004099 Ga0207703_1000409911 301
349 3300026041 Ga0207639_10106772 Ga0207639_101067722 301
350 3300026075 Ga0207708_10200306 Ga0207708_102003062 301
351 3300026078 Ga0207702_10074432 Ga0207702_100744322 301
352 3300026088 Ga0207641_10012663 Ga0207641_100126635 301
353 3300026095 Ga0207676_10003096 Ga0207676_100030963 301
354 3300026116 Ga0207674_10001342 Ga0207674_1000134228 301
355 3300026118 Ga0207675_100539688 Ga0207675_1005396881 301
356 3300026121 Ga0207683_10037184 Ga0207683_100371842 301
357 3300026142 Ga0207698_10024262 Ga0207698_100242624 301
358 3300026142 Ga0207698_10523414 Ga0207698_105234141 301
359 3300027907 Ga0207428_10005539 Ga0207428_1000553914 301
360 3300028379 Ga0268266_10254039 Ga0268266_102540392 301
361 3300028380 Ga0268265_10023842 Ga0268265_100238423 301
362 3300028381 Ga0268264_10030329 Ga0268264_100303292 301
363 3300028381 Ga0268264_10166773 Ga0268264_101667732 301
364 3300028556 Ga0265337_1000392 Ga0265337_10003928 301
365 3300028556 Ga0265337_1000720 Ga0265337_10007207 301
366 3300028573 Ga0265334_10001597 Ga0265334_100015976 301
367 3300028800 Ga0265338_10009296 Ga0265338_100092965 301
368 3300028800 Ga0265338_10012307 Ga0265338_100123076 301
369 3300031235 Ga0265330_10003304 Ga0265330_100033046 301
370 3300031238 Ga0265332_10001684 Ga0265332_1000168411 301
371 3300031241 Ga0265325_10000030 Ga0265325_10000030110 301
372 3300031241 Ga0265325_10007651 Ga0265325_100076514 301
373 3300031241 Ga0265325_10010445 Ga0265325_100104451 301
374 3300031241 Ga0265325_10100121 Ga0265325_101001211 301
375 3300031242 Ga0265329_10004865 Ga0265329_100048654 301
376 3300031247 Ga0265340_10010922 Ga0265340_100109223 301
377 3300031247 Ga0265340_10022391 Ga0265340_100223914 301
378 3300031249 Ga0265339_10014749 Ga0265339_100147494 301
379 3300031249 Ga0265339_10033522 Ga0265339_100335222 301
380 3300031249 Ga0265339_10034146 Ga0265339_100341462 301
381 3300031250 Ga0265331_10010420 Ga0265331_100104204 301
382 3300031344 Ga0265316_10034358 Ga0265316_100343585 301
383 3300031344 Ga0265316_10092760 Ga0265316_100927602 301
384 3300031344 Ga0265316_10239069 Ga0265316_102390691 301
385 3300031548 Ga0307408_100000406 Ga0307408_10000040619 301
386 3300031595 Ga0265313_10006079 Ga0265313_100060795 301
387 3300031595 Ga0265313_10009247 Ga0265313_100092476 301
388 3300031595 Ga0265313_10018585 Ga0265313_100185852 301
389 3300031595 Ga0265313_10127312 Ga0265313_101273121 301
390 3300031595 Ga0265313_10140348 Ga0265313_101403481 301
391 3300031711 Ga0265314_10050143 Ga0265314_100501433 301
392 3300031712 Ga0265342_10001892 Ga0265342_1000189219 301
393 3300031712 Ga0265342_10007645 Ga0265342_100076457 301
394 3300031712 Ga0265342_10015998 Ga0265342_100159984 301
395 3300031911 Ga0307412_10000207 Ga0307412_1000020724 301
396 3300032005 Ga0307411_10000086 Ga0307411_1000008628 301
397 3300034816 Ga0373930_0010544 Ga0373930_0010544_680_1585 301
398 3300034819 Ga0373958_0002820 Ga0373958_0002820_202_1107 301
399 3300035084 Ga0373928_0004182 Ga0373928_0004182_1117_2022 301
400 3300035086 Ga0373934_0014474 Ga0373934_0014474_1213_2136 301
401 3300035089 Ga0373944_0003655 Ga0373944_0003655_2578_3696 301
402 3300035089 Ga0373944_0026075 Ga0373944_0026075_692_1597 301
