F477431

General Info

Members Datasets Scaffolds Average Seq Length
722 336 1444 106

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1363774|Ga0436364_1363774_2935_3327
Length 130
Sequence MTPALDGGNMARAMQMKREGQMLALWVKVRVKPEERERFLKAIEVDALGSERDEPGCLRFNVLRDQQDQNVYYFFEVYRDEAALEAHRAAPHYAVWRAAADTLDGPAEATRCTSVFPSLAEYWEKRGASA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
222 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
241 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
242 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
243 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
247 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.08
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 14.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1363774 3300037853 Bacteria 3872
2 Ga0065712_10165001 3300005290 Bacteria 1255
3 Ga0065715_10121377 3300005293 Bacteria 2231
4 Ga0070676_10010612 3300005328 Bacteria 4998
5 Ga0070683_100074566 3300005329 Bacteria 3169
6 Ga0070683_100451157 3300005329 Unclassified 1227
7 Ga0070670_100002086 3300005331 Bacteria 16383
8 Ga0070670_101412345 3300005331 Unclassified 638
9 Ga0068869_100000242 3300005334 Bacteria 28762
10 Ga0068869_101008795 3300005334 Bacteria 725
11 Ga0070666_11442555 3300005335 Unclassified 514
12 Ga0070680_100000172 3300005336 Bacteria 41297
13 Ga0070680_100020227 3300005336 Bacteria 5282
14 Ga0070680_100460322 3300005336 Bacteria 1087
15 Ga0070682_100002377 3300005337 Bacteria 10428
16 Ga0070682_100372639 3300005337 Unclassified 1071
17 Ga0068868_100027785 3300005338 Bacteria 4319
18 Ga0068868_101615970 3300005338 Unclassified 609
19 Ga0070660_100001451 3300005339 Bacteria 16205
20 Ga0070660_100952401 3300005339 Bacteria 725
21 Ga0070689_100006819 3300005340 Bacteria 7944
22 Ga0070689_100650488 3300005340 Bacteria 917
23 Ga0070689_100986720 3300005340 Bacteria 749
24 Ga0070691_10019730 3300005341 Bacteria 3113
25 Ga0070691_10026968 3300005341 Bacteria 2679
26 Ga0070687_100248847 3300005343 Bacteria 1103
27 Ga0070661_100053534 3300005344 Bacteria 2954
28 Ga0070692_10000564 3300005345 Bacteria 11606
29 Ga0070692_10002520 3300005345 Bacteria 7127
30 Ga0070692_11152994 3300005345 Bacteria 550
31 Ga0070669_100095739 3300005353 Bacteria 2233
32 Ga0070669_100371017 3300005353 Bacteria 1166
33 Ga0070669_100941234 3300005353 Bacteria 739
34 Ga0070675_100377625 3300005354 Bacteria 1261
35 Ga0070675_100924510 3300005354 Bacteria 800
36 Ga0070671_101827642 3300005355 Unclassified 540
37 Ga0070674_100890222 3300005356 Bacteria 775
38 Ga0070674_102206940 3300005356 Bacteria 503
39 Ga0070673_100290274 3300005364 Bacteria 1437
40 Ga0070659_100000892 3300005366 Bacteria 21835
41 Ga0070667_100260981 3300005367 Bacteria 1551
42 Ga0070703_10006211 3300005406 Bacteria 3345
43 Ga0070703_10030706 3300005406 Bacteria 1621
44 Ga0070709_10012934 3300005434 Bacteria 4679
45 Ga0070714_100082353 3300005435 Bacteria 2803
46 Ga0070714_100394738 3300005435 Bacteria 1306
47 Ga0070714_100408590 3300005435 Unclassified 1284
48 Ga0070714_102339713 3300005435 Unclassified 519
49 Ga0070713_100046474 3300005436 Bacteria 3562
50 Ga0070713_100132640 3300005436 Bacteria 2198
51 Ga0070713_100984579 3300005436 Unclassified 813
52 Ga0070710_10380108 3300005437 Bacteria 942
53 Ga0070710_10404435 3300005437 Bacteria 916
54 Ga0070701_10182760 3300005438 Bacteria 1229
55 Ga0070711_100012412 3300005439 Bacteria 5322
56 Ga0070711_100199951 3300005439 Bacteria 1541
57 Ga0070711_100256689 3300005439 Bacteria 1373
58 Ga0070711_100262366 3300005439 Bacteria 1360
59 Ga0070705_100007493 3300005440 Bacteria 5372
60 Ga0070705_100024866 3300005440 Bacteria 3238
61 Ga0070705_100232339 3300005440 Unclassified 1284
62 Ga0070705_101783665 3300005440 Bacteria 522
63 Ga0070705_101957626 3300005440 Bacteria 500
64 Ga0070700_100060196 3300005441 Bacteria 2393
65 Ga0070700_100860393 3300005441 Bacteria 735
66 Ga0070694_100001215 3300005444 Bacteria 14868
67 Ga0070694_100001268 3300005444 Bacteria 14675
68 Ga0070694_100044269 3300005444 Bacteria 2978
69 Ga0070708_100077381 3300005445 Bacteria 3006
70 Ga0070708_100288589 3300005445 Unclassified 1545
71 Ga0070708_100735834 3300005445 Bacteria 928
72 Ga0070663_100002216 3300005455 Bacteria 10875
73 Ga0070662_100015351 3300005457 Bacteria 5128
74 Ga0070662_100047177 3300005457 Bacteria 3098
75 Ga0070681_10018294 3300005458 Bacteria 7004
76 Ga0070681_11998038 3300005458 Bacteria 508
77 Ga0068867_100201411 3300005459 Bacteria 1594
78 Ga0070706_100322770 3300005467 Bacteria 1440
79 Ga0070706_100584995 3300005467 Bacteria 1038
80 Ga0070706_100854186 3300005467 Unclassified 841
81 Ga0070706_101537200 3300005467 Unclassified 608
82 Ga0070707_100015584 3300005468 Bacteria 7134
83 Ga0070707_100046043 3300005468 Bacteria 4174
84 Ga0070707_100385237 3300005468 Bacteria 1362
85 Ga0070707_100614933 3300005468 Unclassified 1049
86 Ga0070707_102321884 3300005468 Bacteria 504
87 Ga0070707_102322687 3300005468 Bacteria 504
88 Ga0070698_100136302 3300005471 Bacteria 2408
89 Ga0070699_100015393 3300005518 Bacteria 6573
90 Ga0070699_100020082 3300005518 Bacteria 5757
91 Ga0070699_100240267 3300005518 Bacteria 1616
92 Ga0070699_101103972 3300005518 Bacteria 728
93 Ga0070679_100000185 3300005530 Bacteria 50363
94 Ga0070679_101877912 3300005530 Bacteria 548
95 Ga0070684_100033556 3300005535 Bacteria 4384
96 Ga0070684_101655607 3300005535 Unclassified 604
97 Ga0070684_101911968 3300005535 Bacteria 560
98 Ga0070697_100289796 3300005536 Bacteria 1406
99 Ga0070697_100496497 3300005536 Unclassified 1067
100 Ga0070697_101356718 3300005536 Bacteria 635
101 Ga0068853_100012041 3300005539 Bacteria 7037
102 Ga0070686_100638789 3300005544 Bacteria 843
103 Ga0070686_100701451 3300005544 Bacteria 807
104 Ga0070686_100811232 3300005544 Bacteria 755
105 Ga0070695_100000865 3300005545 Bacteria 16307
106 Ga0070695_100003727 3300005545 Bacteria 8890
107 Ga0070695_100006846 3300005545 Bacteria 6751
108 Ga0070695_100221091 3300005545 Bacteria 1364
109 Ga0070696_100002658 3300005546 Bacteria 11843
110 Ga0070696_100085466 3300005546 Bacteria 2239
111 Ga0070696_101562655 3300005546 Bacteria 566
112 Ga0070696_101593517 3300005546 Unclassified 561
113 Ga0070693_100000248 3300005547 Bacteria 25117
114 Ga0070665_100372663 3300005548 Bacteria 1435
115 Ga0070704_100002912 3300005549 Bacteria 9719
116 Ga0070704_100523445 3300005549 Bacteria 1032
117 Ga0068855_100000437 3300005563 Bacteria 51661
118 Ga0068855_100394445 3300005563 Bacteria 1518
119 Ga0068855_100913732 3300005563 Unclassified 927
120 Ga0070664_100004721 3300005564 Bacteria 10929
121 Ga0068857_100003434 3300005577 Bacteria 13223
122 Ga0068857_100124460 3300005577 Bacteria 2323
123 Ga0068854_100002679 3300005578 Bacteria 11036
124 Ga0068856_100000464 3300005614 Bacteria 44730
