F477431
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 336 | 1444 | 106 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1363774|Ga0436364_1363774_2935_3327 |
| Length | 130 |
| Sequence | MTPALDGGNMARAMQMKREGQMLALWVKVRVKPEERERFLKAIEVDALGSERDEPGCLRFNVLRDQQDQNVYYFFEVYRDEAALEAHRAAPHYAVWRAAADTLDGPAEATRCTSVFPSLAEYWEKRGASA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 217 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 226 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 232 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 233 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 241 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 242 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 243 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 247 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 248 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.08 |
| Rhizosphere | 94.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_1363774 | 3300037853 | Bacteria | 3872 |
| 2 | Ga0065712_10165001 | 3300005290 | Bacteria | 1255 |
| 3 | Ga0065715_10121377 | 3300005293 | Bacteria | 2231 |
| 4 | Ga0070676_10010612 | 3300005328 | Bacteria | 4998 |
| 5 | Ga0070683_100074566 | 3300005329 | Bacteria | 3169 |
| 6 | Ga0070683_100451157 | 3300005329 | Unclassified | 1227 |
| 7 | Ga0070670_100002086 | 3300005331 | Bacteria | 16383 |
| 8 | Ga0070670_101412345 | 3300005331 | Unclassified | 638 |
| 9 | Ga0068869_100000242 | 3300005334 | Bacteria | 28762 |
| 10 | Ga0068869_101008795 | 3300005334 | Bacteria | 725 |
| 11 | Ga0070666_11442555 | 3300005335 | Unclassified | 514 |
| 12 | Ga0070680_100000172 | 3300005336 | Bacteria | 41297 |
| 13 | Ga0070680_100020227 | 3300005336 | Bacteria | 5282 |
| 14 | Ga0070680_100460322 | 3300005336 | Bacteria | 1087 |
| 15 | Ga0070682_100002377 | 3300005337 | Bacteria | 10428 |
| 16 | Ga0070682_100372639 | 3300005337 | Unclassified | 1071 |
| 17 | Ga0068868_100027785 | 3300005338 | Bacteria | 4319 |
| 18 | Ga0068868_101615970 | 3300005338 | Unclassified | 609 |
| 19 | Ga0070660_100001451 | 3300005339 | Bacteria | 16205 |
| 20 | Ga0070660_100952401 | 3300005339 | Bacteria | 725 |
| 21 | Ga0070689_100006819 | 3300005340 | Bacteria | 7944 |
| 22 | Ga0070689_100650488 | 3300005340 | Bacteria | 917 |
| 23 | Ga0070689_100986720 | 3300005340 | Bacteria | 749 |
| 24 | Ga0070691_10019730 | 3300005341 | Bacteria | 3113 |
| 25 | Ga0070691_10026968 | 3300005341 | Bacteria | 2679 |
| 26 | Ga0070687_100248847 | 3300005343 | Bacteria | 1103 |
| 27 | Ga0070661_100053534 | 3300005344 | Bacteria | 2954 |
| 28 | Ga0070692_10000564 | 3300005345 | Bacteria | 11606 |
| 29 | Ga0070692_10002520 | 3300005345 | Bacteria | 7127 |
| 30 | Ga0070692_11152994 | 3300005345 | Bacteria | 550 |
| 31 | Ga0070669_100095739 | 3300005353 | Bacteria | 2233 |
| 32 | Ga0070669_100371017 | 3300005353 | Bacteria | 1166 |
| 33 | Ga0070669_100941234 | 3300005353 | Bacteria | 739 |
| 34 | Ga0070675_100377625 | 3300005354 | Bacteria | 1261 |
| 35 | Ga0070675_100924510 | 3300005354 | Bacteria | 800 |
| 36 | Ga0070671_101827642 | 3300005355 | Unclassified | 540 |
| 37 | Ga0070674_100890222 | 3300005356 | Bacteria | 775 |
| 38 | Ga0070674_102206940 | 3300005356 | Bacteria | 503 |
| 39 | Ga0070673_100290274 | 3300005364 | Bacteria | 1437 |
| 40 | Ga0070659_100000892 | 3300005366 | Bacteria | 21835 |
| 41 | Ga0070667_100260981 | 3300005367 | Bacteria | 1551 |
| 42 | Ga0070703_10006211 | 3300005406 | Bacteria | 3345 |
| 43 | Ga0070703_10030706 | 3300005406 | Bacteria | 1621 |
| 44 | Ga0070709_10012934 | 3300005434 | Bacteria | 4679 |
| 45 | Ga0070714_100082353 | 3300005435 | Bacteria | 2803 |
| 46 | Ga0070714_100394738 | 3300005435 | Bacteria | 1306 |
| 47 | Ga0070714_100408590 | 3300005435 | Unclassified | 1284 |
| 48 | Ga0070714_102339713 | 3300005435 | Unclassified | 519 |
| 49 | Ga0070713_100046474 | 3300005436 | Bacteria | 3562 |
| 50 | Ga0070713_100132640 | 3300005436 | Bacteria | 2198 |
| 51 | Ga0070713_100984579 | 3300005436 | Unclassified | 813 |
| 52 | Ga0070710_10380108 | 3300005437 | Bacteria | 942 |
| 53 | Ga0070710_10404435 | 3300005437 | Bacteria | 916 |
| 54 | Ga0070701_10182760 | 3300005438 | Bacteria | 1229 |
| 55 | Ga0070711_100012412 | 3300005439 | Bacteria | 5322 |
| 56 | Ga0070711_100199951 | 3300005439 | Bacteria | 1541 |
| 57 | Ga0070711_100256689 | 3300005439 | Bacteria | 1373 |
| 58 | Ga0070711_100262366 | 3300005439 | Bacteria | 1360 |
| 59 | Ga0070705_100007493 | 3300005440 | Bacteria | 5372 |
| 60 | Ga0070705_100024866 | 3300005440 | Bacteria | 3238 |
| 61 | Ga0070705_100232339 | 3300005440 | Unclassified | 1284 |
| 62 | Ga0070705_101783665 | 3300005440 | Bacteria | 522 |
| 63 | Ga0070705_101957626 | 3300005440 | Bacteria | 500 |
| 64 | Ga0070700_100060196 | 3300005441 | Bacteria | 2393 |
| 65 | Ga0070700_100860393 | 3300005441 | Bacteria | 735 |
| 66 | Ga0070694_100001215 | 3300005444 | Bacteria | 14868 |
| 67 | Ga0070694_100001268 | 3300005444 | Bacteria | 14675 |
| 68 | Ga0070694_100044269 | 3300005444 | Bacteria | 2978 |
| 69 | Ga0070708_100077381 | 3300005445 | Bacteria | 3006 |
| 70 | Ga0070708_100288589 | 3300005445 | Unclassified | 1545 |
| 71 | Ga0070708_100735834 | 3300005445 | Bacteria | 928 |
| 72 | Ga0070663_100002216 | 3300005455 | Bacteria | 10875 |
| 73 | Ga0070662_100015351 | 3300005457 | Bacteria | 5128 |
| 74 | Ga0070662_100047177 | 3300005457 | Bacteria | 3098 |
| 75 | Ga0070681_10018294 | 3300005458 | Bacteria | 7004 |
| 76 | Ga0070681_11998038 | 3300005458 | Bacteria | 508 |
| 77 | Ga0068867_100201411 | 3300005459 | Bacteria | 1594 |
| 78 | Ga0070706_100322770 | 3300005467 | Bacteria | 1440 |
| 79 | Ga0070706_100584995 | 3300005467 | Bacteria | 1038 |
| 80 | Ga0070706_100854186 | 3300005467 | Unclassified | 841 |
| 81 | Ga0070706_101537200 | 3300005467 | Unclassified | 608 |
| 82 | Ga0070707_100015584 | 3300005468 | Bacteria | 7134 |
| 83 | Ga0070707_100046043 | 3300005468 | Bacteria | 4174 |
| 84 | Ga0070707_100385237 | 3300005468 | Bacteria | 1362 |
| 85 | Ga0070707_100614933 | 3300005468 | Unclassified | 1049 |
| 86 | Ga0070707_102321884 | 3300005468 | Bacteria | 504 |
| 87 | Ga0070707_102322687 | 3300005468 | Bacteria | 504 |
| 88 | Ga0070698_100136302 | 3300005471 | Bacteria | 2408 |
| 89 | Ga0070699_100015393 | 3300005518 | Bacteria | 6573 |
| 90 | Ga0070699_100020082 | 3300005518 | Bacteria | 5757 |
| 91 | Ga0070699_100240267 | 3300005518 | Bacteria | 1616 |
| 92 | Ga0070699_101103972 | 3300005518 | Bacteria | 728 |
| 93 | Ga0070679_100000185 | 3300005530 | Bacteria | 50363 |
| 94 | Ga0070679_101877912 | 3300005530 | Bacteria | 548 |
| 95 | Ga0070684_100033556 | 3300005535 | Bacteria | 4384 |
| 96 | Ga0070684_101655607 | 3300005535 | Unclassified | 604 |
| 97 | Ga0070684_101911968 | 3300005535 | Bacteria | 560 |
| 98 | Ga0070697_100289796 | 3300005536 | Bacteria | 1406 |
| 99 | Ga0070697_100496497 | 3300005536 | Unclassified | 1067 |
| 100 | Ga0070697_101356718 | 3300005536 | Bacteria | 635 |
| 101 | Ga0068853_100012041 | 3300005539 | Bacteria | 7037 |
| 102 | Ga0070686_100638789 | 3300005544 | Bacteria | 843 |
| 103 | Ga0070686_100701451 | 3300005544 | Bacteria | 807 |
| 104 | Ga0070686_100811232 | 3300005544 | Bacteria | 755 |
| 105 | Ga0070695_100000865 | 3300005545 | Bacteria | 16307 |
| 106 | Ga0070695_100003727 | 3300005545 | Bacteria | 8890 |
| 107 | Ga0070695_100006846 | 3300005545 | Bacteria | 6751 |
| 108 | Ga0070695_100221091 | 3300005545 | Bacteria | 1364 |
| 109 | Ga0070696_100002658 | 3300005546 | Bacteria | 11843 |
| 110 | Ga0070696_100085466 | 3300005546 | Bacteria | 2239 |
| 111 | Ga0070696_101562655 | 3300005546 | Bacteria | 566 |
| 112 | Ga0070696_101593517 | 3300005546 | Unclassified | 561 |
| 113 | Ga0070693_100000248 | 3300005547 | Bacteria | 25117 |
| 114 | Ga0070665_100372663 | 3300005548 | Bacteria | 1435 |
| 115 | Ga0070704_100002912 | 3300005549 | Bacteria | 9719 |
| 116 | Ga0070704_100523445 | 3300005549 | Bacteria | 1032 |
| 117 | Ga0068855_100000437 | 3300005563 | Bacteria | 51661 |
| 118 | Ga0068855_100394445 | 3300005563 | Bacteria | 1518 |
| 119 | Ga0068855_100913732 | 3300005563 | Unclassified | 927 |
| 120 | Ga0070664_100004721 | 3300005564 | Bacteria | 10929 |
| 121 | Ga0068857_100003434 | 3300005577 | Bacteria | 13223 |
| 122 | Ga0068857_100124460 | 3300005577 | Bacteria | 2323 |
| 123 | Ga0068854_100002679 | 3300005578 | Bacteria | 11036 |
| 124 | Ga0068856_100000464 | 3300005614 | Bacteria | 44730 |
| 125 | Ga0068856_100082353 | 3300005614 | Bacteria | 3194 |
| 126 | Ga0068856_100104805 | 3300005614 | Plasmid | 2822 |
| 127 | Ga0068856_100964824 | 3300005614 | Bacteria | 871 |
| 128 | Ga0068856_102423761 | 3300005614 | Unclassified | 532 |