403 3300035090 Ga0373949_0001922 Ga0373949_0001922_2962_3867 301
404 3300035092 Ga0373952_0002747 Ga0373952_0002747_707_1612 301
405 3300035111 Ga0373923_0092203 Ga0373923_0092203_95_1000 301
406 3300035112 Ga0373932_0070550 Ga0373932_0070550_116_1021 301
407 3300035113 Ga0373936_0009931 Ga0373936_0009931_1880_2998 301
408 3300035113 Ga0373936_0067196 Ga0373936_0067196_120_1025 301
409 3300035115 Ga0373941_0004877 Ga0373941_0004877_190_1095 301
410 3300035116 Ga0373945_0007252 Ga0373945_0007252_1786_2904 301
411 3300035117 Ga0373953_0022038 Ga0373953_0022038_848_1771 301
412 3300035117 Ga0373953_0032731 Ga0373953_0032731_525_1430 301
413 3300035119 Ga0373956_0005163 Ga0373956_0005163_3146_4138 301
414 3300035119 Ga0373956_0030239 Ga0373956_0030239_292_1215 301
415 3300035119 Ga0373956_0033078 Ga0373956_0033078_996_1919 301
416 3300035120 Ga0373957_0019480 Ga0373957_0019480_28_951 301
417 3300035121 Ga0373960_0002981 Ga0373960_0002981_1628_2533 301
418 3300035170 Ga0373943_0000467 Ga0373943_0000467_11640_12758 301
419 3300035170 Ga0373943_0059214 Ga0373943_0059214_517_1422 301
420 3300035170 Ga0373943_0150925 Ga0373943_0150925_217_1143 301
421 3300035171 Ga0373946_0000643 Ga0373946_0000643_5631_6749 301
422 3300035172 Ga0373955_0003642 Ga0373955_0003642_5710_6633 301
423 3300035172 Ga0373955_0019547 Ga0373955_0019547_2067_2990 301
424 3300035172 Ga0373955_0255867 Ga0373955_0255867_41_964 301
425 3300035241 Ga0373961_0001004 Ga0373961_0001004_2837_3742 301
426 3300035242 Ga0373962_0000894 Ga0373962_0000894_1333_2238 301
427 3300035410 Ga0373924_0011363 Ga0373924_0011363_473_1396 301
428 3300035410 Ga0373924_0013011 Ga0373924_0013011_896_1801 301
429 3300035691 Ga0373931_0001241 Ga0373931_0001241_9567_10472 301
430 3300035691 Ga0373931_0228569 Ga0373931_0228569_44_949 301
431 3300035692 Ga0373935_0008851 Ga0373935_0008851_1353_2471 301
432 3300035692 Ga0373935_0024495 Ga0373935_0024495_1756_2661 301
433 3300035692 Ga0373935_0025807 Ga0373935_0025807_1192_2115 301
434 3300035692 Ga0373935_0286332 Ga0373935_0286332_33_956 301
435 3300035692 Ga0373935_0379097 Ga0373935_0379097_17_940 301
436 3300035695 Ga0373927_0002618 Ga0373927_0002618_11046_12164 301
437 3300035695 Ga0373927_0020010 Ga0373927_0020010_3084_3998 301
438 3300035695 Ga0373927_0094989 Ga0373927_0094989_803_1708 301
439 3300035695 Ga0373927_0278626 Ga0373927_0278626_152_1075 301
440 3300035724 Ga0373933_0002265 Ga0373933_0002265_5827_6750 301
441 3300035725 Ga0373947_0079939 Ga0373947_0079939_467_1393 301
442 3300035725 Ga0373947_0147302 Ga0373947_0147302_294_1199 301
443 3300035725 Ga0373947_0222156 Ga0373947_0222156_96_1019 301
444 3300036401 Ga0373937_0005767 Ga0373937_0005767_5527_6450 301
445 3300036401 Ga0373937_0017542 Ga0373937_0017542_3678_4601 301
446 3300036401 Ga0373937_0074636 Ga0373937_0074636_1070_1975 301
447 3300036401 Ga0373937_0091544 Ga0373937_0091544_1594_2511 301
448 3300036401 Ga0373937_0165276 Ga0373937_0165276_732_1655 301
449 3300037068 Ga0373925_0002414 Ga0373925_0002414_2508_3626 301
450 3300037068 Ga0373925_0010109 Ga0373925_0010109_5843_6766 301
451 3300037068 Ga0373925_0116732 Ga0373925_0116732_294_1199 301
452 3300037853 Ga0436364_0043682 Ga0436364_0043682_3447_4370 301