125 Ga0068856_100082353 3300005614 Bacteria 3194
126 Ga0068856_100104805 3300005614 Plasmid 2822
127 Ga0068856_100964824 3300005614 Bacteria 871
128 Ga0068856_102423761 3300005614 Unclassified 532
129 Ga0070702_100033954 3300005615 Bacteria 2809
130 Ga0068859_100007895 3300005617 Bacteria 10798
131 Ga0068859_100405292 3300005617 Bacteria 1460
132 Ga0068859_101306301 3300005617 Bacteria 799
133 Ga0068859_101846068 3300005617 Bacteria 667
134 Ga0068864_100001333 3300005618 Bacteria 20559
135 Ga0068864_100462589 3300005618 Bacteria 1215
136 Ga0068864_102210246 3300005618 Bacteria 557
137 Ga0068866_10223299 3300005718 Bacteria 1138
138 Ga0068861_100010099 3300005719 Bacteria 6546
139 Ga0068870_10000256 3300005840 Bacteria 19580
140 Ga0068863_100115930 3300005841 Unclassified 2553
141 Ga0068863_100515027 3300005841 Bacteria 1179
142 Ga0068863_100754375 3300005841 Unclassified 969
143 Ga0068863_101151176 3300005841 Bacteria 781
144 Ga0068858_100475464 3300005842 Bacteria 1206
145 Ga0068858_101568684 3300005842 Bacteria 650
146 Ga0068860_100030858 3300005843 Bacteria 5153
147 Ga0068860_100085941 3300005843 Bacteria 2993
148 Ga0068860_100352507 3300005843 Bacteria 1448
149 Ga0068860_102096751 3300005843 Bacteria 587
150 Ga0068862_100022105 3300005844 Bacteria 5322
151 Ga0068862_102187294 3300005844 Bacteria 564
152 Ga0081455_10001327 3300005937 Bacteria 30589
153 Ga0081455_10649439 3300005937 Bacteria 680
154 Ga0081540_1001963 3300005983 Bacteria 17161
155 Ga0070717_10027539 3300006028 Unclassified 4543
156 Ga0070717_10658095 3300006028 Unclassified 951
157 Ga0070717_10855105 3300006028 Unclassified 828
158 Ga0070717_11128176 3300006028 Unclassified 714
159 Ga0070717_11485703 3300006028 Unclassified 615
160 Ga0070715_10280524 3300006163 Unclassified 883
161 Ga0070716_100076357 3300006173 Bacteria 1985
162 Ga0070712_100022869 3300006175 Bacteria 4122
163 Ga0070712_100038484 3300006175 Bacteria 3269
164 Ga0070712_100157695 3300006175 Unclassified 1750
165 Ga0070712_100226483 3300006175 Bacteria 1483
166 Ga0070712_100859207 3300006175 Unclassified 781
167 Ga0097621_100288142 3300006237 Bacteria 1447
168 Ga0068871_100262331 3300006358 Bacteria 1507
169 Ga0075430_100013495 3300006846 Bacteria 6964
170 Ga0075431_100000061 3300006847 Bacteria 61386
171 Ga0075431_100001236 3300006847 Bacteria 23180
172 Ga0075431_100227414 3300006847 Bacteria 1902
173 Ga0075431_100286936 3300006847 Bacteria 1666
174 Ga0075431_100455275 3300006847 Bacteria 1275
175 Ga0075433_10011484 3300006852 Bacteria 7132
176 Ga0075433_10609273 3300006852 Bacteria 958
177 Ga0075434_100004221 3300006871 Bacteria 12880
178 Ga0075434_100185645 3300006871 Bacteria 2100
179 Ga0075434_100223361 3300006871 Bacteria 1903
180 Ga0075434_101158252 3300006871 Unclassified 786
181 Ga0075434_101920196 3300006871 Bacteria 598
182 Ga0075434_102655400 3300006871 Unclassified 501
183 Ga0075429_100009797 3300006880 Bacteria 8307
184 Ga0075429_100050002 3300006880 Bacteria 3637
185 Ga0075429_100540784 3300006880 Bacteria 1021
186 Ga0068865_100208530 3300006881 Bacteria 1521
187 Ga0075436_100024178 3300006914 Bacteria 4176
188 Ga0075436_101366720 3300006914 Unclassified 536
189 Ga0075436_101366722 3300006914 Unclassified 536
190 Ga0097620_100007895 3300006931 Bacteria 10798
191 Ga0097620_100405298 3300006931 Bacteria 1460
192 Ga0097620_101306328 3300006931 Bacteria 799
193 Ga0097620_101846056 3300006931 Bacteria 667
194 Ga0075435_100004648 3300007076 Bacteria 9461
195 Ga0075435_100023162 3300007076 Bacteria 4798
196 Ga0075435_100890161 3300007076 Bacteria 776
197 Ga0099794_10003599 3300007265 Bacteria 5943
198 Ga0099795_10005888 3300007788 Bacteria 3302
199 Ga0105240_11175561 3300009093 Bacteria 813
200 Ga0105240_12488396 3300009093 Bacteria 535
201 Ga0105245_10102511 3300009098 Bacteria 2650
202 Ga0105247_11425531 3300009101 Unclassified 562
203 Ga0114129_10028046 3300009147 Bacteria 7975
204 Ga0114129_10154263 3300009147 Bacteria 3142
205 Ga0114129_10161134 3300009147 Bacteria 3064
206 Ga0114129_12467895 3300009147 Bacteria 622
207 Ga0105243_10065515 3300009148 Bacteria 2919
208 Ga0105241_10002814 3300009174 Bacteria 13015
209 Ga0105242_10039499 3300009176 Bacteria 3799
210 Ga0105242_10643920 3300009176 Unclassified 1030
211 Ga0105248_10608769 3300009177 Bacteria 1232
212 Ga0105248_10783009 3300009177 Bacteria 1076
213 Ga0105249_10070993 3300009553 Bacteria 3216
214 Ga0105249_10202377 3300009553 Bacteria 1944
215 Ga0105249_10575338 3300009553 Bacteria 1179
216 Ga0105249_10934445 3300009553 Bacteria 935
217 Ga0105249_12240878 3300009553 Unclassified 619
218 Ga0099796_10128287 3300010159 Unclassified 981
219 Ga0099796_10196365 3300010159 Bacteria 817
220 Ga0105239_10456157 3300010375 Bacteria 1451
221 Ga0105246_10265469 3300011119 Bacteria 1370
222 Ga0105246_10270965 3300011119 Bacteria 1357
223 Ga0105246_11023511 3300011119 Unclassified 749
224 Ga0157373_10000439 3300013100 Bacteria 33045
225 Ga0157373_10953354 3300013100 Unclassified 638
226 Ga0157371_10056912 3300013102 Bacteria 2773
227 Ga0157370_10377404 3300013104 Bacteria 1306
228 Ga0157369_10007249 3300013105 Bacteria 12763
229 Ga0157378_10446537 3300013297 Bacteria 1283
230 Ga0163162_10147092 3300013306 Bacteria 2473
231 Ga0163162_10483835 3300013306 Bacteria 1369
232 Ga0163162_11375680 3300013306 Unclassified 803
233 Ga0157372_10000313 3300013307 Bacteria 53548
234 Ga0157372_10293017 3300013307 Bacteria 1893
235 Ga0157375_10248913 3300013308 Bacteria 1938
236 Ga0163163_10048435 3300014325 Bacteria 4179
237 Ga0163163_10086512 3300014325 Bacteria 3144
238 Ga0163163_10175176 3300014325 Bacteria 2191
239 Ga0157380_10396538 3300014326 Bacteria 1308
240 Ga0182008_10040641 3300014497 Unclassified 2321
241 Ga0157377_10058176 3300014745 Bacteria 2200
242 Ga0157379_11323546 3300014968 Bacteria 696
243 Ga0157376_11038344 3300014969 Unclassified 843
244 Ga0182007_10053252 3300015262 Bacteria 1332
245 Ga0206356_11486106 3300020070 Unclassified 524
246 Ga0213873_10041807 3300021358 Bacteria 1183
247 Ga0213874_10107891 3300021377 Unclassified 933
248 Ga0213874_10118277 3300021377 Bacteria 898
249 Ga0213876_10002340 3300021384 Bacteria 11176
250 Ga0213876_10355487 3300021384 Unclassified 779
251 Ga0213876_10463628 3300021384 Bacteria 674
252 Ga0213875_10001380 3300021388 Bacteria 15928
253 Ga0213875_10013336 3300021388 Bacteria 4039
254 Ga0213875_10307603 3300021388 Unclassified 750
255 Ga0213871_10063358 3300021441 Bacteria 1033
256 Ga0213871_10065830 3300021441 Bacteria 1016
257 Ga0207653_10000897 3300025885 Bacteria 9881
258 Ga0207653_10057939 3300025885 Bacteria 1301
259 Ga0207653_10103721 3300025885 Bacteria 1008
260 Ga0207692_11024622 3300025898 Unclassified 545
261 Ga0207692_11079354 3300025898 Bacteria 531
262 Ga0207710_10197761 3300025900 Bacteria 992