| 129 | Ga0070702_100033954 | 3300005615 | Bacteria | 2809 |
| 130 | Ga0068859_100007895 | 3300005617 | Bacteria | 10798 |
| 131 | Ga0068859_100405292 | 3300005617 | Bacteria | 1460 |
| 132 | Ga0068859_101306301 | 3300005617 | Bacteria | 799 |
| 133 | Ga0068859_101846068 | 3300005617 | Bacteria | 667 |
| 134 | Ga0068864_100001333 | 3300005618 | Bacteria | 20559 |
| 135 | Ga0068864_100462589 | 3300005618 | Bacteria | 1215 |
| 136 | Ga0068864_102210246 | 3300005618 | Bacteria | 557 |
| 137 | Ga0068866_10223299 | 3300005718 | Bacteria | 1138 |
| 138 | Ga0068861_100010099 | 3300005719 | Bacteria | 6546 |
| 139 | Ga0068870_10000256 | 3300005840 | Bacteria | 19580 |
| 140 | Ga0068863_100115930 | 3300005841 | Unclassified | 2553 |
| 141 | Ga0068863_100515027 | 3300005841 | Bacteria | 1179 |
| 142 | Ga0068863_100754375 | 3300005841 | Unclassified | 969 |
| 143 | Ga0068863_101151176 | 3300005841 | Bacteria | 781 |
| 144 | Ga0068858_100475464 | 3300005842 | Bacteria | 1206 |
| 145 | Ga0068858_101568684 | 3300005842 | Bacteria | 650 |
| 146 | Ga0068860_100030858 | 3300005843 | Bacteria | 5153 |
| 147 | Ga0068860_100085941 | 3300005843 | Bacteria | 2993 |
| 148 | Ga0068860_100352507 | 3300005843 | Bacteria | 1448 |
| 149 | Ga0068860_102096751 | 3300005843 | Bacteria | 587 |
| 150 | Ga0068862_100022105 | 3300005844 | Bacteria | 5322 |
| 151 | Ga0068862_102187294 | 3300005844 | Bacteria | 564 |
| 152 | Ga0081455_10001327 | 3300005937 | Bacteria | 30589 |
| 153 | Ga0081455_10649439 | 3300005937 | Bacteria | 680 |
| 154 | Ga0081540_1001963 | 3300005983 | Bacteria | 17161 |
| 155 | Ga0070717_10027539 | 3300006028 | Unclassified | 4543 |
| 156 | Ga0070717_10658095 | 3300006028 | Unclassified | 951 |
| 157 | Ga0070717_10855105 | 3300006028 | Unclassified | 828 |
| 158 | Ga0070717_11128176 | 3300006028 | Unclassified | 714 |
| 159 | Ga0070717_11485703 | 3300006028 | Unclassified | 615 |
| 160 | Ga0070715_10280524 | 3300006163 | Unclassified | 883 |
| 161 | Ga0070716_100076357 | 3300006173 | Bacteria | 1985 |
| 162 | Ga0070712_100022869 | 3300006175 | Bacteria | 4122 |
| 163 | Ga0070712_100038484 | 3300006175 | Bacteria | 3269 |
| 164 | Ga0070712_100157695 | 3300006175 | Unclassified | 1750 |
| 165 | Ga0070712_100226483 | 3300006175 | Bacteria | 1483 |
| 166 | Ga0070712_100859207 | 3300006175 | Unclassified | 781 |
| 167 | Ga0097621_100288142 | 3300006237 | Bacteria | 1447 |
| 168 | Ga0068871_100262331 | 3300006358 | Bacteria | 1507 |
| 169 | Ga0075430_100013495 | 3300006846 | Bacteria | 6964 |
| 170 | Ga0075431_100000061 | 3300006847 | Bacteria | 61386 |
| 171 | Ga0075431_100001236 | 3300006847 | Bacteria | 23180 |
| 172 | Ga0075431_100227414 | 3300006847 | Bacteria | 1902 |
| 173 | Ga0075431_100286936 | 3300006847 | Bacteria | 1666 |
| 174 | Ga0075431_100455275 | 3300006847 | Bacteria | 1275 |
| 175 | Ga0075433_10011484 | 3300006852 | Bacteria | 7132 |
| 176 | Ga0075433_10609273 | 3300006852 | Bacteria | 958 |
| 177 | Ga0075434_100004221 | 3300006871 | Bacteria | 12880 |
| 178 | Ga0075434_100185645 | 3300006871 | Bacteria | 2100 |
| 179 | Ga0075434_100223361 | 3300006871 | Bacteria | 1903 |
| 180 | Ga0075434_101158252 | 3300006871 | Unclassified | 786 |
| 181 | Ga0075434_101920196 | 3300006871 | Bacteria | 598 |
| 182 | Ga0075434_102655400 | 3300006871 | Unclassified | 501 |
| 183 | Ga0075429_100009797 | 3300006880 | Bacteria | 8307 |
| 184 | Ga0075429_100050002 | 3300006880 | Bacteria | 3637 |
| 185 | Ga0075429_100540784 | 3300006880 | Bacteria | 1021 |
| 186 | Ga0068865_100208530 | 3300006881 | Bacteria | 1521 |
| 187 | Ga0075436_100024178 | 3300006914 | Bacteria | 4176 |
| 188 | Ga0075436_101366720 | 3300006914 | Unclassified | 536 |
| 189 | Ga0075436_101366722 | 3300006914 | Unclassified | 536 |
| 190 | Ga0097620_100007895 | 3300006931 | Bacteria | 10798 |
| 191 | Ga0097620_100405298 | 3300006931 | Bacteria | 1460 |
| 192 | Ga0097620_101306328 | 3300006931 | Bacteria | 799 |
| 193 | Ga0097620_101846056 | 3300006931 | Bacteria | 667 |
| 194 | Ga0075435_100004648 | 3300007076 | Bacteria | 9461 |
| 195 | Ga0075435_100023162 | 3300007076 | Bacteria | 4798 |
| 196 | Ga0075435_100890161 | 3300007076 | Bacteria | 776 |
| 197 | Ga0099794_10003599 | 3300007265 | Bacteria | 5943 |
| 198 | Ga0099795_10005888 | 3300007788 | Bacteria | 3302 |
| 199 | Ga0105240_11175561 | 3300009093 | Bacteria | 813 |
| 200 | Ga0105240_12488396 | 3300009093 | Bacteria | 535 |
| 201 | Ga0105245_10102511 | 3300009098 | Bacteria | 2650 |
| 202 | Ga0105247_11425531 | 3300009101 | Unclassified | 562 |
| 203 | Ga0114129_10028046 | 3300009147 | Bacteria | 7975 |
| 204 | Ga0114129_10154263 | 3300009147 | Bacteria | 3142 |
| 205 | Ga0114129_10161134 | 3300009147 | Bacteria | 3064 |
| 206 | Ga0114129_12467895 | 3300009147 | Bacteria | 622 |
| 207 | Ga0105243_10065515 | 3300009148 | Bacteria | 2919 |
| 208 | Ga0105241_10002814 | 3300009174 | Bacteria | 13015 |
| 209 | Ga0105242_10039499 | 3300009176 | Bacteria | 3799 |
| 210 | Ga0105242_10643920 | 3300009176 | Unclassified | 1030 |
| 211 | Ga0105248_10608769 | 3300009177 | Bacteria | 1232 |
| 212 | Ga0105248_10783009 | 3300009177 | Bacteria | 1076 |
| 213 | Ga0105249_10070993 | 3300009553 | Bacteria | 3216 |
| 214 | Ga0105249_10202377 | 3300009553 | Bacteria | 1944 |
| 215 | Ga0105249_10575338 | 3300009553 | Bacteria | 1179 |
| 216 | Ga0105249_10934445 | 3300009553 | Bacteria | 935 |
| 217 | Ga0105249_12240878 | 3300009553 | Unclassified | 619 |
| 218 | Ga0099796_10128287 | 3300010159 | Unclassified | 981 |
| 219 | Ga0099796_10196365 | 3300010159 | Bacteria | 817 |
| 220 | Ga0105239_10456157 | 3300010375 | Bacteria | 1451 |
| 221 | Ga0105246_10265469 | 3300011119 | Bacteria | 1370 |
| 222 | Ga0105246_10270965 | 3300011119 | Bacteria | 1357 |
| 223 | Ga0105246_11023511 | 3300011119 | Unclassified | 749 |
| 224 | Ga0157373_10000439 | 3300013100 | Bacteria | 33045 |
| 225 | Ga0157373_10953354 | 3300013100 | Unclassified | 638 |
| 226 | Ga0157371_10056912 | 3300013102 | Bacteria | 2773 |
| 227 | Ga0157370_10377404 | 3300013104 | Bacteria | 1306 |
| 228 | Ga0157369_10007249 | 3300013105 | Bacteria | 12763 |
| 229 | Ga0157378_10446537 | 3300013297 | Bacteria | 1283 |
| 230 | Ga0163162_10147092 | 3300013306 | Bacteria | 2473 |
| 231 | Ga0163162_10483835 | 3300013306 | Bacteria | 1369 |
| 232 | Ga0163162_11375680 | 3300013306 | Unclassified | 803 |
| 233 | Ga0157372_10000313 | 3300013307 | Bacteria | 53548 |
| 234 | Ga0157372_10293017 | 3300013307 | Bacteria | 1893 |
| 235 | Ga0157375_10248913 | 3300013308 | Bacteria | 1938 |
| 236 | Ga0163163_10048435 | 3300014325 | Bacteria | 4179 |
| 237 | Ga0163163_10086512 | 3300014325 | Bacteria | 3144 |
| 238 | Ga0163163_10175176 | 3300014325 | Bacteria | 2191 |
| 239 | Ga0157380_10396538 | 3300014326 | Bacteria | 1308 |
| 240 | Ga0182008_10040641 | 3300014497 | Unclassified | 2321 |
| 241 | Ga0157377_10058176 | 3300014745 | Bacteria | 2200 |
| 242 | Ga0157379_11323546 | 3300014968 | Bacteria | 696 |
| 243 | Ga0157376_11038344 | 3300014969 | Unclassified | 843 |
| 244 | Ga0182007_10053252 | 3300015262 | Bacteria | 1332 |
| 245 | Ga0206356_11486106 | 3300020070 | Unclassified | 524 |
| 246 | Ga0213873_10041807 | 3300021358 | Bacteria | 1183 |
| 247 | Ga0213874_10107891 | 3300021377 | Unclassified | 933 |
| 248 | Ga0213874_10118277 | 3300021377 | Bacteria | 898 |
| 249 | Ga0213876_10002340 | 3300021384 | Bacteria | 11176 |
| 250 | Ga0213876_10355487 | 3300021384 | Unclassified | 779 |
| 251 | Ga0213876_10463628 | 3300021384 | Bacteria | 674 |
| 252 | Ga0213875_10001380 | 3300021388 | Bacteria | 15928 |
| 253 | Ga0213875_10013336 | 3300021388 | Bacteria | 4039 |
| 254 | Ga0213875_10307603 | 3300021388 | Unclassified | 750 |
| 255 | Ga0213871_10063358 | 3300021441 | Bacteria | 1033 |
| 256 | Ga0213871_10065830 | 3300021441 | Bacteria | 1016 |
| 257 | Ga0207653_10000897 | 3300025885 | Bacteria | 9881 |
| 258 | Ga0207653_10057939 | 3300025885 | Bacteria | 1301 |
| 259 | Ga0207653_10103721 | 3300025885 | Bacteria | 1008 |
| 260 | Ga0207692_11024622 | 3300025898 | Unclassified | 545 |
| 261 | Ga0207692_11079354 | 3300025898 | Bacteria | 531 |
| 262 | Ga0207710_10197761 | 3300025900 | Bacteria | 992 |
| 263 | Ga0207699_10030576 | 3300025906 | Bacteria | 3015 |
| 264 | Ga0207645_10000113 | 3300025907 | Bacteria | 60937 |
| 265 | Ga0207643_10000164 | 3300025908 | Bacteria | 45857 |
| 266 | Ga0207684_10005380 | 3300025910 | Bacteria | 11827 |
| 267 | Ga0207684_11271271 | 3300025910 | Bacteria | 607 |
| 268 | Ga0207684_11457536 | 3300025910 | Unclassified | 558 |
| 269 | Ga0207654_10013924 | 3300025911 | Bacteria | 4146 |
| 270 | Ga0207707_10000305 | 3300025912 | Bacteria | 51662 |
| 271 | Ga0207695_11586399 | 3300025913 | Bacteria | 535 |