453 3300037853 Ga0436364_0075263 Ga0436364_0075263_524_1450 301
454 3300037853 Ga0436364_0510596 Ga0436364_0510596_135_1055 301
455 3300037853 Ga0436364_0886859 Ga0436364_0886859_3533_4450 301
456 3300037853 Ga0436364_1245875 Ga0436364_1245875_2192_3112 301
457 3300039437 Ga0436365_0281080 Ga0436365_0281080_2360_3307 301
458 3300039437 Ga0436365_0534961 Ga0436365_0534961_2712_3644 301
459 3300039437 Ga0436365_0634949 Ga0436365_0634949_253_1170 301
460 3300039437 Ga0436365_0642359 Ga0436365_0642359_2243_3169 301
461 3300039437 Ga0436365_0787440 Ga0436365_0787440_686_1615 301
462 3300039438 Ga0436360_0003318 Ga0436360_0003318_65_991 301
463 3300039438 Ga0436360_0141957 Ga0436360_0141957_51_968 301
464 3300039438 Ga0436360_0627708 Ga0436360_0627708_911_1834 301
465 3300039438 Ga0436360_1105762 Ga0436360_1105762_265_1188 301
466 3300039447 Ga0436361_0017372 Ga0436361_0017372_4724_5650 301
467 3300039453 Ga0436362_0556527 Ga0436362_0556527_33_959 301
468 3300039453 Ga0436362_0718952 Ga0436362_0718952_1395_2321 301
469 3300039453 Ga0436362_0881111 Ga0436362_0881111_15_938 301
470 3300039453 Ga0436362_1245208 Ga0436362_1245208_587_1534 301
471 3300039453 Ga0436362_1294643 Ga0436362_1294643_24_941 301
472 3300044684 Ga0466966_0047858 Ga0466966_0047858_204_1115 301
473 3300044693 Ga0466961_0200253 Ga0466961_0200253_282_1193 301
474 3300044694 Ga0466963_0101326 Ga0466963_0101326_724_1635 301
475 3300044694 Ga0466963_0388925 Ga0466963_0388925_12_926 301
476 3300044842 Ga0466957_0072254 Ga0466957_0072254_10_921 301
477 3300045049 Ga0466959_0014641 Ga0466959_0014641_728_1639 301
478 3300045051 Ga0451576_0317321 Ga0451576_0317321_44_991 301
479 3300045836 Ga0466958_0109428 Ga0466958_0109428_333_1244 301
480 3300045976 Ga0466967_0095636 Ga0466967_0095636_1464_2378 301
481 3300045976 Ga0466967_0192925 Ga0466967_0192925_546_1472 301
482 3300046454 Ga0495592_0012135 Ga0495592_0012135_1072_1995 301
483 3300046454 Ga0495592_0034140 Ga0495592_0034140_1582_2487 301
484 3300046454 Ga0495592_0103422 Ga0495592_0103422_679_1596 301
485 3300046455 Ga0495603_0067645 Ga0495603_0067645_840_1745 301
486 3300046457 Ga0495590_0057668 Ga0495590_0057668_289_1215 301
487 3300046459 Ga0495629_0027369 Ga0495629_0027369_2368_3273 301
488 3300046459 Ga0495629_0068543 Ga0495629_0068543_1029_1949 301
489 3300046459 Ga0495629_0217994 Ga0495629_0217994_115_1038 301
490 3300046460 Ga0495638_0009313 Ga0495638_0009313_1262_2185 301
491 3300046462 Ga0495651_0007302 Ga0495651_0007302_6318_7241 301
492 3300046462 Ga0495651_0033242 Ga0495651_0033242_2967_3872 301
493 3300046462 Ga0495651_0046027 Ga0495651_0046027_439_1362 301
494 3300046463 Ga0495653_0089703 Ga0495653_0089703_428_1345 301
495 3300046463 Ga0495653_0104006 Ga0495653_0104006_1059_1964 301
496 3300046463 Ga0495653_0195142 Ga0495653_0195142_211_1134 301
497 3300046472 Ga0495580_0018920 Ga0495580_0018920_2746_3864 301
498 3300046472 Ga0495580_0082379 Ga0495580_0082379_1012_1917 301
499 3300046475 Ga0495639_0029020 Ga0495639_0029020_1306_2424 301
500 3300046475 Ga0495639_0068423 Ga0495639_0068423_337_1242 301
501 3300046476 Ga0495662_0006819 Ga0495662_0006819_4065_5183 301