263 Ga0207699_10030576 3300025906 Bacteria 3015
264 Ga0207645_10000113 3300025907 Bacteria 60937
265 Ga0207643_10000164 3300025908 Bacteria 45857
266 Ga0207684_10005380 3300025910 Bacteria 11827
267 Ga0207684_11271271 3300025910 Bacteria 607
268 Ga0207684_11457536 3300025910 Unclassified 558
269 Ga0207654_10013924 3300025911 Bacteria 4146
270 Ga0207707_10000305 3300025912 Bacteria 51662
271 Ga0207695_11586399 3300025913 Bacteria 535
272 Ga0207693_10015910 3300025915 Bacteria 6022
273 Ga0207693_10032257 3300025915 Bacteria 4135
274 Ga0207693_10033485 3300025915 Bacteria 4054
275 Ga0207693_10492618 3300025915 Bacteria 957
276 Ga0207663_10030143 3300025916 Bacteria 3196
277 Ga0207663_10312747 3300025916 Bacteria 1178
278 Ga0207663_11513547 3300025916 Bacteria 540
279 Ga0207663_11551466 3300025916 Bacteria 533
280 Ga0207660_10000085 3300025917 Bacteria 49898
281 Ga0207660_10256592 3300025917 Bacteria 1381
282 Ga0207662_10163453 3300025918 Bacteria 1424
283 Ga0207662_10554097 3300025918 Bacteria 796
284 Ga0207657_10000236 3300025919 Bacteria 58234
285 Ga0207652_10000572 3300025921 Bacteria 37038
286 Ga0207646_10023117 3300025922 Bacteria 5714
287 Ga0207646_10045410 3300025922 Bacteria 3944
288 Ga0207646_10253662 3300025922 Bacteria 1589
289 Ga0207681_10065016 3300025923 Bacteria 2520
290 Ga0207681_10295708 3300025923 Bacteria 1280
291 Ga0207650_10055267 3300025925 Bacteria 2947
292 Ga0207659_10102562 3300025926 Bacteria 2160
293 Ga0207687_10242560 3300025927 Bacteria 1429
294 Ga0207700_10042250 3300025928 Unclassified 3341
295 Ga0207700_10051033 3300025928 Bacteria 3085
296 Ga0207700_10070291 3300025928 Bacteria 2690
297 Ga0207700_10141398 3300025928 Bacteria 1978
298 Ga0207700_10334043 3300025928 Bacteria 1316
299 Ga0207700_10502103 3300025928 Bacteria 1073
300 Ga0207700_10703620 3300025928 Unclassified 902
301 Ga0207664_10011243 3300025929 Bacteria 6350
302 Ga0207664_10059212 3300025929 Plasmid 3049
303 Ga0207664_10193432 3300025929 Bacteria 1752
304 Ga0207664_11691112 3300025929 Bacteria 555
305 Ga0207690_10006655 3300025932 Bacteria 6847
306 Ga0207706_10027626 3300025933 Bacteria 5073
307 Ga0207706_10032703 3300025933 Bacteria 4630
308 Ga0207686_10029728 3300025934 Bacteria 3227
309 Ga0207709_10036680 3300025935 Bacteria 2907
310 Ga0207709_10839275 3300025935 Unclassified 744
311 Ga0207670_10195242 3300025936 Bacteria 1534
312 Ga0207670_10587435 3300025936 Bacteria 913
313 Ga0207704_10325830 3300025938 Bacteria 1187
314 Ga0207665_10018022 3300025939 Bacteria 4639
315 Ga0207665_11451743 3300025939 Bacteria 546
316 Ga0207665_11610061 3300025939 Bacteria 515
317 Ga0207691_10047077 3300025940 Bacteria 3960
318 Ga0207711_10160205 3300025941 Bacteria 2036
319 Ga0207711_10457579 3300025941 Bacteria 1188
320 Ga0207711_10538209 3300025941 Bacteria 1089
321 Ga0207711_10663305 3300025941 Bacteria 973
322 Ga0207689_10000870 3300025942 Bacteria 29137
323 Ga0207689_10174704 3300025942 Bacteria 1771
324 Ga0207689_10340927 3300025942 Bacteria 1245
325 Ga0207661_10054798 3300025944 Bacteria 3196
326 Ga0207679_10029031 3300025945 Bacteria 3847
327 Ga0207667_10001952 3300025949 Bacteria 25839
328 Ga0207667_10281575 3300025949 Bacteria 1699
329 Ga0207712_10083388 3300025961 Bacteria 2333
330 Ga0207712_10580668 3300025961 Unclassified 967
331 Ga0207640_10000992 3300025981 Bacteria 15701
332 Ga0207658_10151344 3300025986 Bacteria 1891
333 Ga0207677_10075412 3300026023 Bacteria 2397
334 Ga0207677_11582759 3300026023 Unclassified 606
335 Ga0207639_10002377 3300026041 Bacteria 12641
336 Ga0207678_10007083 3300026067 Bacteria 9949
337 Ga0207708_11040089 3300026075 Bacteria 712
338 Ga0207702_10001008 3300026078 Bacteria 28905
339 Ga0207702_10008376 3300026078 Bacteria 8723
340 Ga0207702_10161525 3300026078 Bacteria 2046
341 Ga0207702_10346202 3300026078 Bacteria 1421
342 Ga0207641_10069029 3300026088 Bacteria 3032
343 Ga0207641_10175329 3300026088 Bacteria 1960
344 Ga0207641_10920705 3300026088 Unclassified 869
345 Ga0207641_12081697 3300026088 Unclassified 568
346 Ga0207648_10161512 3300026089 Bacteria 1979
347 Ga0207648_11890261 3300026089 Bacteria 558
348 Ga0207676_10011799 3300026095 Bacteria 6251
349 Ga0207676_10623739 3300026095 Bacteria 1038
350 Ga0207676_10937649 3300026095 Bacteria 851
351 Ga0207674_10000170 3300026116 Bacteria 78770
352 Ga0207674_10022186 3300026116 Bacteria 6823
353 Ga0207674_11675749 3300026116 Unclassified 604
354 Ga0207675_100009324 3300026118 Bacteria 9201
355 Ga0207675_100111477 3300026118 Bacteria 2581
356 Ga0207675_100295691 3300026118 Bacteria 1576
357 Ga0207698_10406455 3300026142 Bacteria 1303
358 Ga0209969_1007082 3300027360 Bacteria 1581
359 Ga0209967_1003270 3300027364 Bacteria 2134
360 Ga0209981_1006580 3300027378 Bacteria 1556
361 Ga0209984_1010481 3300027424 Bacteria 1190
362 Ga0210000_1004882 3300027462 Bacteria 1941
363 Ga0209995_1003605 3300027471 Bacteria 2466
364 Ga0209968_1002706 3300027526 Bacteria 2662
365 Ga0209999_1001016 3300027543 Bacteria 4762
366 Ga0209982_1003402 3300027552 Bacteria 2261
367 Ga0209970_1001851 3300027614 Bacteria 3664
368 Ga0209983_1000540 3300027665 Bacteria 8157
369 Ga0209588_1002624 3300027671 Bacteria 4895
370 Ga0209971_1000163 3300027682 Bacteria 19906
371 Ga0209971_1051706 3300027682 Bacteria 993
372 Ga0209966_1000119 3300027695 Bacteria 35102
373 Ga0209966_1006750 3300027695 Bacteria 1998
374 Ga0209998_10000150 3300027717 Bacteria 26296
375 Ga0209998_10006051 3300027717 Bacteria 2518
376 Ga0209998_10059281 3300027717 Bacteria 899
377 Ga0209974_10009962 3300027876 Bacteria 3214
378 Ga0209974_10044344 3300027876 Unclassified 1483
379 Ga0268266_10839787 3300028379 Bacteria 888
380 Ga0268265_10006872 3300028380 Bacteria 7698
381 Ga0268265_10494032 3300028380 Bacteria 1152
382 Ga0268265_10999833 3300028380 Bacteria 826
383 Ga0268264_10044292 3300028381 Bacteria 3691
384 Ga0268264_10208767 3300028381 Bacteria 1791
385 Ga0265338_10171768 3300028800 Bacteria 1661
386 Ga0265325_10164142 3300031241 Bacteria 1043
387 Ga0307408_100116398 3300031548 Bacteria 2063
388 Ga0307408_101608118 3300031548 Bacteria 617
389 Ga0307405_10246764 3300031731 Unclassified 1326
390 Ga0307407_11409392 3300031903 Unclassified 549
391 Ga0307409_100084866 3300031995 Bacteria 2573
392 Ga0307409_100835618 3300031995 Bacteria 931
393 Ga0307416_101312703 3300032002 Unclassified 829
394 Ga0307411_11875220 3300032005 Bacteria 558
395 Ga0307415_100339476 3300032126 Unclassified 1260
396 Ga0373948_0014113 3300034817 Bacteria 1452
397 Ga0373950_0020394 3300034818 Bacteria 1165
398 Ga0373959_0048694 3300034820 Bacteria 909
399 Ga0373926_0134457 3300035083 Bacteria 937
400 Ga0373934_0019289 3300035086 Bacteria 2616
401 Ga0373940_0087244 3300035088 Bacteria 930
402 Ga0373944_0136476 3300035089 Bacteria 856