| 272 | Ga0207693_10015910 | 3300025915 | Bacteria | 6022 |
| 273 | Ga0207693_10032257 | 3300025915 | Bacteria | 4135 |
| 274 | Ga0207693_10033485 | 3300025915 | Bacteria | 4054 |
| 275 | Ga0207693_10492618 | 3300025915 | Bacteria | 957 |
| 276 | Ga0207663_10030143 | 3300025916 | Bacteria | 3196 |
| 277 | Ga0207663_10312747 | 3300025916 | Bacteria | 1178 |
| 278 | Ga0207663_11513547 | 3300025916 | Bacteria | 540 |
| 279 | Ga0207663_11551466 | 3300025916 | Bacteria | 533 |
| 280 | Ga0207660_10000085 | 3300025917 | Bacteria | 49898 |
| 281 | Ga0207660_10256592 | 3300025917 | Bacteria | 1381 |
| 282 | Ga0207662_10163453 | 3300025918 | Bacteria | 1424 |
| 283 | Ga0207662_10554097 | 3300025918 | Bacteria | 796 |
| 284 | Ga0207657_10000236 | 3300025919 | Bacteria | 58234 |
| 285 | Ga0207652_10000572 | 3300025921 | Bacteria | 37038 |
| 286 | Ga0207646_10023117 | 3300025922 | Bacteria | 5714 |
| 287 | Ga0207646_10045410 | 3300025922 | Bacteria | 3944 |
| 288 | Ga0207646_10253662 | 3300025922 | Bacteria | 1589 |
| 289 | Ga0207681_10065016 | 3300025923 | Bacteria | 2520 |
| 290 | Ga0207681_10295708 | 3300025923 | Bacteria | 1280 |
| 291 | Ga0207650_10055267 | 3300025925 | Bacteria | 2947 |
| 292 | Ga0207659_10102562 | 3300025926 | Bacteria | 2160 |
| 293 | Ga0207687_10242560 | 3300025927 | Bacteria | 1429 |
| 294 | Ga0207700_10042250 | 3300025928 | Unclassified | 3341 |
| 295 | Ga0207700_10051033 | 3300025928 | Bacteria | 3085 |
| 296 | Ga0207700_10070291 | 3300025928 | Bacteria | 2690 |
| 297 | Ga0207700_10141398 | 3300025928 | Bacteria | 1978 |
| 298 | Ga0207700_10334043 | 3300025928 | Bacteria | 1316 |
| 299 | Ga0207700_10502103 | 3300025928 | Bacteria | 1073 |
| 300 | Ga0207700_10703620 | 3300025928 | Unclassified | 902 |
| 301 | Ga0207664_10011243 | 3300025929 | Bacteria | 6350 |
| 302 | Ga0207664_10059212 | 3300025929 | Plasmid | 3049 |
| 303 | Ga0207664_10193432 | 3300025929 | Bacteria | 1752 |
| 304 | Ga0207664_11691112 | 3300025929 | Bacteria | 555 |
| 305 | Ga0207690_10006655 | 3300025932 | Bacteria | 6847 |
| 306 | Ga0207706_10027626 | 3300025933 | Bacteria | 5073 |
| 307 | Ga0207706_10032703 | 3300025933 | Bacteria | 4630 |
| 308 | Ga0207686_10029728 | 3300025934 | Bacteria | 3227 |
| 309 | Ga0207709_10036680 | 3300025935 | Bacteria | 2907 |
| 310 | Ga0207709_10839275 | 3300025935 | Unclassified | 744 |
| 311 | Ga0207670_10195242 | 3300025936 | Bacteria | 1534 |
| 312 | Ga0207670_10587435 | 3300025936 | Bacteria | 913 |
| 313 | Ga0207704_10325830 | 3300025938 | Bacteria | 1187 |
| 314 | Ga0207665_10018022 | 3300025939 | Bacteria | 4639 |
| 315 | Ga0207665_11451743 | 3300025939 | Bacteria | 546 |
| 316 | Ga0207665_11610061 | 3300025939 | Bacteria | 515 |
| 317 | Ga0207691_10047077 | 3300025940 | Bacteria | 3960 |
| 318 | Ga0207711_10160205 | 3300025941 | Bacteria | 2036 |
| 319 | Ga0207711_10457579 | 3300025941 | Bacteria | 1188 |
| 320 | Ga0207711_10538209 | 3300025941 | Bacteria | 1089 |
| 321 | Ga0207711_10663305 | 3300025941 | Bacteria | 973 |
| 322 | Ga0207689_10000870 | 3300025942 | Bacteria | 29137 |
| 323 | Ga0207689_10174704 | 3300025942 | Bacteria | 1771 |
| 324 | Ga0207689_10340927 | 3300025942 | Bacteria | 1245 |
| 325 | Ga0207661_10054798 | 3300025944 | Bacteria | 3196 |
| 326 | Ga0207679_10029031 | 3300025945 | Bacteria | 3847 |
| 327 | Ga0207667_10001952 | 3300025949 | Bacteria | 25839 |
| 328 | Ga0207667_10281575 | 3300025949 | Bacteria | 1699 |
| 329 | Ga0207712_10083388 | 3300025961 | Bacteria | 2333 |
| 330 | Ga0207712_10580668 | 3300025961 | Unclassified | 967 |
| 331 | Ga0207640_10000992 | 3300025981 | Bacteria | 15701 |
| 332 | Ga0207658_10151344 | 3300025986 | Bacteria | 1891 |
| 333 | Ga0207677_10075412 | 3300026023 | Bacteria | 2397 |
| 334 | Ga0207677_11582759 | 3300026023 | Unclassified | 606 |
| 335 | Ga0207639_10002377 | 3300026041 | Bacteria | 12641 |
| 336 | Ga0207678_10007083 | 3300026067 | Bacteria | 9949 |
| 337 | Ga0207708_11040089 | 3300026075 | Bacteria | 712 |
| 338 | Ga0207702_10001008 | 3300026078 | Bacteria | 28905 |
| 339 | Ga0207702_10008376 | 3300026078 | Bacteria | 8723 |
| 340 | Ga0207702_10161525 | 3300026078 | Bacteria | 2046 |
| 341 | Ga0207702_10346202 | 3300026078 | Bacteria | 1421 |
| 342 | Ga0207641_10069029 | 3300026088 | Bacteria | 3032 |
| 343 | Ga0207641_10175329 | 3300026088 | Bacteria | 1960 |
| 344 | Ga0207641_10920705 | 3300026088 | Unclassified | 869 |
| 345 | Ga0207641_12081697 | 3300026088 | Unclassified | 568 |
| 346 | Ga0207648_10161512 | 3300026089 | Bacteria | 1979 |
| 347 | Ga0207648_11890261 | 3300026089 | Bacteria | 558 |
| 348 | Ga0207676_10011799 | 3300026095 | Bacteria | 6251 |
| 349 | Ga0207676_10623739 | 3300026095 | Bacteria | 1038 |
| 350 | Ga0207676_10937649 | 3300026095 | Bacteria | 851 |
| 351 | Ga0207674_10000170 | 3300026116 | Bacteria | 78770 |
| 352 | Ga0207674_10022186 | 3300026116 | Bacteria | 6823 |
| 353 | Ga0207674_11675749 | 3300026116 | Unclassified | 604 |
| 354 | Ga0207675_100009324 | 3300026118 | Bacteria | 9201 |
| 355 | Ga0207675_100111477 | 3300026118 | Bacteria | 2581 |
| 356 | Ga0207675_100295691 | 3300026118 | Bacteria | 1576 |
| 357 | Ga0207698_10406455 | 3300026142 | Bacteria | 1303 |
| 358 | Ga0209969_1007082 | 3300027360 | Bacteria | 1581 |
| 359 | Ga0209967_1003270 | 3300027364 | Bacteria | 2134 |
| 360 | Ga0209981_1006580 | 3300027378 | Bacteria | 1556 |
| 361 | Ga0209984_1010481 | 3300027424 | Bacteria | 1190 |
| 362 | Ga0210000_1004882 | 3300027462 | Bacteria | 1941 |
| 363 | Ga0209995_1003605 | 3300027471 | Bacteria | 2466 |
| 364 | Ga0209968_1002706 | 3300027526 | Bacteria | 2662 |
| 365 | Ga0209999_1001016 | 3300027543 | Bacteria | 4762 |
| 366 | Ga0209982_1003402 | 3300027552 | Bacteria | 2261 |
| 367 | Ga0209970_1001851 | 3300027614 | Bacteria | 3664 |
| 368 | Ga0209983_1000540 | 3300027665 | Bacteria | 8157 |
| 369 | Ga0209588_1002624 | 3300027671 | Bacteria | 4895 |
| 370 | Ga0209971_1000163 | 3300027682 | Bacteria | 19906 |
| 371 | Ga0209971_1051706 | 3300027682 | Bacteria | 993 |
| 372 | Ga0209966_1000119 | 3300027695 | Bacteria | 35102 |
| 373 | Ga0209966_1006750 | 3300027695 | Bacteria | 1998 |
| 374 | Ga0209998_10000150 | 3300027717 | Bacteria | 26296 |
| 375 | Ga0209998_10006051 | 3300027717 | Bacteria | 2518 |
| 376 | Ga0209998_10059281 | 3300027717 | Bacteria | 899 |
| 377 | Ga0209974_10009962 | 3300027876 | Bacteria | 3214 |
| 378 | Ga0209974_10044344 | 3300027876 | Unclassified | 1483 |
| 379 | Ga0268266_10839787 | 3300028379 | Bacteria | 888 |
| 380 | Ga0268265_10006872 | 3300028380 | Bacteria | 7698 |
| 381 | Ga0268265_10494032 | 3300028380 | Bacteria | 1152 |
| 382 | Ga0268265_10999833 | 3300028380 | Bacteria | 826 |
| 383 | Ga0268264_10044292 | 3300028381 | Bacteria | 3691 |
| 384 | Ga0268264_10208767 | 3300028381 | Bacteria | 1791 |
| 385 | Ga0265338_10171768 | 3300028800 | Bacteria | 1661 |
| 386 | Ga0265325_10164142 | 3300031241 | Bacteria | 1043 |
| 387 | Ga0307408_100116398 | 3300031548 | Bacteria | 2063 |
| 388 | Ga0307408_101608118 | 3300031548 | Bacteria | 617 |
| 389 | Ga0307405_10246764 | 3300031731 | Unclassified | 1326 |
| 390 | Ga0307407_11409392 | 3300031903 | Unclassified | 549 |
| 391 | Ga0307409_100084866 | 3300031995 | Bacteria | 2573 |
| 392 | Ga0307409_100835618 | 3300031995 | Bacteria | 931 |
| 393 | Ga0307416_101312703 | 3300032002 | Unclassified | 829 |
| 394 | Ga0307411_11875220 | 3300032005 | Bacteria | 558 |
| 395 | Ga0307415_100339476 | 3300032126 | Unclassified | 1260 |
| 396 | Ga0373948_0014113 | 3300034817 | Bacteria | 1452 |
| 397 | Ga0373950_0020394 | 3300034818 | Bacteria | 1165 |
| 398 | Ga0373959_0048694 | 3300034820 | Bacteria | 909 |
| 399 | Ga0373926_0134457 | 3300035083 | Bacteria | 937 |
| 400 | Ga0373934_0019289 | 3300035086 | Bacteria | 2616 |
| 401 | Ga0373940_0087244 | 3300035088 | Bacteria | 930 |
| 402 | Ga0373944_0136476 | 3300035089 | Bacteria | 856 |
| 403 | Ga0373949_0013308 | 3300035090 | Bacteria | 1822 |
| 404 | Ga0373949_0021882 | 3300035090 | Bacteria | 1471 |
| 405 | Ga0373949_0208433 | 3300035090 | Unclassified | 590 |
| 406 | Ga0373951_0016513 | 3300035091 | Bacteria | 1665 |
| 407 | Ga0373923_0055220 | 3300035111 | Bacteria | 1674 |
| 408 | Ga0373932_0192584 | 3300035112 | Bacteria | 721 |
| 409 | Ga0373939_0278437 | 3300035114 | Bacteria | 660 |
| 410 | Ga0373941_0041797 | 3300035115 | Bacteria | 1420 |
| 411 | Ga0373945_0467767 | 3300035116 | Unclassified | 559 |
| 412 | Ga0373953_0037622 | 3300035117 | Bacteria | 1910 |
| 413 | Ga0373953_0172433 | 3300035117 | Bacteria | 931 |
| 414 | Ga0373954_0010052 | 3300035118 | Bacteria | 4169 |
| 415 | Ga0373956_0014193 | 3300035119 | Bacteria | 3325 |
| 416 | Ga0373956_0102654 | 3300035119 | Bacteria | 1327 |
| 417 | Ga0373957_0061520 | 3300035120 | Bacteria | 1455 |