502 3300046476 Ga0495662_0066293 Ga0495662_0066293_128_1033 301
503 3300046477 Ga0495664_0002260 Ga0495664_0002260_468_1460 301
504 3300046477 Ga0495664_0118166 Ga0495664_0118166_205_1128 301
505 3300046491 Ga0495584_0010207 Ga0495584_0010207_1091_2014 301
506 3300046491 Ga0495584_0019599 Ga0495584_0019599_2229_3155 301
507 3300046491 Ga0495584_0045760 Ga0495584_0045760_1255_2175 301
508 3300046492 Ga0495585_0032795 Ga0495585_0032795_762_1688 301
509 3300046501 Ga0495607_0046310 Ga0495607_0046310_293_1219 301
510 3300046511 Ga0495608_0005826 Ga0495608_0005826_4341_5246 301
511 3300046511 Ga0495608_0042818 Ga0495608_0042818_329_1252 301
512 3300046511 Ga0495608_0052624 Ga0495608_0052624_261_1178 301
513 3300046511 Ga0495608_0113703 Ga0495608_0113703_750_1673 301
514 3300046514 Ga0495618_0053716 Ga0495618_0053716_774_1679 301
515 3300046514 Ga0495618_0092656 Ga0495618_0092656_821_1738 301
516 3300046514 Ga0495618_0098854 Ga0495618_0098854_64_1182 301
517 3300046516 Ga0495628_0005312 Ga0495628_0005312_4823_5746 301
518 3300046516 Ga0495628_0036834 Ga0495628_0036834_2901_3824 301
519 3300046516 Ga0495628_0094735 Ga0495628_0094735_1255_2160 301
520 3300046516 Ga0495628_0200468 Ga0495628_0200468_560_1486 301
521 3300046517 Ga0495630_0044480 Ga0495630_0044480_1726_2844 301
522 3300046517 Ga0495630_0165190 Ga0495630_0165190_241_1146 301
523 3300046526 Ga0495666_0012458 Ga0495666_0012458_704_1822 301
524 3300046528 Ga0495642_0095646 Ga0495642_0095646_194_1117 301
525 3300046529 Ga0495652_0005594 Ga0495652_0005594_10426_11349 301
526 3300046529 Ga0495652_0135282 Ga0495652_0135282_582_1487 301
527 3300046531 Ga0495665_0084294 Ga0495665_0084294_454_1359 301
528 3300046533 Ga0495640_0007932 Ga0495640_0007932_7264_8169 301
529 3300046533 Ga0495640_0023762 Ga0495640_0023762_1552_2481 301
530 3300046533 Ga0495640_0130544 Ga0495640_0130544_434_1339 301
531 3300046533 Ga0495640_0130775 Ga0495640_0130775_267_1190 301
532 3300046533 Ga0495640_0158976 Ga0495640_0158976_469_1395 301
533 3300046535 Ga0495586_0015460 Ga0495586_0015460_3106_4026 301
534 3300046536 Ga0495587_0023570 Ga0495587_0023570_1072_1995 301
535 3300046537 Ga0495598_0026592 Ga0495598_0026592_367_1290 301
536 3300046543 Ga0495645_0001619 Ga0495645_0001619_4375_5298 301
537 3300046543 Ga0495645_0105489 Ga0495645_0105489_111_1103 301
538 3300046543 Ga0495645_0210678 Ga0495645_0210678_264_1169 301
539 3300046557 Ga0495622_0031552 Ga0495622_0031552_288_1193 301
540 3300046559 Ga0495667_0006860 Ga0495667_0006860_1659_2582 301
541 3300046559 Ga0495667_0009135 Ga0495667_0009135_1540_2463 301
542 3300046559 Ga0495667_0043732 Ga0495667_0043732_896_1801 301
543 3300046642 Ga0495634_0246008 Ga0495634_0246008_69_974 301
544 3300046663 Ga0495635_0006683 Ga0495635_0006683_1356_2261 301
545 3300046663 Ga0495635_0047122 Ga0495635_0047122_110_1033 301
546 3300046663 Ga0495635_0072599 Ga0495635_0072599_939_1844 301
547 3300046663 Ga0495635_0094348 Ga0495635_0094348_626_1549 301
548 3300046663 Ga0495635_0167339 Ga0495635_0167339_277_1200 301
549 3300046664 Ga0495659_0003234 Ga0495659_0003234_4141_5064 301
550 3300046664 Ga0495659_0007612 Ga0495659_0007612_44_967 301
551 3300046664 Ga0495659_0018418 Ga0495659_0018418_787_1710 301