403 Ga0373949_0013308 3300035090 Bacteria 1822
404 Ga0373949_0021882 3300035090 Bacteria 1471
405 Ga0373949_0208433 3300035090 Unclassified 590
406 Ga0373951_0016513 3300035091 Bacteria 1665
407 Ga0373923_0055220 3300035111 Bacteria 1674
408 Ga0373932_0192584 3300035112 Bacteria 721
409 Ga0373939_0278437 3300035114 Bacteria 660
410 Ga0373941_0041797 3300035115 Bacteria 1420
411 Ga0373945_0467767 3300035116 Unclassified 559
412 Ga0373953_0037622 3300035117 Bacteria 1910
413 Ga0373953_0172433 3300035117 Bacteria 931
414 Ga0373954_0010052 3300035118 Bacteria 4169
415 Ga0373956_0014193 3300035119 Bacteria 3325
416 Ga0373956_0102654 3300035119 Bacteria 1327
417 Ga0373957_0061520 3300035120 Bacteria 1455
418 Ga0373960_0010360 3300035121 Bacteria 2275
419 Ga0373960_0133007 3300035121 Bacteria 836
420 Ga0373943_0115512 3300035170 Bacteria 1421
421 Ga0373943_0187559 3300035170 Bacteria 1139
422 Ga0373943_0600073 3300035170 Bacteria 648
423 Ga0373946_0077216 3300035171 Bacteria 1451
424 Ga0373955_0052869 3300035172 Bacteria 2216
425 Ga0373955_0060198 3300035172 Bacteria 2094
426 Ga0373961_0004323 3300035241 Bacteria 3437
427 Ga0373924_0022868 3300035410 Bacteria 2447
428 Ga0373924_0197233 3300035410 Bacteria 887
429 Ga0373931_0148720 3300035691 Bacteria 1363
430 Ga0373931_1291553 3300035691 Unclassified 502
431 Ga0373935_0062157 3300035692 Bacteria 2392
432 Ga0373935_0103602 3300035692 Bacteria 1879
433 Ga0373935_0257375 3300035692 Bacteria 1223
434 Ga0373927_0022718 3300035695 Bacteria 4108
435 Ga0373927_0200131 3300035695 Bacteria 1311
436 Ga0373933_0011306 3300035724 Bacteria 4914
437 Ga0373933_0121110 3300035724 Bacteria 1639
438 Ga0373933_0229372 3300035724 Bacteria 1192
439 Ga0373947_0090849 3300035725 Bacteria 1904
440 Ga0373947_0143107 3300035725 Bacteria 1535
441 Ga0373937_0027514 3300036401 Bacteria 5141
442 Ga0373937_0073288 3300036401 Bacteria 3159
443 Ga0373937_0318822 3300036401 Bacteria 1470
444 Ga0373937_0562456 3300036401 Unclassified 1083
445 Ga0373937_1687036 3300036401 Bacteria 580
446 Ga0373925_0031059 3300037068 Bacteria 3923
447 Ga0373925_0118322 3300037068 Unclassified 2054
448 Ga0373925_0519559 3300037068 Bacteria 978
449 Ga0373925_0568607 3300037068 Unclassified 933
450 Ga0395900_0618552 3300037418 Unclassified 1022
451 Ga0436364_0145813 3300037853 Bacteria 1822
452 Ga0436364_0467252 3300037853 Bacteria 599
453 Ga0436364_0601131 3300037853 Bacteria 3980
454 Ga0436364_0663275 3300037853 Bacteria 97909
455 Ga0436364_1513617 3300037853 Bacteria 5157
456 Ga0242420_042086 3300038996 Bacteria 875
457 Ga0242420_126924 3300038996 Bacteria 560
458 Ga0436365_0178215 3300039437 Bacteria 1654
459 Ga0436365_0335175 3300039437 Bacteria 1264
460 Ga0436365_0457769 3300039437 Unclassified 1599
461 Ga0436365_0492069 3300039437 Unclassified 573
462 Ga0436365_1405111 3300039437 Unclassified 560
463 Ga0436365_1597299 3300039437 Bacteria 8020
464 Ga0436360_0479485 3300039438 Bacteria 2591
465 Ga0436360_0600212 3300039438 Bacteria 1462
466 Ga0436360_1227350 3300039438 Unclassified 1205
467 Ga0436360_1270871 3300039438 Bacteria 635
468 Ga0436363_0635281 3300039450 Viruses 871
469 Ga0436363_1048964 3300039450 Unclassified 586
470 Ga0436363_1698508 3300039450 Bacteria 2747
471 Ga0436363_1700699 3300039450 Bacteria 3636
472 Ga0436362_0431659 3300039453 Bacteria 595
473 Ga0436362_0494949 3300039453 Bacteria 1225
474 Ga0436362_0816092 3300039453 Unclassified 713
475 Ga0439441_001047 3300042001 Bacteria 3432
476 Ga0439448_0006020 3300042005 Bacteria 3474
477 Ga0439450_002450 3300042008 Bacteria 2919
478 Ga0439455_0009296 3300042012 Bacteria 2128
479 Ga0439455_0017669 3300042012 Bacteria 1665
480 Ga0450919_017820 3300042121 Bacteria 801
481 Ga0439458_0002678 3300042157 Bacteria 4298
482 Ga0439444_0017514 3300042437 Unclassified 1231
483 Ga0439459_0005063 3300042438 Bacteria 2149
484 Ga0439460_0001824 3300042461 Bacteria 5071
485 Ga0451577_0216339 3300042876 Bacteria 1731
486 Ga0453683_0361759 3300044673 Bacteria 933
487 Ga0466963_0431330 3300044694 Bacteria 930
488 Ga0453684_0063129 3300044712 Bacteria 4741
489 Ga0453684_1803588 3300044712 Bacteria 622
490 Ga0451576_0025306 3300045051 Bacteria 6395
491 Ga0451576_0025584 3300045051 Bacteria 6358
492 Ga0451576_0236850 3300045051 Bacteria 1906
493 Ga0451576_0321554 3300045051 Bacteria 1619
494 Ga0451576_0534632 3300045051 Bacteria 1231
495 Ga0451576_0711271 3300045051 Bacteria 1055
496 Ga0466967_2163747 3300045976 Bacteria 552
497 Ga0495629_0505448 3300046459 Unclassified 815
498 Ga0495651_0050591 3300046462 Bacteria 3205
499 Ga0495653_0067991 3300046463 Bacteria 2673
500 Ga0495580_0281094 3300046472 Bacteria 1135
501 Ga0495580_0403610 3300046472 Bacteria 921
502 Ga0495639_0147734 3300046475 Unclassified 1133
503 Ga0495639_0435446 3300046475 Bacteria 665
504 Ga0495662_0207285 3300046476 Bacteria 966
505 Ga0495662_0298268 3300046476 Bacteria 793
506 Ga0495664_0001798 3300046477 Bacteria 11392
507 Ga0495608_0054522 3300046511 Bacteria 2643
508 Ga0495608_0058203 3300046511 Bacteria 2548
509 Ga0495618_0053319 3300046514 Bacteria 2557
510 Ga0495628_0243667 3300046516 Bacteria 1344
511 Ga0495628_0983303 3300046516 Unclassified 581
512 Ga0495652_0054502 3300046529 Bacteria 3405
513 Ga0495640_0093828 3300046533 Bacteria 1977
514 Ga0495640_0152002 3300046533 Bacteria 1487
515 Ga0495586_0235196 3300046535 Bacteria 1043
516 Ga0495587_0013695 3300046536 Bacteria 5094
517 Ga0495587_0447200 3300046536 Unclassified 716
518 Ga0495645_0005511 3300046543 Bacteria 8697
519 Ga0495645_0807545 3300046543 Unclassified 562
520 Ga0495667_0023531 3300046559 Bacteria 4150
521 Ga0495667_0025467 3300046559 Bacteria 3986
522 Ga0495667_0103828 3300046559 Bacteria 1838
523 Ga0495667_0378704 3300046559 Bacteria 892
524 Ga0495667_0598937 3300046559 Bacteria 687
525 Ga0495634_0104892 3300046642 Bacteria 1823
526 Ga0495635_0094823 3300046663 Bacteria 2040
527 Ga0495657_0095018 3300046675 Bacteria 1906
528 Ga0495657_0509202 3300046675 Unclassified 701
529 Ga0495657_0654502 3300046675 Unclassified 606
530 Ga0495599_0074004 3300046678 Bacteria 2127
531 Ga0495599_0343613 3300046678 Bacteria 895
532 Ga0495599_0860520 3300046678 Unclassified 515
533 Ga0495623_0068077 3300046679 Bacteria 2221
534 Ga0495646_0070261 3300046680 Bacteria 2063
535 Ga0495600_0153293 3300046809 Bacteria 1491
536 Ga0495600_0263425 3300046809 Bacteria 1094
537 Ga0495600_0515021 3300046809 Unclassified 734
538 Ga0495604_0017462 3300047317 Bacteria 5744
539 Ga0495674_0017151 3300047319 Bacteria 6745
540 Ga0495676_0129642 3300047321 Bacteria 1823
541 Ga0495680_0077017 3300047322 Bacteria 2527
542 Ga0495680_0406427 3300047322 Unclassified 939
543 Ga0495684_0261036 3300047471 Bacteria 1256
544 Ga0495684_0573328 3300047471 Unclassified 765
545 Ga0495593_0350555 3300047673 Bacteria 738