| 418 | Ga0373960_0010360 | 3300035121 | Bacteria | 2275 |
| 419 | Ga0373960_0133007 | 3300035121 | Bacteria | 836 |
| 420 | Ga0373943_0115512 | 3300035170 | Bacteria | 1421 |
| 421 | Ga0373943_0187559 | 3300035170 | Bacteria | 1139 |
| 422 | Ga0373943_0600073 | 3300035170 | Bacteria | 648 |
| 423 | Ga0373946_0077216 | 3300035171 | Bacteria | 1451 |
| 424 | Ga0373955_0052869 | 3300035172 | Bacteria | 2216 |
| 425 | Ga0373955_0060198 | 3300035172 | Bacteria | 2094 |
| 426 | Ga0373961_0004323 | 3300035241 | Bacteria | 3437 |
| 427 | Ga0373924_0022868 | 3300035410 | Bacteria | 2447 |
| 428 | Ga0373924_0197233 | 3300035410 | Bacteria | 887 |
| 429 | Ga0373931_0148720 | 3300035691 | Bacteria | 1363 |
| 430 | Ga0373931_1291553 | 3300035691 | Unclassified | 502 |
| 431 | Ga0373935_0062157 | 3300035692 | Bacteria | 2392 |
| 432 | Ga0373935_0103602 | 3300035692 | Bacteria | 1879 |
| 433 | Ga0373935_0257375 | 3300035692 | Bacteria | 1223 |
| 434 | Ga0373927_0022718 | 3300035695 | Bacteria | 4108 |
| 435 | Ga0373927_0200131 | 3300035695 | Bacteria | 1311 |
| 436 | Ga0373933_0011306 | 3300035724 | Bacteria | 4914 |
| 437 | Ga0373933_0121110 | 3300035724 | Bacteria | 1639 |
| 438 | Ga0373933_0229372 | 3300035724 | Bacteria | 1192 |
| 439 | Ga0373947_0090849 | 3300035725 | Bacteria | 1904 |
| 440 | Ga0373947_0143107 | 3300035725 | Bacteria | 1535 |
| 441 | Ga0373937_0027514 | 3300036401 | Bacteria | 5141 |
| 442 | Ga0373937_0073288 | 3300036401 | Bacteria | 3159 |
| 443 | Ga0373937_0318822 | 3300036401 | Bacteria | 1470 |
| 444 | Ga0373937_0562456 | 3300036401 | Unclassified | 1083 |
| 445 | Ga0373937_1687036 | 3300036401 | Bacteria | 580 |
| 446 | Ga0373925_0031059 | 3300037068 | Bacteria | 3923 |
| 447 | Ga0373925_0118322 | 3300037068 | Unclassified | 2054 |
| 448 | Ga0373925_0519559 | 3300037068 | Bacteria | 978 |
| 449 | Ga0373925_0568607 | 3300037068 | Unclassified | 933 |
| 450 | Ga0395900_0618552 | 3300037418 | Unclassified | 1022 |
| 451 | Ga0436364_0145813 | 3300037853 | Bacteria | 1822 |
| 452 | Ga0436364_0467252 | 3300037853 | Bacteria | 599 |
| 453 | Ga0436364_0601131 | 3300037853 | Bacteria | 3980 |
| 454 | Ga0436364_0663275 | 3300037853 | Bacteria | 97909 |
| 455 | Ga0436364_1513617 | 3300037853 | Bacteria | 5157 |
| 456 | Ga0242420_042086 | 3300038996 | Bacteria | 875 |
| 457 | Ga0242420_126924 | 3300038996 | Bacteria | 560 |
| 458 | Ga0436365_0178215 | 3300039437 | Bacteria | 1654 |
| 459 | Ga0436365_0335175 | 3300039437 | Bacteria | 1264 |
| 460 | Ga0436365_0457769 | 3300039437 | Unclassified | 1599 |
| 461 | Ga0436365_0492069 | 3300039437 | Unclassified | 573 |
| 462 | Ga0436365_1405111 | 3300039437 | Unclassified | 560 |
| 463 | Ga0436365_1597299 | 3300039437 | Bacteria | 8020 |
| 464 | Ga0436360_0479485 | 3300039438 | Bacteria | 2591 |
| 465 | Ga0436360_0600212 | 3300039438 | Bacteria | 1462 |
| 466 | Ga0436360_1227350 | 3300039438 | Unclassified | 1205 |
| 467 | Ga0436360_1270871 | 3300039438 | Bacteria | 635 |
| 468 | Ga0436363_0635281 | 3300039450 | Viruses | 871 |
| 469 | Ga0436363_1048964 | 3300039450 | Unclassified | 586 |
| 470 | Ga0436363_1698508 | 3300039450 | Bacteria | 2747 |
| 471 | Ga0436363_1700699 | 3300039450 | Bacteria | 3636 |
| 472 | Ga0436362_0431659 | 3300039453 | Bacteria | 595 |
| 473 | Ga0436362_0494949 | 3300039453 | Bacteria | 1225 |
| 474 | Ga0436362_0816092 | 3300039453 | Unclassified | 713 |
| 475 | Ga0439441_001047 | 3300042001 | Bacteria | 3432 |
| 476 | Ga0439448_0006020 | 3300042005 | Bacteria | 3474 |
| 477 | Ga0439450_002450 | 3300042008 | Bacteria | 2919 |
| 478 | Ga0439455_0009296 | 3300042012 | Bacteria | 2128 |
| 479 | Ga0439455_0017669 | 3300042012 | Bacteria | 1665 |
| 480 | Ga0450919_017820 | 3300042121 | Bacteria | 801 |
| 481 | Ga0439458_0002678 | 3300042157 | Bacteria | 4298 |
| 482 | Ga0439444_0017514 | 3300042437 | Unclassified | 1231 |
| 483 | Ga0439459_0005063 | 3300042438 | Bacteria | 2149 |
| 484 | Ga0439460_0001824 | 3300042461 | Bacteria | 5071 |
| 485 | Ga0451577_0216339 | 3300042876 | Bacteria | 1731 |
| 486 | Ga0453683_0361759 | 3300044673 | Bacteria | 933 |
| 487 | Ga0466963_0431330 | 3300044694 | Bacteria | 930 |
| 488 | Ga0453684_0063129 | 3300044712 | Bacteria | 4741 |
| 489 | Ga0453684_1803588 | 3300044712 | Bacteria | 622 |
| 490 | Ga0451576_0025306 | 3300045051 | Bacteria | 6395 |
| 491 | Ga0451576_0025584 | 3300045051 | Bacteria | 6358 |
| 492 | Ga0451576_0236850 | 3300045051 | Bacteria | 1906 |
| 493 | Ga0451576_0321554 | 3300045051 | Bacteria | 1619 |
| 494 | Ga0451576_0534632 | 3300045051 | Bacteria | 1231 |
| 495 | Ga0451576_0711271 | 3300045051 | Bacteria | 1055 |
| 496 | Ga0466967_2163747 | 3300045976 | Bacteria | 552 |
| 497 | Ga0495629_0505448 | 3300046459 | Unclassified | 815 |
| 498 | Ga0495651_0050591 | 3300046462 | Bacteria | 3205 |
| 499 | Ga0495653_0067991 | 3300046463 | Bacteria | 2673 |
| 500 | Ga0495580_0281094 | 3300046472 | Bacteria | 1135 |
| 501 | Ga0495580_0403610 | 3300046472 | Bacteria | 921 |
| 502 | Ga0495639_0147734 | 3300046475 | Unclassified | 1133 |
| 503 | Ga0495639_0435446 | 3300046475 | Bacteria | 665 |
| 504 | Ga0495662_0207285 | 3300046476 | Bacteria | 966 |
| 505 | Ga0495662_0298268 | 3300046476 | Bacteria | 793 |
| 506 | Ga0495664_0001798 | 3300046477 | Bacteria | 11392 |
| 507 | Ga0495608_0054522 | 3300046511 | Bacteria | 2643 |
| 508 | Ga0495608_0058203 | 3300046511 | Bacteria | 2548 |
| 509 | Ga0495618_0053319 | 3300046514 | Bacteria | 2557 |
| 510 | Ga0495628_0243667 | 3300046516 | Bacteria | 1344 |
| 511 | Ga0495628_0983303 | 3300046516 | Unclassified | 581 |
| 512 | Ga0495652_0054502 | 3300046529 | Bacteria | 3405 |
| 513 | Ga0495640_0093828 | 3300046533 | Bacteria | 1977 |
| 514 | Ga0495640_0152002 | 3300046533 | Bacteria | 1487 |
| 515 | Ga0495586_0235196 | 3300046535 | Bacteria | 1043 |
| 516 | Ga0495587_0013695 | 3300046536 | Bacteria | 5094 |
| 517 | Ga0495587_0447200 | 3300046536 | Unclassified | 716 |
| 518 | Ga0495645_0005511 | 3300046543 | Bacteria | 8697 |
| 519 | Ga0495645_0807545 | 3300046543 | Unclassified | 562 |
| 520 | Ga0495667_0023531 | 3300046559 | Bacteria | 4150 |
| 521 | Ga0495667_0025467 | 3300046559 | Bacteria | 3986 |
| 522 | Ga0495667_0103828 | 3300046559 | Bacteria | 1838 |
| 523 | Ga0495667_0378704 | 3300046559 | Bacteria | 892 |
| 524 | Ga0495667_0598937 | 3300046559 | Bacteria | 687 |
| 525 | Ga0495634_0104892 | 3300046642 | Bacteria | 1823 |
| 526 | Ga0495635_0094823 | 3300046663 | Bacteria | 2040 |
| 527 | Ga0495657_0095018 | 3300046675 | Bacteria | 1906 |
| 528 | Ga0495657_0509202 | 3300046675 | Unclassified | 701 |
| 529 | Ga0495657_0654502 | 3300046675 | Unclassified | 606 |
| 530 | Ga0495599_0074004 | 3300046678 | Bacteria | 2127 |
| 531 | Ga0495599_0343613 | 3300046678 | Bacteria | 895 |
| 532 | Ga0495599_0860520 | 3300046678 | Unclassified | 515 |
| 533 | Ga0495623_0068077 | 3300046679 | Bacteria | 2221 |
| 534 | Ga0495646_0070261 | 3300046680 | Bacteria | 2063 |
| 535 | Ga0495600_0153293 | 3300046809 | Bacteria | 1491 |
| 536 | Ga0495600_0263425 | 3300046809 | Bacteria | 1094 |
| 537 | Ga0495600_0515021 | 3300046809 | Unclassified | 734 |
| 538 | Ga0495604_0017462 | 3300047317 | Bacteria | 5744 |
| 539 | Ga0495674_0017151 | 3300047319 | Bacteria | 6745 |
| 540 | Ga0495676_0129642 | 3300047321 | Bacteria | 1823 |
| 541 | Ga0495680_0077017 | 3300047322 | Bacteria | 2527 |
| 542 | Ga0495680_0406427 | 3300047322 | Unclassified | 939 |
| 543 | Ga0495684_0261036 | 3300047471 | Bacteria | 1256 |
| 544 | Ga0495684_0573328 | 3300047471 | Unclassified | 765 |
| 545 | Ga0495593_0350555 | 3300047673 | Bacteria | 738 |
| 546 | Ga0495602_0002925 | 3300048088 | Bacteria | 17516 |
| 547 | Ga0495614_0502244 | 3300048089 | Bacteria | 577 |
| 548 | Ga0496102_0129875 | 3300048905 | Bacteria | 2357 |
| 549 | Ga0496103_0464535 | 3300048906 | Bacteria | 811 |
| 550 | Ga0496104_0073944 | 3300048907 | Bacteria | 3243 |
| 551 | Ga0496106_0350117 | 3300048909 | Bacteria | 1186 |
| 552 | Ga0496106_0385628 | 3300048909 | Unclassified | 1126 |
| 553 | Ga0496106_0892863 | 3300048909 | Bacteria | 702 |
| 554 | Ga0496108_0766259 | 3300048911 | Bacteria | 834 |
| 555 | Ga0496108_0853671 | 3300048911 | Unclassified | 783 |
| 556 | Ga0496109_0477331 | 3300048912 | Bacteria | 1177 |
| 557 | Ga0496110_0071394 | 3300048913 | Unclassified | 3079 |
| 558 | Ga0496110_0300852 | 3300048913 | Bacteria | 1461 |
| 559 | Ga0496112_0084393 | 3300048915 | Unclassified | 3141 |
| 560 | Ga0496112_0150159 | 3300048915 | Bacteria | 2297 |
| 561 | Ga0496112_0216999 | 3300048915 | Bacteria | 1869 |
| 562 | Ga0496113_0250219 | 3300048916 | Bacteria | 1415 |
| 563 | Ga0501032_0895354 | 3300049569 | Bacteria | 559 |
| 564 | Ga0501032_0996681 | 3300049569 | Bacteria | 526 |