552 3300046674 Ga0495588_0017207 Ga0495588_0017207_1678_2583 301
553 3300046675 Ga0495657_0046789 Ga0495657_0046789_272_1195 301
554 3300046678 Ga0495599_0003169 Ga0495599_0003169_3170_4093 301
555 3300046679 Ga0495623_0004051 Ga0495623_0004051_6093_7016 301
556 3300046679 Ga0495623_0166777 Ga0495623_0166777_36_941 301
557 3300046680 Ga0495646_0030081 Ga0495646_0030081_733_1638 301
558 3300046681 Ga0495647_0046530 Ga0495647_0046530_129_1034 301
559 3300046683 Ga0495658_0048722 Ga0495658_0048722_865_1770 301
560 3300046684 Ga0495669_0083771 Ga0495669_0083771_186_1091 301
561 3300046689 Ga0495613_0039460 Ga0495613_0039460_2109_3227 301
562 3300046689 Ga0495613_0323786 Ga0495613_0323786_90_995 301
563 3300046690 Ga0495624_0009872 Ga0495624_0009872_4084_5202 301
564 3300046690 Ga0495624_0195461 Ga0495624_0195461_158_1063 301
565 3300046692 Ga0495671_0123816 Ga0495671_0123816_158_1084 301
566 3300046809 Ga0495600_0000464 Ga0495600_0000464_4565_5488 301
567 3300046809 Ga0495600_0010301 Ga0495600_0010301_481_1386 301
568 3300046809 Ga0495600_0095554 Ga0495600_0095554_602_1525 301
569 3300046809 Ga0495600_0141967 Ga0495600_0141967_309_1226 301
570 3300047315 Ga0495581_0044753 Ga0495581_0044753_995_1918 301
571 3300047317 Ga0495604_0004562 Ga0495604_0004562_3687_4610 301
572 3300047317 Ga0495604_0008733 Ga0495604_0008733_1522_2445 301
573 3300047317 Ga0495604_0158914 Ga0495604_0158914_118_1023 301
574 3300047318 Ga0495636_0011501 Ga0495636_0011501_1257_2180 301
575 3300047319 Ga0495674_0011078 Ga0495674_0011078_7520_8425 301
576 3300047319 Ga0495674_0068120 Ga0495674_0068120_1070_1993 301
577 3300047319 Ga0495674_0441322 Ga0495674_0441322_67_990 301
578 3300047321 Ga0495676_0123944 Ga0495676_0123944_796_1701 301
579 3300047322 Ga0495680_0006696 Ga0495680_0006696_262_1167 301
580 3300047322 Ga0495680_0007490 Ga0495680_0007490_8025_8948 301
581 3300047322 Ga0495680_0024923 Ga0495680_0024923_1689_2606 301
582 3300047322 Ga0495680_0272499 Ga0495680_0272499_138_1061 301
583 3300047444 Ga0495675_0005984 Ga0495675_0005984_198_1103 301
584 3300047444 Ga0495675_0133131 Ga0495675_0133131_214_1149 301
585 3300047447 Ga0495685_018054 Ga0495685_018054_514_1437 301
586 3300047447 Ga0495685_067586 Ga0495685_067586_206_1129 301
587 3300047471 Ga0495684_0001167 Ga0495684_0001167_19536_20654 301
588 3300047471 Ga0495684_0294977 Ga0495684_0294977_98_1015 301
589 3300047673 Ga0495593_0034679 Ga0495593_0034679_809_1927 301
590 3300048088 Ga0495602_0011056 Ga0495602_0011056_5532_6455 301
591 3300048088 Ga0495602_0078129 Ga0495602_0078129_749_1654 301
592 3300048088 Ga0495602_0095095 Ga0495602_0095095_1343_2266 301
593 3300048903 Ga0496100_0006789 Ga0496100_0006789_4793_5698 301
594 3300048903 Ga0496100_0060843 Ga0496100_0060843_604_1509 301
595 3300048903 Ga0496100_0095785 Ga0496100_0095785_434_1342 301
596 3300048904 Ga0496101_0004666 Ga0496101_0004666_17_922 301
597 3300048904 Ga0496101_0005617 Ga0496101_0005617_1285_2190 301
598 3300048904 Ga0496101_0027626 Ga0496101_0027626_2664_3569 301
599 3300048904 Ga0496101_0452554 Ga0496101_0452554_14_937 301
600 3300048905 Ga0496102_0005207 Ga0496102_0005207_9307_10212 301
601 3300048905 Ga0496102_0021515 Ga0496102_0021515_1510_2415 301