546 Ga0495602_0002925 3300048088 Bacteria 17516
547 Ga0495614_0502244 3300048089 Bacteria 577
548 Ga0496102_0129875 3300048905 Bacteria 2357
549 Ga0496103_0464535 3300048906 Bacteria 811
550 Ga0496104_0073944 3300048907 Bacteria 3243
551 Ga0496106_0350117 3300048909 Bacteria 1186
552 Ga0496106_0385628 3300048909 Unclassified 1126
553 Ga0496106_0892863 3300048909 Bacteria 702
554 Ga0496108_0766259 3300048911 Bacteria 834
555 Ga0496108_0853671 3300048911 Unclassified 783
556 Ga0496109_0477331 3300048912 Bacteria 1177
557 Ga0496110_0071394 3300048913 Unclassified 3079
558 Ga0496110_0300852 3300048913 Bacteria 1461
559 Ga0496112_0084393 3300048915 Unclassified 3141
560 Ga0496112_0150159 3300048915 Bacteria 2297
561 Ga0496112_0216999 3300048915 Bacteria 1869
562 Ga0496113_0250219 3300048916 Bacteria 1415
563 Ga0501032_0895354 3300049569 Bacteria 559
564 Ga0501032_0996681 3300049569 Bacteria 526
565 Ga0501033_0019194 3300049570 Bacteria 5170
566 Ga0501033_0661771 3300049570 Unclassified 713
567 Ga0501033_1197740 3300049570 Bacteria 503
568 Ga0501036_0173305 3300049572 Bacteria 1817
569 Ga0501036_0525965 3300049572 Bacteria 983
570 Ga0501036_0535292 3300049572 Bacteria 974
571 Ga0501036_1029953 3300049572 Bacteria 673
572 Ga0501037_0103642 3300049573 Bacteria 2052
573 Ga0501037_0839331 3300049573 Bacteria 605
574 Ga0501038_0030863 3300049574 Bacteria 4738
575 Ga0501038_0370356 3300049574 Bacteria 1113
576 Ga0501038_0483933 3300049574 Bacteria 948
577 Ga0501039_0047726 3300049575 Bacteria 3310
578 Ga0501039_0230428 3300049575 Bacteria 1456
579 Ga0501039_1439174 3300049575 Unclassified 530
580 Ga0501040_0105502 3300049576 Bacteria 1968
581 Ga0501040_0122381 3300049576 Bacteria 1826
582 Ga0501040_0248720 3300049576 Bacteria 1268
583 Ga0501040_0262117 3300049576 Bacteria 1233
584 Ga0501040_0552343 3300049576 Bacteria 831
585 Ga0501041_0021804 3300049577 Bacteria 3837
586 Ga0501041_0139625 3300049577 Bacteria 1511
587 Ga0501041_0187344 3300049577 Bacteria 1296
588 Ga0501042_0064250 3300049578 Bacteria 2623
589 Ga0501042_0156472 3300049578 Bacteria 1644
590 Ga0501042_0265789 3300049578 Bacteria 1238
591 Ga0501042_0480964 3300049578 Bacteria 901
592 Ga0501042_0637020 3300049578 Bacteria 775
593 Ga0501043_0055508 3300049579 Bacteria 3112
594 Ga0501046_0005426 3300049580 Bacteria 11394
595 Ga0501046_0204765 3300049580 Bacteria 1467
596 Ga0501046_0388570 3300049580 Unclassified 1009
597 Ga0501047_0135200 3300049581 Bacteria 2346
598 Ga0501048_0014717 3300049582 Bacteria 5788
599 Ga0501048_0215247 3300049582 Bacteria 1362
600 Ga0501048_0253837 3300049582 Bacteria 1249
601 Ga0501067_0006899 3300049583 Bacteria 6302
602 Ga0501067_0237298 3300049583 Bacteria 1015
603 Ga0501068_0045662 3300049584 Bacteria 2639
604 Ga0501068_0061080 3300049584 Bacteria 2289
605 Ga0501068_0111897 3300049584 Bacteria 1698
606 Ga0501068_0160756 3300049584 Bacteria 1416
607 Ga0501068_0278108 3300049584 Bacteria 1069
608 Ga0501069_0053225 3300049585 Bacteria 2254
609 Ga0501069_0126842 3300049585 Bacteria 1460
610 Ga0501070_0151118 3300049586 Bacteria 1916
611 Ga0501071_0047689 3300049587 Bacteria 3078
612 Ga0501071_0080772 3300049587 Bacteria 2378
613 Ga0501071_0387473 3300049587 Unclassified 1066
614 Ga0501071_0699449 3300049587 Bacteria 780
615 Ga0501072_0034516 3300049588 Bacteria 3965
616 Ga0501072_0043356 3300049588 Bacteria 3536
617 Ga0501072_0074126 3300049588 Bacteria 2691
618 Ga0501072_0111005 3300049588 Bacteria 2183
619 Ga0501072_0510352 3300049588 Bacteria 951
620 Ga0501072_0875437 3300049588 Unclassified 702
621 Ga0501074_0004922 3300049590 Bacteria 9573
622 Ga0501074_0131171 3300049590 Bacteria 1793
623 Ga0501074_0283567 3300049590 Bacteria 1177
624 Ga0501074_0447982 3300049590 Bacteria 915
625 Ga0501075_0030857 3300049591 Bacteria 3974
626 Ga0501075_0034666 3300049591 Bacteria 3759
627 Ga0501075_0041891 3300049591 Bacteria 3432
628 Ga0501075_0069260 3300049591 Bacteria 2666
629 Ga0501075_0755666 3300049591 Bacteria 740
630 Ga0501075_0781828 3300049591 Bacteria 726
631 Ga0501075_1491901 3300049591 Bacteria 512
632 Ga0501076_0016701 3300049592 Bacteria 5568
633 Ga0501076_0050314 3300049592 Bacteria 3296
634 Ga0501076_0215729 3300049592 Bacteria 1569
635 Ga0501076_0313878 3300049592 Unclassified 1286
636 Ga0501076_0419992 3300049592 Bacteria 1100
637 Ga0501076_1510757 3300049592 Bacteria 551
638 Ga0501077_0023284 3300049593 Bacteria 3927
639 Ga0501077_0033438 3300049593 Bacteria 3273
640 Ga0501077_0046695 3300049593 Bacteria 2751
641 Ga0501077_0070177 3300049593 Bacteria 2220
642 Ga0501233_259089 3300049668 Unclassified 525
643 Ga0501079_0000544 3300049741 Bacteria 24557
644 Ga0501079_0001291 3300049741 Bacteria 17624
645 Ga0501079_0004073 3300049741 Bacteria 10828
646 Ga0501079_0045890 3300049741 Bacteria 3372
647 Ga0501079_0283122 3300049741 Unclassified 1296
648 Ga0501079_0403067 3300049741 Bacteria 1073
649 Ga0501079_0451588 3300049741 Bacteria 1009
650 Ga0501079_1287006 3300049741 Bacteria 576
651 Ga0501080_0028167 3300049742 Bacteria 5224
652 Ga0501080_0184001 3300049742 Bacteria 1922
653 Ga0501080_0267406 3300049742 Bacteria 1557
654 Ga0501080_0281982 3300049742 Bacteria 1510
655 Ga0501080_0459130 3300049742 Bacteria 1141
656 Ga0501081_0002363 3300049743 Bacteria 11889
657 Ga0501081_0062332 3300049743 Bacteria 2586
658 Ga0501081_0079440 3300049743 Bacteria 2294
659 Ga0501081_0132135 3300049743 Unclassified 1784
660 Ga0501081_0162607 3300049743 Bacteria 1609
661 Ga0501081_0866592 3300049743 Bacteria 680
662 Ga0501083_0016041 3300049744 Bacteria 5246
663 Ga0501083_0320137 3300049744 Bacteria 1009
664 Ga0501035_0254502 3300049822 Bacteria 1490
665 Ga0501035_0325284 3300049822 Bacteria 1291
666 Ga0501045_0006466 3300049824 Bacteria 8117
667 Ga0501045_0137241 3300049824 Bacteria 1818
668 Ga0501045_0146310 3300049824 Bacteria 1758
669 Ga0501045_0162269 3300049824 Bacteria 1664
670 nmdc:mga05p37_142449_c1 3300050507 Bacteria 2936
671 nmdc:mga05p37_171211_c1 3300050507 Bacteria 2648
672 nmdc:mga05p37_27612_c1 3300050507 Bacteria 6912
673 nmdc:mga09592_10160_c1 3300050508 Bacteria 7661
674 nmdc:mga09592_1270679_c1 3300050508 Bacteria 606
675 nmdc:mga09592_484326_c1 3300050508 Bacteria 1066
676 nmdc:mga0qj67_132375_c1 3300050509 Bacteria 2020
677 nmdc:mga0qj67_6307_c1 3300050509 Bacteria 8704
678 nmdc:mga06r32_319_c1 3300050510 Bacteria 40297
679 nmdc:mga06r32_338871_c1 3300050510 Bacteria 1488
680 nmdc:mga06r32_50894_c1 3300050510 Bacteria 3963
681 nmdc:mga06r32_8924_c1 3300050510 Bacteria 9036
682 nmdc:mga0n895_165417_c1 3300050512 Bacteria 2244
683 nmdc:mga0n895_169910_c1 3300050512 Bacteria 2212
684 nmdc:mga0n895_2180843_c1 3300050512 Bacteria 509
685 nmdc:mga0n895_2201612_c1 3300050512 Bacteria 507
686 nmdc:mga0n895_283669_c1 3300050512 Unclassified 1679