| 565 | Ga0501033_0019194 | 3300049570 | Bacteria | 5170 |
| 566 | Ga0501033_0661771 | 3300049570 | Unclassified | 713 |
| 567 | Ga0501033_1197740 | 3300049570 | Bacteria | 503 |
| 568 | Ga0501036_0173305 | 3300049572 | Bacteria | 1817 |
| 569 | Ga0501036_0525965 | 3300049572 | Bacteria | 983 |
| 570 | Ga0501036_0535292 | 3300049572 | Bacteria | 974 |
| 571 | Ga0501036_1029953 | 3300049572 | Bacteria | 673 |
| 572 | Ga0501037_0103642 | 3300049573 | Bacteria | 2052 |
| 573 | Ga0501037_0839331 | 3300049573 | Bacteria | 605 |
| 574 | Ga0501038_0030863 | 3300049574 | Bacteria | 4738 |
| 575 | Ga0501038_0370356 | 3300049574 | Bacteria | 1113 |
| 576 | Ga0501038_0483933 | 3300049574 | Bacteria | 948 |
| 577 | Ga0501039_0047726 | 3300049575 | Bacteria | 3310 |
| 578 | Ga0501039_0230428 | 3300049575 | Bacteria | 1456 |
| 579 | Ga0501039_1439174 | 3300049575 | Unclassified | 530 |
| 580 | Ga0501040_0105502 | 3300049576 | Bacteria | 1968 |
| 581 | Ga0501040_0122381 | 3300049576 | Bacteria | 1826 |
| 582 | Ga0501040_0248720 | 3300049576 | Bacteria | 1268 |
| 583 | Ga0501040_0262117 | 3300049576 | Bacteria | 1233 |
| 584 | Ga0501040_0552343 | 3300049576 | Bacteria | 831 |
| 585 | Ga0501041_0021804 | 3300049577 | Bacteria | 3837 |
| 586 | Ga0501041_0139625 | 3300049577 | Bacteria | 1511 |
| 587 | Ga0501041_0187344 | 3300049577 | Bacteria | 1296 |
| 588 | Ga0501042_0064250 | 3300049578 | Bacteria | 2623 |
| 589 | Ga0501042_0156472 | 3300049578 | Bacteria | 1644 |
| 590 | Ga0501042_0265789 | 3300049578 | Bacteria | 1238 |
| 591 | Ga0501042_0480964 | 3300049578 | Bacteria | 901 |
| 592 | Ga0501042_0637020 | 3300049578 | Bacteria | 775 |
| 593 | Ga0501043_0055508 | 3300049579 | Bacteria | 3112 |
| 594 | Ga0501046_0005426 | 3300049580 | Bacteria | 11394 |
| 595 | Ga0501046_0204765 | 3300049580 | Bacteria | 1467 |
| 596 | Ga0501046_0388570 | 3300049580 | Unclassified | 1009 |
| 597 | Ga0501047_0135200 | 3300049581 | Bacteria | 2346 |
| 598 | Ga0501048_0014717 | 3300049582 | Bacteria | 5788 |
| 599 | Ga0501048_0215247 | 3300049582 | Bacteria | 1362 |
| 600 | Ga0501048_0253837 | 3300049582 | Bacteria | 1249 |
| 601 | Ga0501067_0006899 | 3300049583 | Bacteria | 6302 |
| 602 | Ga0501067_0237298 | 3300049583 | Bacteria | 1015 |
| 603 | Ga0501068_0045662 | 3300049584 | Bacteria | 2639 |
| 604 | Ga0501068_0061080 | 3300049584 | Bacteria | 2289 |
| 605 | Ga0501068_0111897 | 3300049584 | Bacteria | 1698 |
| 606 | Ga0501068_0160756 | 3300049584 | Bacteria | 1416 |
| 607 | Ga0501068_0278108 | 3300049584 | Bacteria | 1069 |
| 608 | Ga0501069_0053225 | 3300049585 | Bacteria | 2254 |
| 609 | Ga0501069_0126842 | 3300049585 | Bacteria | 1460 |
| 610 | Ga0501070_0151118 | 3300049586 | Bacteria | 1916 |
| 611 | Ga0501071_0047689 | 3300049587 | Bacteria | 3078 |
| 612 | Ga0501071_0080772 | 3300049587 | Bacteria | 2378 |
| 613 | Ga0501071_0387473 | 3300049587 | Unclassified | 1066 |
| 614 | Ga0501071_0699449 | 3300049587 | Bacteria | 780 |
| 615 | Ga0501072_0034516 | 3300049588 | Bacteria | 3965 |
| 616 | Ga0501072_0043356 | 3300049588 | Bacteria | 3536 |
| 617 | Ga0501072_0074126 | 3300049588 | Bacteria | 2691 |
| 618 | Ga0501072_0111005 | 3300049588 | Bacteria | 2183 |
| 619 | Ga0501072_0510352 | 3300049588 | Bacteria | 951 |
| 620 | Ga0501072_0875437 | 3300049588 | Unclassified | 702 |
| 621 | Ga0501074_0004922 | 3300049590 | Bacteria | 9573 |
| 622 | Ga0501074_0131171 | 3300049590 | Bacteria | 1793 |
| 623 | Ga0501074_0283567 | 3300049590 | Bacteria | 1177 |
| 624 | Ga0501074_0447982 | 3300049590 | Bacteria | 915 |
| 625 | Ga0501075_0030857 | 3300049591 | Bacteria | 3974 |
| 626 | Ga0501075_0034666 | 3300049591 | Bacteria | 3759 |
| 627 | Ga0501075_0041891 | 3300049591 | Bacteria | 3432 |
| 628 | Ga0501075_0069260 | 3300049591 | Bacteria | 2666 |
| 629 | Ga0501075_0755666 | 3300049591 | Bacteria | 740 |
| 630 | Ga0501075_0781828 | 3300049591 | Bacteria | 726 |
| 631 | Ga0501075_1491901 | 3300049591 | Bacteria | 512 |
| 632 | Ga0501076_0016701 | 3300049592 | Bacteria | 5568 |
| 633 | Ga0501076_0050314 | 3300049592 | Bacteria | 3296 |
| 634 | Ga0501076_0215729 | 3300049592 | Bacteria | 1569 |
| 635 | Ga0501076_0313878 | 3300049592 | Unclassified | 1286 |
| 636 | Ga0501076_0419992 | 3300049592 | Bacteria | 1100 |
| 637 | Ga0501076_1510757 | 3300049592 | Bacteria | 551 |
| 638 | Ga0501077_0023284 | 3300049593 | Bacteria | 3927 |
| 639 | Ga0501077_0033438 | 3300049593 | Bacteria | 3273 |
| 640 | Ga0501077_0046695 | 3300049593 | Bacteria | 2751 |
| 641 | Ga0501077_0070177 | 3300049593 | Bacteria | 2220 |
| 642 | Ga0501233_259089 | 3300049668 | Unclassified | 525 |
| 643 | Ga0501079_0000544 | 3300049741 | Bacteria | 24557 |
| 644 | Ga0501079_0001291 | 3300049741 | Bacteria | 17624 |
| 645 | Ga0501079_0004073 | 3300049741 | Bacteria | 10828 |
| 646 | Ga0501079_0045890 | 3300049741 | Bacteria | 3372 |
| 647 | Ga0501079_0283122 | 3300049741 | Unclassified | 1296 |
| 648 | Ga0501079_0403067 | 3300049741 | Bacteria | 1073 |
| 649 | Ga0501079_0451588 | 3300049741 | Bacteria | 1009 |
| 650 | Ga0501079_1287006 | 3300049741 | Bacteria | 576 |
| 651 | Ga0501080_0028167 | 3300049742 | Bacteria | 5224 |
| 652 | Ga0501080_0184001 | 3300049742 | Bacteria | 1922 |
| 653 | Ga0501080_0267406 | 3300049742 | Bacteria | 1557 |
| 654 | Ga0501080_0281982 | 3300049742 | Bacteria | 1510 |
| 655 | Ga0501080_0459130 | 3300049742 | Bacteria | 1141 |
| 656 | Ga0501081_0002363 | 3300049743 | Bacteria | 11889 |
| 657 | Ga0501081_0062332 | 3300049743 | Bacteria | 2586 |
| 658 | Ga0501081_0079440 | 3300049743 | Bacteria | 2294 |
| 659 | Ga0501081_0132135 | 3300049743 | Unclassified | 1784 |
| 660 | Ga0501081_0162607 | 3300049743 | Bacteria | 1609 |
| 661 | Ga0501081_0866592 | 3300049743 | Bacteria | 680 |
| 662 | Ga0501083_0016041 | 3300049744 | Bacteria | 5246 |
| 663 | Ga0501083_0320137 | 3300049744 | Bacteria | 1009 |
| 664 | Ga0501035_0254502 | 3300049822 | Bacteria | 1490 |
| 665 | Ga0501035_0325284 | 3300049822 | Bacteria | 1291 |
| 666 | Ga0501045_0006466 | 3300049824 | Bacteria | 8117 |
| 667 | Ga0501045_0137241 | 3300049824 | Bacteria | 1818 |
| 668 | Ga0501045_0146310 | 3300049824 | Bacteria | 1758 |
| 669 | Ga0501045_0162269 | 3300049824 | Bacteria | 1664 |
| 670 | nmdc:mga05p37_142449_c1 | 3300050507 | Bacteria | 2936 |
| 671 | nmdc:mga05p37_171211_c1 | 3300050507 | Bacteria | 2648 |
| 672 | nmdc:mga05p37_27612_c1 | 3300050507 | Bacteria | 6912 |
| 673 | nmdc:mga09592_10160_c1 | 3300050508 | Bacteria | 7661 |
| 674 | nmdc:mga09592_1270679_c1 | 3300050508 | Bacteria | 606 |
| 675 | nmdc:mga09592_484326_c1 | 3300050508 | Bacteria | 1066 |
| 676 | nmdc:mga0qj67_132375_c1 | 3300050509 | Bacteria | 2020 |
| 677 | nmdc:mga0qj67_6307_c1 | 3300050509 | Bacteria | 8704 |
| 678 | nmdc:mga06r32_319_c1 | 3300050510 | Bacteria | 40297 |
| 679 | nmdc:mga06r32_338871_c1 | 3300050510 | Bacteria | 1488 |
| 680 | nmdc:mga06r32_50894_c1 | 3300050510 | Bacteria | 3963 |
| 681 | nmdc:mga06r32_8924_c1 | 3300050510 | Bacteria | 9036 |
| 682 | nmdc:mga0n895_165417_c1 | 3300050512 | Bacteria | 2244 |
| 683 | nmdc:mga0n895_169910_c1 | 3300050512 | Bacteria | 2212 |
| 684 | nmdc:mga0n895_2180843_c1 | 3300050512 | Bacteria | 509 |
| 685 | nmdc:mga0n895_2201612_c1 | 3300050512 | Bacteria | 507 |
| 686 | nmdc:mga0n895_283669_c1 | 3300050512 | Unclassified | 1679 |
| 687 | nmdc:mga0n895_287774_c1 | 3300050512 | Bacteria | 1666 |
| 688 | nmdc:mga0n895_306800_c1 | 3300050512 | Bacteria | 1609 |
| 689 | nmdc:mga0n895_47458_c1 | 3300050512 | Unclassified | 4199 |
| 690 | nmdc:mga0rr50_313289_c1 | 3300050513 | Bacteria | 1315 |
| 691 | nmdc:mga0rr50_5599_c1 | 3300050513 | Bacteria | 7516 |
| 692 | nmdc:mga08x19_69450_c1 | 3300050514 | Bacteria | 2295 |
| 693 | nmdc:mga0a205_411_c1 | 3300050515 | Bacteria | 32848 |
| 694 | nmdc:mga0a205_52258_c1 | 3300050515 | Bacteria | 3944 |
| 695 | nmdc:mga0a205_839442_c1 | 3300050515 | Bacteria | 766 |
| 696 | Ga0495601_0004384 | 3300053077 | Bacteria | 8152 |
| 697 | Ga0495601_0022902 | 3300053077 | Bacteria | 3838 |
| 698 | Ga0495601_0117775 | 3300053077 | Unclassified | 1723 |
| 699 | Ga0495601_0709592 | 3300053077 | Unclassified | 641 |
| 700 | Ga0495612_0001013 | 3300053078 | Bacteria | 11549 |
| 701 | Ga0495595_0106915 | 3300053084 | Unclassified | 1354 |
| 702 | Ga0495595_0329371 | 3300053084 | Unclassified | 769 |
| 703 | Ga0495595_0392098 | 3300053084 | Unclassified | 703 |
| 704 | Ga0495619_0260640 | 3300053085 | Bacteria | 1201 |
| 705 | Ga0495619_0530450 | 3300053085 | Unclassified | 808 |
| 706 | Ga0501084_0000637 | 3300054114 | Bacteria | 26671 |
| 707 | Ga0501084_0037585 | 3300054114 | Bacteria | 4046 |
| 708 | Ga0501084_0213163 | 3300054114 | Bacteria | 1629 |