602 3300048905 Ga0496102_0037459 Ga0496102_0037459_1493_2413 301
603 3300048905 Ga0496102_0069311 Ga0496102_0069311_820_1725 301
604 3300048905 Ga0496102_0543607 Ga0496102_0543607_89_994 301
605 3300048906 Ga0496103_0005219 Ga0496103_0005219_6827_7753 301
606 3300048906 Ga0496103_0017408 Ga0496103_0017408_707_1612 301
607 3300048906 Ga0496103_0026963 Ga0496103_0026963_1092_1997 301
608 3300048907 Ga0496104_0000065 Ga0496104_0000065_21293_22216 301
609 3300048907 Ga0496104_0035308 Ga0496104_0035308_1129_2034 301
610 3300048907 Ga0496104_0097234 Ga0496104_0097234_1153_2058 301
611 3300048908 Ga0496105_0000530 Ga0496105_0000530_18598_19521 301
612 3300048908 Ga0496105_0013007 Ga0496105_0013007_4266_5171 301
613 3300048908 Ga0496105_0121987 Ga0496105_0121987_377_1300 301
614 3300048908 Ga0496105_0142959 Ga0496105_0142959_1004_1909 301
615 3300048909 Ga0496106_0004911 Ga0496106_0004911_5709_6614 301
616 3300048909 Ga0496106_0045419 Ga0496106_0045419_163_1068 301
617 3300048909 Ga0496106_0059882 Ga0496106_0059882_1445_2350 301
618 3300048910 Ga0496107_0003623 Ga0496107_0003623_7677_8582 301
619 3300048910 Ga0496107_0137194 Ga0496107_0137194_468_1373 301
620 3300048911 Ga0496108_0006182 Ga0496108_0006182_3086_4012 301
621 3300048911 Ga0496108_0276755 Ga0496108_0276755_214_1119 301
622 3300048912 Ga0496109_0006148 Ga0496109_0006148_2052_2957 301
623 3300048912 Ga0496109_0063220 Ga0496109_0063220_941_1846 301
624 3300048912 Ga0496109_0090911 Ga0496109_0090911_1583_2488 301
625 3300048912 Ga0496109_0160081 Ga0496109_0160081_53_976 301
626 3300048913 Ga0496110_0141607 Ga0496110_0141607_294_1199 301
627 3300048913 Ga0496110_0316310 Ga0496110_0316310_305_1210 301
628 3300048914 Ga0496111_0050442 Ga0496111_0050442_894_1799 301
629 3300048914 Ga0496111_0319806 Ga0496111_0319806_67_993 301
630 3300048915 Ga0496112_0063064 Ga0496112_0063064_537_1460 301
631 3300048915 Ga0496112_0081582 Ga0496112_0081582_452_1357 301
632 3300048915 Ga0496112_0312652 Ga0496112_0312652_401_1306 301
633 3300048916 Ga0496113_0012326 Ga0496113_0012326_3797_4702 301
634 3300048916 Ga0496113_0027032 Ga0496113_0027032_573_1478 301
635 3300048917 Ga0496114_0013198 Ga0496114_0013198_4997_5905 301
636 3300048917 Ga0496114_0108737 Ga0496114_0108737_1268_2191 301
637 3300048918 Ga0496115_0009176 Ga0496115_0009176_4511_5434 301
638 3300048918 Ga0496115_0047492 Ga0496115_0047492_2484_3389 301
639 3300048918 Ga0496115_0054214 Ga0496115_0054214_45_950 301
640 3300048918 Ga0496115_0137716 Ga0496115_0137716_404_1309 301
641 3300048918 Ga0496115_0140429 Ga0496115_0140429_607_1527 301
642 3300048918 Ga0496115_0200037 Ga0496115_0200037_265_1170 301
643 3300048920 Ga0496117_0000024 Ga0496117_0000024_204584_205504 301
644 3300048921 Ga0496118_0000014 Ga0496118_0000014_213558_214478 301
645 3300048922 Ga0496119_0038923 Ga0496119_0038923_57_977 301
646 3300048924 Ga0496121_0115632 Ga0496121_0115632_930_1850 301
647 3300048927 Ga0496124_0010253 Ga0496124_0010253_317_1237 301
648 3300048929 Ga0496126_0007905 Ga0496126_0007905_6198_7118 301
649 3300048929 Ga0496126_0162504 Ga0496126_0162504_532_1455 301
650 3300049571 Ga0501034_0012903 Ga0501034_0012903_842_1747 301
651 3300049571 Ga0501034_0120734 Ga0501034_0120734_263_1186 301