687 nmdc:mga0n895_287774_c1 3300050512 Bacteria 1666
688 nmdc:mga0n895_306800_c1 3300050512 Bacteria 1609
689 nmdc:mga0n895_47458_c1 3300050512 Unclassified 4199
690 nmdc:mga0rr50_313289_c1 3300050513 Bacteria 1315
691 nmdc:mga0rr50_5599_c1 3300050513 Bacteria 7516
692 nmdc:mga08x19_69450_c1 3300050514 Bacteria 2295
693 nmdc:mga0a205_411_c1 3300050515 Bacteria 32848
694 nmdc:mga0a205_52258_c1 3300050515 Bacteria 3944
695 nmdc:mga0a205_839442_c1 3300050515 Bacteria 766
696 Ga0495601_0004384 3300053077 Bacteria 8152
697 Ga0495601_0022902 3300053077 Bacteria 3838
698 Ga0495601_0117775 3300053077 Unclassified 1723
699 Ga0495601_0709592 3300053077 Unclassified 641
700 Ga0495612_0001013 3300053078 Bacteria 11549
701 Ga0495595_0106915 3300053084 Unclassified 1354
702 Ga0495595_0329371 3300053084 Unclassified 769
703 Ga0495595_0392098 3300053084 Unclassified 703
704 Ga0495619_0260640 3300053085 Bacteria 1201
705 Ga0495619_0530450 3300053085 Unclassified 808
706 Ga0501084_0000637 3300054114 Bacteria 26671
707 Ga0501084_0037585 3300054114 Bacteria 4046
708 Ga0501084_0213163 3300054114 Bacteria 1629
709 Ga0501084_0313452 3300054114 Bacteria 1325
710 Ga0501084_0461014 3300054114 Bacteria 1074
711 Ga0501084_0804571 3300054114 Bacteria 791
712 Ga0501084_1045823 3300054114 Bacteria 686
713 Ga0590071_012115 3300059421 Bacteria 2022
714 Ga0501082_0001274 3300060353 Bacteria 22120
715 Ga0501082_0001594 3300060353 Bacteria 20004
716 Ga0501082_0081198 3300060353 Bacteria 2798
717 Ga0501082_0189389 3300060353 Bacteria 1790
718 Ga0501082_0602393 3300060353 Bacteria 961
719 Ga0530510_0002661 3300061734 Bacteria 12276
720 Ga0530510_0019222 3300061734 Bacteria 4848
721 Ga0530510_0064087 3300061734 Bacteria 2662
722 Ga0530510_0093569 3300061734 Bacteria 2195
723 Ga0436364_1363774
724 Ga0065712_10165001
725 Ga0065715_10121377
726 Ga0070676_10010612
727 Ga0070683_100074566
728 Ga0070683_100451157
729 Ga0070670_100002086
730 Ga0070670_101412345
731 Ga0068869_100000242
732 Ga0068869_101008795
733 Ga0070666_11442555
734 Ga0070680_100000172
735 Ga0070680_100020227
736 Ga0070680_100460322
737 Ga0070682_100002377
738 Ga0070682_100372639
739 Ga0068868_100027785
740 Ga0068868_101615970
741 Ga0070660_100001451
742 Ga0070660_100952401
743 Ga0070689_100006819
744 Ga0070689_100650488
745 Ga0070689_100986720
746 Ga0070691_10019730
747 Ga0070691_10026968
748 Ga0070687_100248847
749 Ga0070661_100053534
750 Ga0070692_10000564
751 Ga0070692_10002520
752 Ga0070692_11152994
753 Ga0070669_100095739
754 Ga0070669_100371017
755 Ga0070669_100941234
756 Ga0070675_100377625
757 Ga0070675_100924510
758 Ga0070671_101827642
759 Ga0070674_100890222
760 Ga0070674_102206940
761 Ga0070673_100290274
762 Ga0070659_100000892
763 Ga0070667_100260981
764 Ga0070703_10006211
765 Ga0070703_10030706
766 Ga0070709_10012934
767 Ga0070714_100082353
768 Ga0070714_100394738
769 Ga0070714_100408590
770 Ga0070714_102339713
771 Ga0070713_100046474
772 Ga0070713_100132640
773 Ga0070713_100984579
774 Ga0070710_10380108
775 Ga0070710_10404435
776 Ga0070701_10182760
777 Ga0070711_100012412
778 Ga0070711_100199951
779 Ga0070711_100256689
780 Ga0070711_100262366
781 Ga0070705_100007493
782 Ga0070705_100024866
783 Ga0070705_100232339
784 Ga0070705_101783665
785 Ga0070705_101957626
786 Ga0070700_100060196
787 Ga0070700_100860393
788 Ga0070694_100001215
789 Ga0070694_100001268
790 Ga0070694_100044269
791 Ga0070708_100077381
792 Ga0070708_100288589
793 Ga0070708_100735834
794 Ga0070663_100002216
795 Ga0070662_100015351
796 Ga0070662_100047177
797 Ga0070681_10018294
798 Ga0070681_11998038
799 Ga0068867_100201411
800 Ga0070706_100322770
801 Ga0070706_100584995
802 Ga0070706_100854186
803 Ga0070706_101537200
804 Ga0070707_100015584
805 Ga0070707_100046043
806 Ga0070707_100385237
807 Ga0070707_100614933
808 Ga0070707_102321884
809 Ga0070707_102322687
810 Ga0070698_100136302
811 Ga0070699_100015393
812 Ga0070699_100020082
813 Ga0070699_100240267
814 Ga0070699_101103972
815 Ga0070679_100000185
816 Ga0070679_101877912
817 Ga0070684_100033556
818 Ga0070684_101655607
819 Ga0070684_101911968
820 Ga0070697_100289796
821 Ga0070697_100496497
822 Ga0070697_101356718
823 Ga0068853_100012041
824 Ga0070686_100638789
825 Ga0070686_100701451
826 Ga0070686_100811232
827 Ga0070695_100000865
828 Ga0070695_100003727
829 Ga0070695_100006846
830 Ga0070695_100221091
831 Ga0070696_100002658
832 Ga0070696_100085466
833 Ga0070696_101562655
834 Ga0070696_101593517
835 Ga0070693_100000248
836 Ga0070665_100372663
837 Ga0070704_100002912
838 Ga0070704_100523445
839 Ga0068855_100000437
840 Ga0068855_100394445
841 Ga0068855_100913732
842 Ga0070664_100004721
843 Ga0068857_100003434
844 Ga0068857_100124460
845 Ga0068854_100002679
846 Ga0068856_100000464
847 Ga0068856_100082353
848 Ga0068856_100104805
849 Ga0068856_100964824
850 Ga0068856_102423761
851 Ga0070702_100033954
852 Ga0068859_100007895
853 Ga0068859_100405292
854 Ga0068859_101306301
855 Ga0068859_101846068
856 Ga0068864_100001333
857 Ga0068864_100462589
858 Ga0068864_102210246
859 Ga0068866_10223299
860 Ga0068861_100010099
861 Ga0068870_10000256
862 Ga0068863_100115930
863 Ga0068863_100515027
864 Ga0068863_100754375
865 Ga0068863_101151176
866 Ga0068858_100475464
867 Ga0068858_101568684
868 Ga0068860_100030858
869 Ga0068860_100085941
870 Ga0068860_100352507
871 Ga0068860_102096751
872 Ga0068862_100022105
873 Ga0068862_102187294
874 Ga0081455_10001327
875 Ga0081455_10649439
876 Ga0081540_1001963
877 Ga0070717_10027539
878 Ga0070717_10658095
879 Ga0070717_10855105
880 Ga0070717_11128176
881 Ga0070717_11485703
882 Ga0070715_10280524
883 Ga0070716_100076357
884 Ga0070712_100022869
885 Ga0070712_100038484
886 Ga0070712_100157695
887 Ga0070712_100226483
888 Ga0070712_100859207
889 Ga0097621_100288142
890 Ga0068871_100262331
891 Ga0075430_100013495
892 Ga0075431_100000061
893 Ga0075431_100001236
894 Ga0075431_100227414
895 Ga0075431_100286936
896 Ga0075431_100455275
897 Ga0075433_10011484
898 Ga0075433_10609273
899 Ga0075434_100004221
900 Ga0075434_100185645
901 Ga0075434_100223361
902 Ga0075434_101158252
903 Ga0075434_101920196
904 Ga0075434_102655400
905 Ga0075429_100009797
906 Ga0075429_100050002
907 Ga0075429_100540784
908 Ga0068865_100208530
909 Ga0075436_100024178
910 Ga0075436_101366720
911 Ga0075436_101366722
912 Ga0097620_100007895
913 Ga0097620_100405298
914 Ga0097620_101306328
915 Ga0097620_101846056
916 Ga0075435_100004648
917 Ga0075435_100023162
918 Ga0075435_100890161
919 Ga0099794_10003599
920 Ga0099795_10005888
921 Ga0105240_11175561
922 Ga0105240_12488396
923 Ga0105245_10102511
924 Ga0105247_11425531
925 Ga0114129_10028046
926 Ga0114129_10154263
927 Ga0114129_10161134
928 Ga0114129_12467895
929 Ga0105243_10065515
930 Ga0105241_10002814
931 Ga0105242_10039499
932 Ga0105242_10643920
933 Ga0105248_10608769