| 709 | Ga0501084_0313452 | 3300054114 | Bacteria | 1325 |
| 710 | Ga0501084_0461014 | 3300054114 | Bacteria | 1074 |
| 711 | Ga0501084_0804571 | 3300054114 | Bacteria | 791 |
| 712 | Ga0501084_1045823 | 3300054114 | Bacteria | 686 |
| 713 | Ga0590071_012115 | 3300059421 | Bacteria | 2022 |
| 714 | Ga0501082_0001274 | 3300060353 | Bacteria | 22120 |
| 715 | Ga0501082_0001594 | 3300060353 | Bacteria | 20004 |
| 716 | Ga0501082_0081198 | 3300060353 | Bacteria | 2798 |
| 717 | Ga0501082_0189389 | 3300060353 | Bacteria | 1790 |
| 718 | Ga0501082_0602393 | 3300060353 | Bacteria | 961 |
| 719 | Ga0530510_0002661 | 3300061734 | Bacteria | 12276 |
| 720 | Ga0530510_0019222 | 3300061734 | Bacteria | 4848 |
| 721 | Ga0530510_0064087 | 3300061734 | Bacteria | 2662 |
| 722 | Ga0530510_0093569 | 3300061734 | Bacteria | 2195 |
| 723 | Ga0436364_1363774 | |||
| 724 | Ga0065712_10165001 | |||
| 725 | Ga0065715_10121377 | |||
| 726 | Ga0070676_10010612 | |||
| 727 | Ga0070683_100074566 | |||
| 728 | Ga0070683_100451157 | |||
| 729 | Ga0070670_100002086 | |||
| 730 | Ga0070670_101412345 | |||
| 731 | Ga0068869_100000242 | |||
| 732 | Ga0068869_101008795 | |||
| 733 | Ga0070666_11442555 | |||
| 734 | Ga0070680_100000172 | |||
| 735 | Ga0070680_100020227 | |||
| 736 | Ga0070680_100460322 | |||
| 737 | Ga0070682_100002377 | |||
| 738 | Ga0070682_100372639 | |||
| 739 | Ga0068868_100027785 | |||
| 740 | Ga0068868_101615970 | |||
| 741 | Ga0070660_100001451 | |||
| 742 | Ga0070660_100952401 | |||
| 743 | Ga0070689_100006819 | |||
| 744 | Ga0070689_100650488 | |||
| 745 | Ga0070689_100986720 | |||
| 746 | Ga0070691_10019730 | |||
| 747 | Ga0070691_10026968 | |||
| 748 | Ga0070687_100248847 | |||
| 749 | Ga0070661_100053534 | |||
| 750 | Ga0070692_10000564 | |||
| 751 | Ga0070692_10002520 | |||
| 752 | Ga0070692_11152994 | |||
| 753 | Ga0070669_100095739 | |||
| 754 | Ga0070669_100371017 | |||
| 755 | Ga0070669_100941234 | |||
| 756 | Ga0070675_100377625 | |||
| 757 | Ga0070675_100924510 | |||
| 758 | Ga0070671_101827642 | |||
| 759 | Ga0070674_100890222 | |||
| 760 | Ga0070674_102206940 | |||
| 761 | Ga0070673_100290274 | |||
| 762 | Ga0070659_100000892 | |||
| 763 | Ga0070667_100260981 | |||
| 764 | Ga0070703_10006211 | |||
| 765 | Ga0070703_10030706 | |||
| 766 | Ga0070709_10012934 | |||
| 767 | Ga0070714_100082353 | |||
| 768 | Ga0070714_100394738 | |||
| 769 | Ga0070714_100408590 | |||
| 770 | Ga0070714_102339713 | |||
| 771 | Ga0070713_100046474 | |||
| 772 | Ga0070713_100132640 | |||
| 773 | Ga0070713_100984579 | |||
| 774 | Ga0070710_10380108 | |||
| 775 | Ga0070710_10404435 | |||
| 776 | Ga0070701_10182760 | |||
| 777 | Ga0070711_100012412 | |||
| 778 | Ga0070711_100199951 | |||
| 779 | Ga0070711_100256689 | |||
| 780 | Ga0070711_100262366 | |||
| 781 | Ga0070705_100007493 | |||
| 782 | Ga0070705_100024866 | |||
| 783 | Ga0070705_100232339 | |||
| 784 | Ga0070705_101783665 | |||
| 785 | Ga0070705_101957626 | |||
| 786 | Ga0070700_100060196 | |||
| 787 | Ga0070700_100860393 | |||
| 788 | Ga0070694_100001215 | |||
| 789 | Ga0070694_100001268 | |||
| 790 | Ga0070694_100044269 | |||
| 791 | Ga0070708_100077381 | |||
| 792 | Ga0070708_100288589 | |||
| 793 | Ga0070708_100735834 | |||
| 794 | Ga0070663_100002216 | |||
| 795 | Ga0070662_100015351 | |||
| 796 | Ga0070662_100047177 | |||
| 797 | Ga0070681_10018294 | |||
| 798 | Ga0070681_11998038 | |||
| 799 | Ga0068867_100201411 | |||
| 800 | Ga0070706_100322770 | |||
| 801 | Ga0070706_100584995 | |||
| 802 | Ga0070706_100854186 | |||
| 803 | Ga0070706_101537200 | |||
| 804 | Ga0070707_100015584 | |||
| 805 | Ga0070707_100046043 | |||
| 806 | Ga0070707_100385237 | |||
| 807 | Ga0070707_100614933 | |||
| 808 | Ga0070707_102321884 | |||
| 809 | Ga0070707_102322687 | |||
| 810 | Ga0070698_100136302 | |||
| 811 | Ga0070699_100015393 | |||
| 812 | Ga0070699_100020082 | |||
| 813 | Ga0070699_100240267 | |||
| 814 | Ga0070699_101103972 | |||
| 815 | Ga0070679_100000185 | |||
| 816 | Ga0070679_101877912 | |||
| 817 | Ga0070684_100033556 | |||
| 818 | Ga0070684_101655607 | |||
| 819 | Ga0070684_101911968 | |||
| 820 | Ga0070697_100289796 | |||
| 821 | Ga0070697_100496497 | |||
| 822 | Ga0070697_101356718 | |||
| 823 | Ga0068853_100012041 | |||
| 824 | Ga0070686_100638789 | |||
| 825 | Ga0070686_100701451 | |||
| 826 | Ga0070686_100811232 | |||
| 827 | Ga0070695_100000865 | |||
| 828 | Ga0070695_100003727 | |||
| 829 | Ga0070695_100006846 | |||
| 830 | Ga0070695_100221091 | |||
| 831 | Ga0070696_100002658 | |||
| 832 | Ga0070696_100085466 | |||
| 833 | Ga0070696_101562655 | |||
| 834 | Ga0070696_101593517 | |||
| 835 | Ga0070693_100000248 | |||
| 836 | Ga0070665_100372663 | |||
| 837 | Ga0070704_100002912 | |||
| 838 | Ga0070704_100523445 | |||
| 839 | Ga0068855_100000437 | |||
| 840 | Ga0068855_100394445 | |||
| 841 | Ga0068855_100913732 | |||
| 842 | Ga0070664_100004721 | |||
| 843 | Ga0068857_100003434 | |||
| 844 | Ga0068857_100124460 | |||
| 845 | Ga0068854_100002679 | |||
| 846 | Ga0068856_100000464 | |||
| 847 | Ga0068856_100082353 | |||
| 848 | Ga0068856_100104805 | |||
| 849 | Ga0068856_100964824 | |||
| 850 | Ga0068856_102423761 | |||
| 851 | Ga0070702_100033954 | |||
| 852 | Ga0068859_100007895 | |||
| 853 | Ga0068859_100405292 | |||
| 854 | Ga0068859_101306301 | |||
| 855 | Ga0068859_101846068 | |||
| 856 | Ga0068864_100001333 | |||
| 857 | Ga0068864_100462589 | |||
| 858 | Ga0068864_102210246 | |||
| 859 | Ga0068866_10223299 | |||
| 860 | Ga0068861_100010099 | |||
| 861 | Ga0068870_10000256 | |||
| 862 | Ga0068863_100115930 | |||
| 863 | Ga0068863_100515027 | |||
| 864 | Ga0068863_100754375 | |||
| 865 | Ga0068863_101151176 | |||
| 866 | Ga0068858_100475464 | |||
| 867 | Ga0068858_101568684 | |||
| 868 | Ga0068860_100030858 | |||
| 869 | Ga0068860_100085941 | |||
| 870 | Ga0068860_100352507 | |||
| 871 | Ga0068860_102096751 | |||
| 872 | Ga0068862_100022105 | |||
| 873 | Ga0068862_102187294 | |||
| 874 | Ga0081455_10001327 | |||
| 875 | Ga0081455_10649439 | |||
| 876 | Ga0081540_1001963 | |||
| 877 | Ga0070717_10027539 | |||
| 878 | Ga0070717_10658095 | |||
| 879 | Ga0070717_10855105 | |||
| 880 | Ga0070717_11128176 | |||
| 881 | Ga0070717_11485703 | |||
| 882 | Ga0070715_10280524 | |||
| 883 | Ga0070716_100076357 | |||
| 884 | Ga0070712_100022869 | |||
| 885 | Ga0070712_100038484 | |||
| 886 | Ga0070712_100157695 | |||
| 887 | Ga0070712_100226483 | |||
| 888 | Ga0070712_100859207 | |||
| 889 | Ga0097621_100288142 | |||
| 890 | Ga0068871_100262331 | |||
| 891 | Ga0075430_100013495 | |||
| 892 | Ga0075431_100000061 | |||
| 893 | Ga0075431_100001236 | |||
| 894 | Ga0075431_100227414 | |||
| 895 | Ga0075431_100286936 | |||
| 896 | Ga0075431_100455275 | |||
| 897 | Ga0075433_10011484 | |||
| 898 | Ga0075433_10609273 | |||
| 899 | Ga0075434_100004221 | |||
| 900 | Ga0075434_100185645 | |||
| 901 | Ga0075434_100223361 | |||
| 902 | Ga0075434_101158252 | |||
| 903 | Ga0075434_101920196 | |||
| 904 | Ga0075434_102655400 | |||
| 905 | Ga0075429_100009797 | |||
| 906 | Ga0075429_100050002 | |||
| 907 | Ga0075429_100540784 | |||
| 908 | Ga0068865_100208530 | |||
| 909 | Ga0075436_100024178 | |||
| 910 | Ga0075436_101366720 | |||
| 911 | Ga0075436_101366722 | |||
| 912 | Ga0097620_100007895 | |||
| 913 | Ga0097620_100405298 | |||
| 914 | Ga0097620_101306328 | |||
| 915 | Ga0097620_101846056 | |||
| 916 | Ga0075435_100004648 | |||
| 917 | Ga0075435_100023162 | |||
| 918 | Ga0075435_100890161 | |||
| 919 | Ga0099794_10003599 | |||
| 920 | Ga0099795_10005888 | |||
| 921 | Ga0105240_11175561 | |||
| 922 | Ga0105240_12488396 | |||
| 923 | Ga0105245_10102511 | |||
| 924 | Ga0105247_11425531 | |||
| 925 | Ga0114129_10028046 | |||
| 926 | Ga0114129_10154263 | |||
| 927 | Ga0114129_10161134 | |||
| 928 | Ga0114129_12467895 | |||
| 929 | Ga0105243_10065515 | |||
| 930 | Ga0105241_10002814 | |||
| 931 | Ga0105242_10039499 | |||
| 932 | Ga0105242_10643920 | |||
| 933 | Ga0105248_10608769 | |||
| 934 | Ga0105248_10783009 | |||
| 935 | Ga0105249_10070993 | |||
| 936 | Ga0105249_10202377 | |||
| 937 | Ga0105249_10575338 | |||
| 938 | Ga0105249_10934445 | |||
| 939 | Ga0105249_12240878 | |||
| 940 | Ga0099796_10128287 | |||
| 941 | Ga0099796_10196365 | |||
| 942 | Ga0105239_10456157 | |||
| 943 | Ga0105246_10265469 | |||
| 944 | Ga0105246_10270965 | |||
| 945 | Ga0105246_11023511 | |||
| 946 | Ga0157373_10000439 | |||
| 947 | Ga0157373_10953354 | |||
| 948 | Ga0157371_10056912 | |||
| 949 | Ga0157370_10377404 | |||
| 950 | Ga0157369_10007249 | |||
| 951 | Ga0157378_10446537 | |||
| 952 | Ga0163162_10147092 | |||
| 953 | Ga0163162_10483835 | |||
| 954 | Ga0163162_11375680 | |||
| 955 | Ga0157372_10000313 | |||
| 956 | Ga0157372_10293017 | |||
| 957 | Ga0157375_10248913 | |||