652 3300049571 Ga0501034_0139317 Ga0501034_0139317_1056_1976 301
653 3300049574 Ga0501038_0073437 Ga0501038_0073437_1474_2394 301
654 3300049581 Ga0501047_0122447 Ga0501047_0122447_583_1503 301
655 3300049587 Ga0501071_0034927 Ga0501071_0034927_543_1466 301
656 3300049587 Ga0501071_0054405 Ga0501071_0054405_252_1181 301
657 3300049587 Ga0501071_0311314 Ga0501071_0311314_233_1138 301
658 3300049588 Ga0501072_0003275 Ga0501072_0003275_9788_10711 301
659 3300049589 Ga0501073_0123408 Ga0501073_0123408_420_1343 301
660 3300049591 Ga0501075_0020575 Ga0501075_0020575_1045_1968 301
661 3300049591 Ga0501075_0314342 Ga0501075_0314342_196_1125 301
662 3300049591 Ga0501075_0381451 Ga0501075_0381451_31_954 301
663 3300049592 Ga0501076_0030342 Ga0501076_0030342_752_1681 301
664 3300049592 Ga0501076_0103432 Ga0501076_0103432_516_1439 301
665 3300049592 Ga0501076_0268297 Ga0501076_0268297_73_996 301
666 3300049593 Ga0501077_0097489 Ga0501077_0097489_815_1744 301
667 3300049741 Ga0501079_0281091 Ga0501079_0281091_187_1116 301
668 3300049743 Ga0501081_0052195 Ga0501081_0052195_49_972 301
669 3300049743 Ga0501081_0326705 Ga0501081_0326705_34_963 301
670 3300049744 Ga0501083_0106036 Ga0501083_0106036_422_1342 301
671 3300050491 nmdc:mga00v17_124093_c1 nmdc:mga00v17_124093_c1_293_1219 301
672 3300050492 nmdc:mga0yw44_19721_c1 nmdc:mga0yw44_19721_c1_2509_3444 301
673 3300050492 nmdc:mga0yw44_37073_c1 nmdc:mga0yw44_37073_c1_1427_2353 301
674 3300050494 nmdc:mga06z11_137253_c1 nmdc:mga06z11_137253_c1_101_1036 301
675 3300050507 nmdc:mga05p37_1643_c1 nmdc:mga05p37_1643_c1_21379_22314 301
676 3300050507 nmdc:mga05p37_232221_c1 nmdc:mga05p37_232221_c1_274_1257 301
677 3300050507 nmdc:mga05p37_26039_c1 nmdc:mga05p37_26039_c1_1628_2560 301
678 3300050507 nmdc:mga05p37_263698_c1 nmdc:mga05p37_263698_c1_393_1316 301
679 3300050507 nmdc:mga05p37_41974_c1 nmdc:mga05p37_41974_c1_110_1042 301
680 3300050507 nmdc:mga05p37_447443_c1 nmdc:mga05p37_447443_c1_202_1128 301
681 3300050507 nmdc:mga05p37_65277_c1 nmdc:mga05p37_65277_c1_740_1663 301
682 3300050508 nmdc:mga09592_348162_c1 nmdc:mga09592_348162_c1_240_1163 301
683 3300050508 nmdc:mga09592_36096_c1 nmdc:mga09592_36096_c1_2361_3293 301
684 3300050510 nmdc:mga06r32_44199_c1 nmdc:mga06r32_44199_c1_1635_2558 301
685 3300050511 nmdc:mga08y16_12539_c1 nmdc:mga08y16_12539_c1_48_953 301
686 3300050511 nmdc:mga08y16_371085_c1 nmdc:mga08y16_371085_c1_114_1037 301
687 3300050512 nmdc:mga0n895_104882_c1 nmdc:mga0n895_104882_c1_1410_2333 301
688 3300050512 nmdc:mga0n895_19417_c1 nmdc:mga0n895_19417_c1_3576_4499 301
689 3300050512 nmdc:mga0n895_55209_c1 nmdc:mga0n895_55209_c1_1285_2190 301
690 3300050512 nmdc:mga0n895_7304_c1 nmdc:mga0n895_7304_c1_1573_2478 301
691 3300050513 nmdc:mga0rr50_412421_c1 nmdc:mga0rr50_412421_c1_207_1130 301
692 3300050513 nmdc:mga0rr50_54668_c1 nmdc:mga0rr50_54668_c1_1935_2858 301
693 3300050514 nmdc:mga08x19_8440_c1 nmdc:mga08x19_8440_c1_2999_3922 301
694 3300050514 nmdc:mga08x19_85522_c1 nmdc:mga08x19_85522_c1_482_1405 301
695 3300050515 nmdc:mga0a205_303384_c1 nmdc:mga0a205_303384_c1_161_1093 301
696 3300053077 Ga0495601_0000111 Ga0495601_0000111_38751_39674 301