934 Ga0105248_10783009
935 Ga0105249_10070993
936 Ga0105249_10202377
937 Ga0105249_10575338
938 Ga0105249_10934445
939 Ga0105249_12240878
940 Ga0099796_10128287
941 Ga0099796_10196365
942 Ga0105239_10456157
943 Ga0105246_10265469
944 Ga0105246_10270965
945 Ga0105246_11023511
946 Ga0157373_10000439
947 Ga0157373_10953354
948 Ga0157371_10056912
949 Ga0157370_10377404
950 Ga0157369_10007249
951 Ga0157378_10446537
952 Ga0163162_10147092
953 Ga0163162_10483835
954 Ga0163162_11375680
955 Ga0157372_10000313
956 Ga0157372_10293017
957 Ga0157375_10248913
958 Ga0163163_10048435
959 Ga0163163_10086512
960 Ga0163163_10175176
961 Ga0157380_10396538
962 Ga0182008_10040641
963 Ga0157377_10058176
964 Ga0157379_11323546
965 Ga0157376_11038344
966 Ga0182007_10053252
967 Ga0206356_11486106
968 Ga0213873_10041807
969 Ga0213874_10107891
970 Ga0213874_10118277
971 Ga0213876_10002340
972 Ga0213876_10355487
973 Ga0213876_10463628
974 Ga0213875_10001380
975 Ga0213875_10013336
976 Ga0213875_10307603
977 Ga0213871_10063358
978 Ga0213871_10065830
979 Ga0207653_10000897
980 Ga0207653_10057939
981 Ga0207653_10103721
982 Ga0207692_11024622
983 Ga0207692_11079354
984 Ga0207710_10197761
985 Ga0207699_10030576
986 Ga0207645_10000113
987 Ga0207643_10000164
988 Ga0207684_10005380
989 Ga0207684_11271271
990 Ga0207684_11457536
991 Ga0207654_10013924
992 Ga0207707_10000305
993 Ga0207695_11586399
994 Ga0207693_10015910
995 Ga0207693_10032257
996 Ga0207693_10033485
997 Ga0207693_10492618
998 Ga0207663_10030143
999 Ga0207663_10312747
1000 Ga0207663_11513547
1001 Ga0207663_11551466
1002 Ga0207660_10000085
1003 Ga0207660_10256592
1004 Ga0207662_10163453
1005 Ga0207662_10554097
1006 Ga0207657_10000236
1007 Ga0207652_10000572
1008 Ga0207646_10023117
1009 Ga0207646_10045410
1010 Ga0207646_10253662
1011 Ga0207681_10065016
1012 Ga0207681_10295708
1013 Ga0207650_10055267
1014 Ga0207659_10102562
1015 Ga0207687_10242560
1016 Ga0207700_10042250
1017 Ga0207700_10051033
1018 Ga0207700_10070291
1019 Ga0207700_10141398
1020 Ga0207700_10334043
1021 Ga0207700_10502103
1022 Ga0207700_10703620
1023 Ga0207664_10011243
1024 Ga0207664_10059212
1025 Ga0207664_10193432
1026 Ga0207664_11691112
1027 Ga0207690_10006655
1028 Ga0207706_10027626
1029 Ga0207706_10032703
1030 Ga0207686_10029728
1031 Ga0207709_10036680
1032 Ga0207709_10839275
1033 Ga0207670_10195242
1034 Ga0207670_10587435
1035 Ga0207704_10325830
1036 Ga0207665_10018022
1037 Ga0207665_11451743
1038 Ga0207665_11610061
1039 Ga0207691_10047077
1040 Ga0207711_10160205
1041 Ga0207711_10457579
1042 Ga0207711_10538209
1043 Ga0207711_10663305
1044 Ga0207689_10000870
1045 Ga0207689_10174704
1046 Ga0207689_10340927
1047 Ga0207661_10054798
1048 Ga0207679_10029031
1049 Ga0207667_10001952
1050 Ga0207667_10281575
1051 Ga0207712_10083388
1052 Ga0207712_10580668
1053 Ga0207640_10000992
1054 Ga0207658_10151344
1055 Ga0207677_10075412
1056 Ga0207677_11582759
1057 Ga0207639_10002377
1058 Ga0207678_10007083
1059 Ga0207708_11040089
1060 Ga0207702_10001008
1061 Ga0207702_10008376
1062 Ga0207702_10161525
1063 Ga0207702_10346202
1064 Ga0207641_10069029
1065 Ga0207641_10175329
1066 Ga0207641_10920705
1067 Ga0207641_12081697
1068 Ga0207648_10161512
1069 Ga0207648_11890261
1070 Ga0207676_10011799
1071 Ga0207676_10623739
1072 Ga0207676_10937649
1073 Ga0207674_10000170
1074 Ga0207674_10022186
1075 Ga0207674_11675749
1076 Ga0207675_100009324
1077 Ga0207675_100111477
1078 Ga0207675_100295691
1079 Ga0207698_10406455
1080 Ga0209969_1007082
1081 Ga0209967_1003270
1082 Ga0209981_1006580
1083 Ga0209984_1010481
1084 Ga0210000_1004882
1085 Ga0209995_1003605
1086 Ga0209968_1002706
1087 Ga0209999_1001016
1088 Ga0209982_1003402
1089 Ga0209970_1001851
1090 Ga0209983_1000540
1091 Ga0209588_1002624
1092 Ga0209971_1000163
1093 Ga0209971_1051706
1094 Ga0209966_1000119
1095 Ga0209966_1006750
1096 Ga0209998_10000150
1097 Ga0209998_10006051
1098 Ga0209998_10059281
1099 Ga0209974_10009962
1100 Ga0209974_10044344
1101 Ga0268266_10839787
1102 Ga0268265_10006872
1103 Ga0268265_10494032
1104 Ga0268265_10999833
1105 Ga0268264_10044292
1106 Ga0268264_10208767
1107 Ga0265338_10171768
1108 Ga0265325_10164142
1109 Ga0307408_100116398
1110 Ga0307408_101608118
1111 Ga0307405_10246764
1112 Ga0307407_11409392
1113 Ga0307409_100084866
1114 Ga0307409_100835618
1115 Ga0307416_101312703
1116 Ga0307411_11875220
1117 Ga0307415_100339476
1118 Ga0373948_0014113
1119 Ga0373950_0020394
1120 Ga0373959_0048694
1121 Ga0373926_0134457
1122 Ga0373934_0019289
1123 Ga0373940_0087244
1124 Ga0373944_0136476
1125 Ga0373949_0013308
1126 Ga0373949_0021882
1127 Ga0373949_0208433
1128 Ga0373951_0016513
1129 Ga0373923_0055220
1130 Ga0373932_0192584
1131 Ga0373939_0278437
1132 Ga0373941_0041797
1133 Ga0373945_0467767
1134 Ga0373953_0037622
1135 Ga0373953_0172433
1136 Ga0373954_0010052
1137 Ga0373956_0014193
1138 Ga0373956_0102654
1139 Ga0373957_0061520
1140 Ga0373960_0010360
1141 Ga0373960_0133007
1142 Ga0373943_0115512
1143 Ga0373943_0187559
1144 Ga0373943_0600073
1145 Ga0373946_0077216
1146 Ga0373955_0052869
1147 Ga0373955_0060198
1148 Ga0373961_0004323
1149 Ga0373924_0022868
1150 Ga0373924_0197233
1151 Ga0373931_0148720
1152 Ga0373931_1291553
1153 Ga0373935_0062157
1154 Ga0373935_0103602
1155 Ga0373935_0257375
1156 Ga0373927_0022718
1157 Ga0373927_0200131
1158 Ga0373933_0011306
1159 Ga0373933_0121110
1160 Ga0373933_0229372
1161 Ga0373947_0090849
1162 Ga0373947_0143107
1163 Ga0373937_0027514
1164 Ga0373937_0073288
1165 Ga0373937_0318822
1166 Ga0373937_0562456
1167 Ga0373937_1687036
1168 Ga0373925_0031059
1169 Ga0373925_0118322
1170 Ga0373925_0519559
1171 Ga0373925_0568607
1172 Ga0395900_0618552
1173 Ga0436364_0145813
1174 Ga0436364_0467252
1175 Ga0436364_0601131
1176 Ga0436364_0663275
1177 Ga0436364_1513617
1178 Ga0242420_042086
1179 Ga0242420_126924
1180 Ga0436365_0178215
1181 Ga0436365_0335175
1182 Ga0436365_0457769
1183 Ga0436365_0492069
1184 Ga0436365_1405111
1185 Ga0436365_1597299
1186 Ga0436360_0479485
1187 Ga0436360_0600212
1188 Ga0436360_1227350
1189 Ga0436360_1270871
1190 Ga0436363_0635281
1191 Ga0436363_1048964
1192 Ga0436363_1698508
1193 Ga0436363_1700699
1194 Ga0436362_0431659
1195 Ga0436362_0494949
1196 Ga0436362_0816092
1197 Ga0439441_001047
1198 Ga0439448_0006020
1199 Ga0439450_002450
1200 Ga0439455_0009296
1201 Ga0439455_0017669
1202 Ga0450919_017820
1203 Ga0439458_0002678
1204 Ga0439444_0017514
1205 Ga0439459_0005063
1206 Ga0439460_0001824
1207 Ga0451577_0216339
1208 Ga0453683_0361759
1209 Ga0466963_0431330
1210 Ga0453684_0063129
1211 Ga0453684_1803588
1212 Ga0451576_0025306
1213 Ga0451576_0025584
1214 Ga0451576_0236850
1215 Ga0451576_0321554
1216 Ga0451576_0534632
1217 Ga0451576_0711271
1218 Ga0466967_2163747
1219 Ga0495629_0505448
1220 Ga0495651_0050591
1221 Ga0495653_0067991
1222 Ga0495580_0281094