| 958 | Ga0163163_10048435 | |||
| 959 | Ga0163163_10086512 | |||
| 960 | Ga0163163_10175176 | |||
| 961 | Ga0157380_10396538 | |||
| 962 | Ga0182008_10040641 | |||
| 963 | Ga0157377_10058176 | |||
| 964 | Ga0157379_11323546 | |||
| 965 | Ga0157376_11038344 | |||
| 966 | Ga0182007_10053252 | |||
| 967 | Ga0206356_11486106 | |||
| 968 | Ga0213873_10041807 | |||
| 969 | Ga0213874_10107891 | |||
| 970 | Ga0213874_10118277 | |||
| 971 | Ga0213876_10002340 | |||
| 972 | Ga0213876_10355487 | |||
| 973 | Ga0213876_10463628 | |||
| 974 | Ga0213875_10001380 | |||
| 975 | Ga0213875_10013336 | |||
| 976 | Ga0213875_10307603 | |||
| 977 | Ga0213871_10063358 | |||
| 978 | Ga0213871_10065830 | |||
| 979 | Ga0207653_10000897 | |||
| 980 | Ga0207653_10057939 | |||
| 981 | Ga0207653_10103721 | |||
| 982 | Ga0207692_11024622 | |||
| 983 | Ga0207692_11079354 | |||
| 984 | Ga0207710_10197761 | |||
| 985 | Ga0207699_10030576 | |||
| 986 | Ga0207645_10000113 | |||
| 987 | Ga0207643_10000164 | |||
| 988 | Ga0207684_10005380 | |||
| 989 | Ga0207684_11271271 | |||
| 990 | Ga0207684_11457536 | |||
| 991 | Ga0207654_10013924 | |||
| 992 | Ga0207707_10000305 | |||
| 993 | Ga0207695_11586399 | |||
| 994 | Ga0207693_10015910 | |||
| 995 | Ga0207693_10032257 | |||
| 996 | Ga0207693_10033485 | |||
| 997 | Ga0207693_10492618 | |||
| 998 | Ga0207663_10030143 | |||
| 999 | Ga0207663_10312747 | |||
| 1000 | Ga0207663_11513547 | |||
| 1001 | Ga0207663_11551466 | |||
| 1002 | Ga0207660_10000085 | |||
| 1003 | Ga0207660_10256592 | |||
| 1004 | Ga0207662_10163453 | |||
| 1005 | Ga0207662_10554097 | |||
| 1006 | Ga0207657_10000236 | |||
| 1007 | Ga0207652_10000572 | |||
| 1008 | Ga0207646_10023117 | |||
| 1009 | Ga0207646_10045410 | |||
| 1010 | Ga0207646_10253662 | |||
| 1011 | Ga0207681_10065016 | |||
| 1012 | Ga0207681_10295708 | |||
| 1013 | Ga0207650_10055267 | |||
| 1014 | Ga0207659_10102562 | |||
| 1015 | Ga0207687_10242560 | |||
| 1016 | Ga0207700_10042250 | |||
| 1017 | Ga0207700_10051033 | |||
| 1018 | Ga0207700_10070291 | |||
| 1019 | Ga0207700_10141398 | |||
| 1020 | Ga0207700_10334043 | |||
| 1021 | Ga0207700_10502103 | |||
| 1022 | Ga0207700_10703620 | |||
| 1023 | Ga0207664_10011243 | |||
| 1024 | Ga0207664_10059212 | |||
| 1025 | Ga0207664_10193432 | |||
| 1026 | Ga0207664_11691112 | |||
| 1027 | Ga0207690_10006655 | |||
| 1028 | Ga0207706_10027626 | |||
| 1029 | Ga0207706_10032703 | |||
| 1030 | Ga0207686_10029728 | |||
| 1031 | Ga0207709_10036680 | |||
| 1032 | Ga0207709_10839275 | |||
| 1033 | Ga0207670_10195242 | |||
| 1034 | Ga0207670_10587435 | |||
| 1035 | Ga0207704_10325830 | |||
| 1036 | Ga0207665_10018022 | |||
| 1037 | Ga0207665_11451743 | |||
| 1038 | Ga0207665_11610061 | |||
| 1039 | Ga0207691_10047077 | |||
| 1040 | Ga0207711_10160205 | |||
| 1041 | Ga0207711_10457579 | |||
| 1042 | Ga0207711_10538209 | |||
| 1043 | Ga0207711_10663305 | |||
| 1044 | Ga0207689_10000870 | |||
| 1045 | Ga0207689_10174704 | |||
| 1046 | Ga0207689_10340927 | |||
| 1047 | Ga0207661_10054798 | |||
| 1048 | Ga0207679_10029031 | |||
| 1049 | Ga0207667_10001952 | |||
| 1050 | Ga0207667_10281575 | |||
| 1051 | Ga0207712_10083388 | |||
| 1052 | Ga0207712_10580668 | |||
| 1053 | Ga0207640_10000992 | |||
| 1054 | Ga0207658_10151344 | |||
| 1055 | Ga0207677_10075412 | |||
| 1056 | Ga0207677_11582759 | |||
| 1057 | Ga0207639_10002377 | |||
| 1058 | Ga0207678_10007083 | |||
| 1059 | Ga0207708_11040089 | |||
| 1060 | Ga0207702_10001008 | |||
| 1061 | Ga0207702_10008376 | |||
| 1062 | Ga0207702_10161525 | |||
| 1063 | Ga0207702_10346202 | |||
| 1064 | Ga0207641_10069029 | |||
| 1065 | Ga0207641_10175329 | |||
| 1066 | Ga0207641_10920705 | |||
| 1067 | Ga0207641_12081697 | |||
| 1068 | Ga0207648_10161512 | |||
| 1069 | Ga0207648_11890261 | |||
| 1070 | Ga0207676_10011799 | |||
| 1071 | Ga0207676_10623739 | |||
| 1072 | Ga0207676_10937649 | |||
| 1073 | Ga0207674_10000170 | |||
| 1074 | Ga0207674_10022186 | |||
| 1075 | Ga0207674_11675749 | |||
| 1076 | Ga0207675_100009324 | |||
| 1077 | Ga0207675_100111477 | |||
| 1078 | Ga0207675_100295691 | |||
| 1079 | Ga0207698_10406455 | |||
| 1080 | Ga0209969_1007082 | |||
| 1081 | Ga0209967_1003270 | |||
| 1082 | Ga0209981_1006580 | |||
| 1083 | Ga0209984_1010481 | |||
| 1084 | Ga0210000_1004882 | |||
| 1085 | Ga0209995_1003605 | |||
| 1086 | Ga0209968_1002706 | |||
| 1087 | Ga0209999_1001016 | |||
| 1088 | Ga0209982_1003402 | |||
| 1089 | Ga0209970_1001851 | |||
| 1090 | Ga0209983_1000540 | |||
| 1091 | Ga0209588_1002624 | |||
| 1092 | Ga0209971_1000163 | |||
| 1093 | Ga0209971_1051706 | |||
| 1094 | Ga0209966_1000119 | |||
| 1095 | Ga0209966_1006750 | |||
| 1096 | Ga0209998_10000150 | |||
| 1097 | Ga0209998_10006051 | |||
| 1098 | Ga0209998_10059281 | |||
| 1099 | Ga0209974_10009962 | |||
| 1100 | Ga0209974_10044344 | |||
| 1101 | Ga0268266_10839787 | |||
| 1102 | Ga0268265_10006872 | |||
| 1103 | Ga0268265_10494032 | |||
| 1104 | Ga0268265_10999833 | |||
| 1105 | Ga0268264_10044292 | |||
| 1106 | Ga0268264_10208767 | |||
| 1107 | Ga0265338_10171768 | |||
| 1108 | Ga0265325_10164142 | |||
| 1109 | Ga0307408_100116398 | |||
| 1110 | Ga0307408_101608118 | |||
| 1111 | Ga0307405_10246764 | |||
| 1112 | Ga0307407_11409392 | |||
| 1113 | Ga0307409_100084866 | |||
| 1114 | Ga0307409_100835618 | |||
| 1115 | Ga0307416_101312703 | |||
| 1116 | Ga0307411_11875220 | |||
| 1117 | Ga0307415_100339476 | |||
| 1118 | Ga0373948_0014113 | |||
| 1119 | Ga0373950_0020394 | |||
| 1120 | Ga0373959_0048694 | |||
| 1121 | Ga0373926_0134457 | |||
| 1122 | Ga0373934_0019289 | |||
| 1123 | Ga0373940_0087244 | |||
| 1124 | Ga0373944_0136476 | |||
| 1125 | Ga0373949_0013308 | |||
| 1126 | Ga0373949_0021882 | |||
| 1127 | Ga0373949_0208433 | |||
| 1128 | Ga0373951_0016513 | |||
| 1129 | Ga0373923_0055220 | |||
| 1130 | Ga0373932_0192584 | |||
| 1131 | Ga0373939_0278437 | |||
| 1132 | Ga0373941_0041797 | |||
| 1133 | Ga0373945_0467767 | |||
| 1134 | Ga0373953_0037622 | |||
| 1135 | Ga0373953_0172433 | |||
| 1136 | Ga0373954_0010052 | |||
| 1137 | Ga0373956_0014193 | |||
| 1138 | Ga0373956_0102654 | |||
| 1139 | Ga0373957_0061520 | |||
| 1140 | Ga0373960_0010360 | |||
| 1141 | Ga0373960_0133007 | |||
| 1142 | Ga0373943_0115512 | |||
| 1143 | Ga0373943_0187559 | |||
| 1144 | Ga0373943_0600073 | |||
| 1145 | Ga0373946_0077216 | |||
| 1146 | Ga0373955_0052869 | |||
| 1147 | Ga0373955_0060198 | |||
| 1148 | Ga0373961_0004323 | |||
| 1149 | Ga0373924_0022868 | |||
| 1150 | Ga0373924_0197233 | |||
| 1151 | Ga0373931_0148720 | |||
| 1152 | Ga0373931_1291553 | |||
| 1153 | Ga0373935_0062157 | |||
| 1154 | Ga0373935_0103602 | |||
| 1155 | Ga0373935_0257375 | |||
| 1156 | Ga0373927_0022718 | |||
| 1157 | Ga0373927_0200131 | |||
| 1158 | Ga0373933_0011306 | |||
| 1159 | Ga0373933_0121110 | |||
| 1160 | Ga0373933_0229372 | |||
| 1161 | Ga0373947_0090849 | |||
| 1162 | Ga0373947_0143107 | |||
| 1163 | Ga0373937_0027514 | |||
| 1164 | Ga0373937_0073288 | |||
| 1165 | Ga0373937_0318822 | |||
| 1166 | Ga0373937_0562456 | |||
| 1167 | Ga0373937_1687036 | |||
| 1168 | Ga0373925_0031059 | |||
| 1169 | Ga0373925_0118322 | |||
| 1170 | Ga0373925_0519559 | |||
| 1171 | Ga0373925_0568607 | |||
| 1172 | Ga0395900_0618552 | |||
| 1173 | Ga0436364_0145813 | |||
| 1174 | Ga0436364_0467252 | |||
| 1175 | Ga0436364_0601131 | |||
| 1176 | Ga0436364_0663275 | |||
| 1177 | Ga0436364_1513617 | |||
| 1178 | Ga0242420_042086 | |||
| 1179 | Ga0242420_126924 | |||
| 1180 | Ga0436365_0178215 | |||
| 1181 | Ga0436365_0335175 | |||
| 1182 | Ga0436365_0457769 | |||
| 1183 | Ga0436365_0492069 | |||
| 1184 | Ga0436365_1405111 | |||
| 1185 | Ga0436365_1597299 | |||
| 1186 | Ga0436360_0479485 | |||
| 1187 | Ga0436360_0600212 | |||
| 1188 | Ga0436360_1227350 | |||
| 1189 | Ga0436360_1270871 | |||
| 1190 | Ga0436363_0635281 | |||
| 1191 | Ga0436363_1048964 | |||
| 1192 | Ga0436363_1698508 | |||
| 1193 | Ga0436363_1700699 | |||
| 1194 | Ga0436362_0431659 | |||
| 1195 | Ga0436362_0494949 | |||
| 1196 | Ga0436362_0816092 | |||
| 1197 | Ga0439441_001047 | |||
| 1198 | Ga0439448_0006020 | |||
| 1199 | Ga0439450_002450 | |||
| 1200 | Ga0439455_0009296 | |||
| 1201 | Ga0439455_0017669 | |||
| 1202 | Ga0450919_017820 | |||
| 1203 | Ga0439458_0002678 | |||
| 1204 | Ga0439444_0017514 | |||
| 1205 | Ga0439459_0005063 | |||
| 1206 | Ga0439460_0001824 | |||
| 1207 | Ga0451577_0216339 | |||
| 1208 | Ga0453683_0361759 | |||
| 1209 | Ga0466963_0431330 | |||
| 1210 | Ga0453684_0063129 | |||
| 1211 | Ga0453684_1803588 | |||
| 1212 | Ga0451576_0025306 | |||
| 1213 | Ga0451576_0025584 | |||
| 1214 | Ga0451576_0236850 | |||
| 1215 | Ga0451576_0321554 | |||
| 1216 | Ga0451576_0534632 | |||
| 1217 | Ga0451576_0711271 | |||
| 1218 | Ga0466967_2163747 | |||
| 1219 | Ga0495629_0505448 | |||