697 3300053077 Ga0495601_0000806 Ga0495601_0000806_10781_11698 301
698 3300053077 Ga0495601_0001346 Ga0495601_0001346_5465_6388 301
699 3300053077 Ga0495601_0002531 Ga0495601_0002531_5887_6792 301
700 3300053077 Ga0495601_0081704 Ga0495601_0081704_805_1731 301
701 3300053077 Ga0495601_0152001 Ga0495601_0152001_53_976 301
702 3300053078 Ga0495612_0001026 Ga0495612_0001026_8328_9251 301
703 3300053078 Ga0495612_0003065 Ga0495612_0003065_1127_2050 301
704 3300053078 Ga0495612_0010383 Ga0495612_0010383_2066_2983 301
705 3300053078 Ga0495612_0032068 Ga0495612_0032068_725_1630 301
706 3300053084 Ga0495595_0000447 Ga0495595_0000447_9861_10784 301
707 3300053084 Ga0495595_0018267 Ga0495595_0018267_23_928 301
708 3300053084 Ga0495595_0048168 Ga0495595_0048168_314_1222 301
709 3300053084 Ga0495595_0085033 Ga0495595_0085033_484_1410 301
710 3300053085 Ga0495619_0000307 Ga0495619_0000307_25362_26279 301
711 3300053085 Ga0495619_0001436 Ga0495619_0001436_9363_10286 301
712 3300053085 Ga0495619_0002791 Ga0495619_0002791_9940_10845 301
713 3300053085 Ga0495619_0024455 Ga0495619_0024455_2111_3016 301
714 3300053085 Ga0495619_0096468 Ga0495619_0096468_298_1221 301
715 3300053117 Ga0500593_001418 Ga0500593_001418_843_1763 301
716 3300060353 Ga0501082_0012546 Ga0501082_0012546_3924_4847 301
717 3300060353 Ga0501082_0082080 Ga0501082_0082080_585_1505 301
718 3300060353 Ga0501082_0117266 Ga0501082_0117266_865_1770 301
719 3300060353 Ga0501082_0248574 Ga0501082_0248574_325_1245 301
720 3300060353 Ga0501082_0485672 Ga0501082_0485672_125_1048 301
721 3300061719 Ga0466962_0181377 Ga0466962_0181377_34_945 301
722 3300061734 Ga0530510_0100967 Ga0530510_0100967_855_1781 301
723 3300061734 Ga0530510_0200319 Ga0530510_0200319_324_1253 301

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7927 1 287
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.7792 1 297
4h6d-assembly4.cif.gz_E crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae 0.7737 1 297
4nmy-assembly2.cif.gz_B crystal structure of the thiamin-bound form of substrate-binding protein of abc transporter from clostridium difficile 0.773 1 298
4h6d-assembly2.cif.gz_B crystal structure of plp-soaked hmp synthase thi5 from s. cerevisiae 0.7655 1 297
ID Description Score Start End Superfamily
4h6dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8118 1 297 3.40.190.10
3k2dB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.793 1 58 3.40.190.10
3ix1B01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7691 1 298 3.40.190.10
1xs5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7521 2 82 3.40.190.10
af_Q869K3_189_310_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.7519 1 56 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A1F9G1K0-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9907 1 281
AF-A0A1F9G1K0-F1-model_v4 Nitrate ABC transporter substrate-binding protein 0.9837 1 281
AF-A0A536SR51-F1-model_v4 ABC transporter substrate-binding protein 0.9834 1 298
AF-A0A536SR51-F1-model_v4 ABC transporter substrate-binding protein 0.9608 1 298
AF-A0A536WG91-F1-model_v4 ABC transporter substrate-binding protein 0.9531 1 190

Feature Viewer

pLDDT pTM Quality
95.13 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map