1223 Ga0495580_0403610
1224 Ga0495639_0147734
1225 Ga0495639_0435446
1226 Ga0495662_0207285
1227 Ga0495662_0298268
1228 Ga0495664_0001798
1229 Ga0495608_0054522
1230 Ga0495608_0058203
1231 Ga0495618_0053319
1232 Ga0495628_0243667
1233 Ga0495628_0983303
1234 Ga0495652_0054502
1235 Ga0495640_0093828
1236 Ga0495640_0152002
1237 Ga0495586_0235196
1238 Ga0495587_0013695
1239 Ga0495587_0447200
1240 Ga0495645_0005511
1241 Ga0495645_0807545
1242 Ga0495667_0023531
1243 Ga0495667_0025467
1244 Ga0495667_0103828
1245 Ga0495667_0378704
1246 Ga0495667_0598937
1247 Ga0495634_0104892
1248 Ga0495635_0094823
1249 Ga0495657_0095018
1250 Ga0495657_0509202
1251 Ga0495657_0654502
1252 Ga0495599_0074004
1253 Ga0495599_0343613
1254 Ga0495599_0860520
1255 Ga0495623_0068077
1256 Ga0495646_0070261
1257 Ga0495600_0153293
1258 Ga0495600_0263425
1259 Ga0495600_0515021
1260 Ga0495604_0017462
1261 Ga0495674_0017151
1262 Ga0495676_0129642
1263 Ga0495680_0077017
1264 Ga0495680_0406427
1265 Ga0495684_0261036
1266 Ga0495684_0573328
1267 Ga0495593_0350555
1268 Ga0495602_0002925
1269 Ga0495614_0502244
1270 Ga0496102_0129875
1271 Ga0496103_0464535
1272 Ga0496104_0073944
1273 Ga0496106_0350117
1274 Ga0496106_0385628
1275 Ga0496106_0892863
1276 Ga0496108_0766259
1277 Ga0496108_0853671
1278 Ga0496109_0477331
1279 Ga0496110_0071394
1280 Ga0496110_0300852
1281 Ga0496112_0084393
1282 Ga0496112_0150159
1283 Ga0496112_0216999
1284 Ga0496113_0250219
1285 Ga0501032_0895354
1286 Ga0501032_0996681
1287 Ga0501033_0019194
1288 Ga0501033_0661771
1289 Ga0501033_1197740
1290 Ga0501036_0173305
1291 Ga0501036_0525965
1292 Ga0501036_0535292
1293 Ga0501036_1029953
1294 Ga0501037_0103642
1295 Ga0501037_0839331
1296 Ga0501038_0030863
1297 Ga0501038_0370356
1298 Ga0501038_0483933
1299 Ga0501039_0047726
1300 Ga0501039_0230428
1301 Ga0501039_1439174
1302 Ga0501040_0105502
1303 Ga0501040_0122381
1304 Ga0501040_0248720
1305 Ga0501040_0262117
1306 Ga0501040_0552343
1307 Ga0501041_0021804
1308 Ga0501041_0139625
1309 Ga0501041_0187344
1310 Ga0501042_0064250
1311 Ga0501042_0156472
1312 Ga0501042_0265789
1313 Ga0501042_0480964
1314 Ga0501042_0637020
1315 Ga0501043_0055508
1316 Ga0501046_0005426
1317 Ga0501046_0204765
1318 Ga0501046_0388570
1319 Ga0501047_0135200
1320 Ga0501048_0014717
1321 Ga0501048_0215247
1322 Ga0501048_0253837
1323 Ga0501067_0006899
1324 Ga0501067_0237298
1325 Ga0501068_0045662
1326 Ga0501068_0061080
1327 Ga0501068_0111897
1328 Ga0501068_0160756
1329 Ga0501068_0278108
1330 Ga0501069_0053225
1331 Ga0501069_0126842
1332 Ga0501070_0151118
1333 Ga0501071_0047689
1334 Ga0501071_0080772
1335 Ga0501071_0387473
1336 Ga0501071_0699449
1337 Ga0501072_0034516
1338 Ga0501072_0043356
1339 Ga0501072_0074126
1340 Ga0501072_0111005
1341 Ga0501072_0510352
1342 Ga0501072_0875437
1343 Ga0501074_0004922
1344 Ga0501074_0131171
1345 Ga0501074_0283567
1346 Ga0501074_0447982
1347 Ga0501075_0030857
1348 Ga0501075_0034666
1349 Ga0501075_0041891
1350 Ga0501075_0069260
1351 Ga0501075_0755666
1352 Ga0501075_0781828
1353 Ga0501075_1491901
1354 Ga0501076_0016701
1355 Ga0501076_0050314
1356 Ga0501076_0215729
1357 Ga0501076_0313878
1358 Ga0501076_0419992
1359 Ga0501076_1510757
1360 Ga0501077_0023284
1361 Ga0501077_0033438
1362 Ga0501077_0046695
1363 Ga0501077_0070177
1364 Ga0501233_259089
1365 Ga0501079_0000544
1366 Ga0501079_0001291
1367 Ga0501079_0004073
1368 Ga0501079_0045890
1369 Ga0501079_0283122
1370 Ga0501079_0403067
1371 Ga0501079_0451588
1372 Ga0501079_1287006
1373 Ga0501080_0028167
1374 Ga0501080_0184001
1375 Ga0501080_0267406
1376 Ga0501080_0281982
1377 Ga0501080_0459130
1378 Ga0501081_0002363
1379 Ga0501081_0062332
1380 Ga0501081_0079440
1381 Ga0501081_0132135
1382 Ga0501081_0162607
1383 Ga0501081_0866592
1384 Ga0501083_0016041
1385 Ga0501083_0320137
1386 Ga0501035_0254502
1387 Ga0501035_0325284
1388 Ga0501045_0006466
1389 Ga0501045_0137241
1390 Ga0501045_0146310
1391 Ga0501045_0162269
1392 nmdc:mga05p37_142449_c1
1393 nmdc:mga05p37_171211_c1
1394 nmdc:mga05p37_27612_c1
1395 nmdc:mga09592_10160_c1
1396 nmdc:mga09592_1270679_c1
1397 nmdc:mga09592_484326_c1
1398 nmdc:mga0qj67_132375_c1
1399 nmdc:mga0qj67_6307_c1
1400 nmdc:mga06r32_319_c1
1401 nmdc:mga06r32_338871_c1
1402 nmdc:mga06r32_50894_c1
1403 nmdc:mga06r32_8924_c1
1404 nmdc:mga0n895_165417_c1
1405 nmdc:mga0n895_169910_c1
1406 nmdc:mga0n895_2180843_c1
1407 nmdc:mga0n895_2201612_c1
1408 nmdc:mga0n895_283669_c1
1409 nmdc:mga0n895_287774_c1
1410 nmdc:mga0n895_306800_c1
1411 nmdc:mga0n895_47458_c1
1412 nmdc:mga0rr50_313289_c1
1413 nmdc:mga0rr50_5599_c1
1414 nmdc:mga08x19_69450_c1
1415 nmdc:mga0a205_411_c1
1416 nmdc:mga0a205_52258_c1
1417 nmdc:mga0a205_839442_c1
1418 Ga0495601_0004384
1419 Ga0495601_0022902
1420 Ga0495601_0117775
1421 Ga0495601_0709592
1422 Ga0495612_0001013
1423 Ga0495595_0106915
1424 Ga0495595_0329371
1425 Ga0495595_0392098
1426 Ga0495619_0260640
1427 Ga0495619_0530450
1428 Ga0501084_0000637
1429 Ga0501084_0037585
1430 Ga0501084_0213163
1431 Ga0501084_0313452
1432 Ga0501084_0461014
1433 Ga0501084_0804571
1434 Ga0501084_1045823
1435 Ga0590071_012115
1436 Ga0501082_0001274
1437 Ga0501082_0001594
1438 Ga0501082_0081198
1439 Ga0501082_0189389
1440 Ga0501082_0602393
1441 Ga0530510_0002661
1442 Ga0530510_0019222
1443 Ga0530510_0064087
1444 Ga0530510_0093569

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

22

99

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f44-assembly1.cif.gz_A crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution 0.8278 3 81
3mcs-assembly1.cif.gz_A crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution 0.7847 3 80
2fb0-assembly1.cif.gz_A-2 crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase 0.7631 3 82
2omo-assembly2.cif.gz_C putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea 0.7521 3 84
4kia-assembly1.cif.gz_A crystal structure of lmhde, heme-degrading enzyme, from listeria monocytogenes 0.7371 3 81
ID Description Score Start End Superfamily
3mcsA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7873 3 82 3.30.70.100
af_P78833_2_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7693 3 82 3.30.70.100
1q8bA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7549 2 81 3.30.70.100
2fb0A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7337 3 80 3.30.70.100
af_O06569_1_91_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7294 1 82 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2V2GUK5-F1-model_v4 deleted 0.9187 2 77
AF-A0A379K550-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.8915 1 75 GO:0004497
GO:0005829
AF-A0A5C5SDI7-F1-model_v4 ABM domain-containing protein 0.8892 3 77
AF-A0A372KQ20-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.8844 2 82 GO:0004497
AF-A0A7V4PS86-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.8787 1 77 GO:0004497
GO:0005829

Map