| 1220 | Ga0495651_0050591 | |||
| 1221 | Ga0495653_0067991 | |||
| 1222 | Ga0495580_0281094 | |||
| 1223 | Ga0495580_0403610 | |||
| 1224 | Ga0495639_0147734 | |||
| 1225 | Ga0495639_0435446 | |||
| 1226 | Ga0495662_0207285 | |||
| 1227 | Ga0495662_0298268 | |||
| 1228 | Ga0495664_0001798 | |||
| 1229 | Ga0495608_0054522 | |||
| 1230 | Ga0495608_0058203 | |||
| 1231 | Ga0495618_0053319 | |||
| 1232 | Ga0495628_0243667 | |||
| 1233 | Ga0495628_0983303 | |||
| 1234 | Ga0495652_0054502 | |||
| 1235 | Ga0495640_0093828 | |||
| 1236 | Ga0495640_0152002 | |||
| 1237 | Ga0495586_0235196 | |||
| 1238 | Ga0495587_0013695 | |||
| 1239 | Ga0495587_0447200 | |||
| 1240 | Ga0495645_0005511 | |||
| 1241 | Ga0495645_0807545 | |||
| 1242 | Ga0495667_0023531 | |||
| 1243 | Ga0495667_0025467 | |||
| 1244 | Ga0495667_0103828 | |||
| 1245 | Ga0495667_0378704 | |||
| 1246 | Ga0495667_0598937 | |||
| 1247 | Ga0495634_0104892 | |||
| 1248 | Ga0495635_0094823 | |||
| 1249 | Ga0495657_0095018 | |||
| 1250 | Ga0495657_0509202 | |||
| 1251 | Ga0495657_0654502 | |||
| 1252 | Ga0495599_0074004 | |||
| 1253 | Ga0495599_0343613 | |||
| 1254 | Ga0495599_0860520 | |||
| 1255 | Ga0495623_0068077 | |||
| 1256 | Ga0495646_0070261 | |||
| 1257 | Ga0495600_0153293 | |||
| 1258 | Ga0495600_0263425 | |||
| 1259 | Ga0495600_0515021 | |||
| 1260 | Ga0495604_0017462 | |||
| 1261 | Ga0495674_0017151 | |||
| 1262 | Ga0495676_0129642 | |||
| 1263 | Ga0495680_0077017 | |||
| 1264 | Ga0495680_0406427 | |||
| 1265 | Ga0495684_0261036 | |||
| 1266 | Ga0495684_0573328 | |||
| 1267 | Ga0495593_0350555 | |||
| 1268 | Ga0495602_0002925 | |||
| 1269 | Ga0495614_0502244 | |||
| 1270 | Ga0496102_0129875 | |||
| 1271 | Ga0496103_0464535 | |||
| 1272 | Ga0496104_0073944 | |||
| 1273 | Ga0496106_0350117 | |||
| 1274 | Ga0496106_0385628 | |||
| 1275 | Ga0496106_0892863 | |||
| 1276 | Ga0496108_0766259 | |||
| 1277 | Ga0496108_0853671 | |||
| 1278 | Ga0496109_0477331 | |||
| 1279 | Ga0496110_0071394 | |||
| 1280 | Ga0496110_0300852 | |||
| 1281 | Ga0496112_0084393 | |||
| 1282 | Ga0496112_0150159 | |||
| 1283 | Ga0496112_0216999 | |||
| 1284 | Ga0496113_0250219 | |||
| 1285 | Ga0501032_0895354 | |||
| 1286 | Ga0501032_0996681 | |||
| 1287 | Ga0501033_0019194 | |||
| 1288 | Ga0501033_0661771 | |||
| 1289 | Ga0501033_1197740 | |||
| 1290 | Ga0501036_0173305 | |||
| 1291 | Ga0501036_0525965 | |||
| 1292 | Ga0501036_0535292 | |||
| 1293 | Ga0501036_1029953 | |||
| 1294 | Ga0501037_0103642 | |||
| 1295 | Ga0501037_0839331 | |||
| 1296 | Ga0501038_0030863 | |||
| 1297 | Ga0501038_0370356 | |||
| 1298 | Ga0501038_0483933 | |||
| 1299 | Ga0501039_0047726 | |||
| 1300 | Ga0501039_0230428 | |||
| 1301 | Ga0501039_1439174 | |||
| 1302 | Ga0501040_0105502 | |||
| 1303 | Ga0501040_0122381 | |||
| 1304 | Ga0501040_0248720 | |||
| 1305 | Ga0501040_0262117 | |||
| 1306 | Ga0501040_0552343 | |||
| 1307 | Ga0501041_0021804 | |||
| 1308 | Ga0501041_0139625 | |||
| 1309 | Ga0501041_0187344 | |||
| 1310 | Ga0501042_0064250 | |||
| 1311 | Ga0501042_0156472 | |||
| 1312 | Ga0501042_0265789 | |||
| 1313 | Ga0501042_0480964 | |||
| 1314 | Ga0501042_0637020 | |||
| 1315 | Ga0501043_0055508 | |||
| 1316 | Ga0501046_0005426 | |||
| 1317 | Ga0501046_0204765 | |||
| 1318 | Ga0501046_0388570 | |||
| 1319 | Ga0501047_0135200 | |||
| 1320 | Ga0501048_0014717 | |||
| 1321 | Ga0501048_0215247 | |||
| 1322 | Ga0501048_0253837 | |||
| 1323 | Ga0501067_0006899 | |||
| 1324 | Ga0501067_0237298 | |||
| 1325 | Ga0501068_0045662 | |||
| 1326 | Ga0501068_0061080 | |||
| 1327 | Ga0501068_0111897 | |||
| 1328 | Ga0501068_0160756 | |||
| 1329 | Ga0501068_0278108 | |||
| 1330 | Ga0501069_0053225 | |||
| 1331 | Ga0501069_0126842 | |||
| 1332 | Ga0501070_0151118 | |||
| 1333 | Ga0501071_0047689 | |||
| 1334 | Ga0501071_0080772 | |||
| 1335 | Ga0501071_0387473 | |||
| 1336 | Ga0501071_0699449 | |||
| 1337 | Ga0501072_0034516 | |||
| 1338 | Ga0501072_0043356 | |||
| 1339 | Ga0501072_0074126 | |||
| 1340 | Ga0501072_0111005 | |||
| 1341 | Ga0501072_0510352 | |||
| 1342 | Ga0501072_0875437 | |||
| 1343 | Ga0501074_0004922 | |||
| 1344 | Ga0501074_0131171 | |||
| 1345 | Ga0501074_0283567 | |||
| 1346 | Ga0501074_0447982 | |||
| 1347 | Ga0501075_0030857 | |||
| 1348 | Ga0501075_0034666 | |||
| 1349 | Ga0501075_0041891 | |||
| 1350 | Ga0501075_0069260 | |||
| 1351 | Ga0501075_0755666 | |||
| 1352 | Ga0501075_0781828 | |||
| 1353 | Ga0501075_1491901 | |||
| 1354 | Ga0501076_0016701 | |||
| 1355 | Ga0501076_0050314 | |||
| 1356 | Ga0501076_0215729 | |||
| 1357 | Ga0501076_0313878 | |||
| 1358 | Ga0501076_0419992 | |||
| 1359 | Ga0501076_1510757 | |||
| 1360 | Ga0501077_0023284 | |||
| 1361 | Ga0501077_0033438 | |||
| 1362 | Ga0501077_0046695 | |||
| 1363 | Ga0501077_0070177 | |||
| 1364 | Ga0501233_259089 | |||
| 1365 | Ga0501079_0000544 | |||
| 1366 | Ga0501079_0001291 | |||
| 1367 | Ga0501079_0004073 | |||
| 1368 | Ga0501079_0045890 | |||
| 1369 | Ga0501079_0283122 | |||
| 1370 | Ga0501079_0403067 | |||
| 1371 | Ga0501079_0451588 | |||
| 1372 | Ga0501079_1287006 | |||
| 1373 | Ga0501080_0028167 | |||
| 1374 | Ga0501080_0184001 | |||
| 1375 | Ga0501080_0267406 | |||
| 1376 | Ga0501080_0281982 | |||
| 1377 | Ga0501080_0459130 | |||
| 1378 | Ga0501081_0002363 | |||
| 1379 | Ga0501081_0062332 | |||
| 1380 | Ga0501081_0079440 | |||
| 1381 | Ga0501081_0132135 | |||
| 1382 | Ga0501081_0162607 | |||
| 1383 | Ga0501081_0866592 | |||
| 1384 | Ga0501083_0016041 | |||
| 1385 | Ga0501083_0320137 | |||
| 1386 | Ga0501035_0254502 | |||
| 1387 | Ga0501035_0325284 | |||
| 1388 | Ga0501045_0006466 | |||
| 1389 | Ga0501045_0137241 | |||
| 1390 | Ga0501045_0146310 | |||
| 1391 | Ga0501045_0162269 | |||
| 1392 | nmdc:mga05p37_142449_c1 | |||
| 1393 | nmdc:mga05p37_171211_c1 | |||
| 1394 | nmdc:mga05p37_27612_c1 | |||
| 1395 | nmdc:mga09592_10160_c1 | |||
| 1396 | nmdc:mga09592_1270679_c1 | |||
| 1397 | nmdc:mga09592_484326_c1 | |||
| 1398 | nmdc:mga0qj67_132375_c1 | |||
| 1399 | nmdc:mga0qj67_6307_c1 | |||
| 1400 | nmdc:mga06r32_319_c1 | |||
| 1401 | nmdc:mga06r32_338871_c1 | |||
| 1402 | nmdc:mga06r32_50894_c1 | |||
| 1403 | nmdc:mga06r32_8924_c1 | |||
| 1404 | nmdc:mga0n895_165417_c1 | |||
| 1405 | nmdc:mga0n895_169910_c1 | |||
| 1406 | nmdc:mga0n895_2180843_c1 | |||
| 1407 | nmdc:mga0n895_2201612_c1 | |||
| 1408 | nmdc:mga0n895_283669_c1 | |||
| 1409 | nmdc:mga0n895_287774_c1 | |||
| 1410 | nmdc:mga0n895_306800_c1 | |||
| 1411 | nmdc:mga0n895_47458_c1 | |||
| 1412 | nmdc:mga0rr50_313289_c1 | |||
| 1413 | nmdc:mga0rr50_5599_c1 | |||
| 1414 | nmdc:mga08x19_69450_c1 | |||
| 1415 | nmdc:mga0a205_411_c1 | |||
| 1416 | nmdc:mga0a205_52258_c1 | |||
| 1417 | nmdc:mga0a205_839442_c1 | |||
| 1418 | Ga0495601_0004384 | |||
| 1419 | Ga0495601_0022902 | |||
| 1420 | Ga0495601_0117775 | |||
| 1421 | Ga0495601_0709592 | |||
| 1422 | Ga0495612_0001013 | |||
| 1423 | Ga0495595_0106915 | |||
| 1424 | Ga0495595_0329371 | |||
| 1425 | Ga0495595_0392098 | |||
| 1426 | Ga0495619_0260640 | |||
| 1427 | Ga0495619_0530450 | |||
| 1428 | Ga0501084_0000637 | |||
| 1429 | Ga0501084_0037585 | |||
| 1430 | Ga0501084_0213163 | |||
| 1431 | Ga0501084_0313452 | |||
| 1432 | Ga0501084_0461014 | |||
| 1433 | Ga0501084_0804571 | |||
| 1434 | Ga0501084_1045823 | |||
| 1435 | Ga0590071_012115 | |||
| 1436 | Ga0501082_0001274 | |||
| 1437 | Ga0501082_0001594 | |||
| 1438 | Ga0501082_0081198 | |||
| 1439 | Ga0501082_0189389 | |||
| 1440 | Ga0501082_0602393 | |||
| 1441 | Ga0530510_0002661 | |||
| 1442 | Ga0530510_0019222 | |||
| 1443 | Ga0530510_0064087 | |||
| 1444 | Ga0530510_0093569 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f44-assembly1.cif.gz_A | crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution | 0.8278 | 3 | 81 |
| 3mcs-assembly1.cif.gz_A | crystal structure of putative monooxygenase (fn1347) from fusobacterium nucleatum subsp. nucleatum atcc 25586 at 2.55 a resolution | 0.7847 | 3 | 80 |
| 2fb0-assembly1.cif.gz_A-2 | crystal structure of conserved protein of unknown function from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution, possible oxidoreductase | 0.7631 | 3 | 82 |
| 2omo-assembly2.cif.gz_C | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.7521 | 3 | 84 |
| 4kia-assembly1.cif.gz_A | crystal structure of lmhde, heme-degrading enzyme, from listeria monocytogenes | 0.7371 | 3 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mcsA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7873 | 3 | 82 | 3.30.70.100 |
| af_P78833_2_105_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7693 | 3 | 82 | 3.30.70.100 |
| 1q8bA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7549 | 2 | 81 | 3.30.70.100 |
| 2fb0A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7337 | 3 | 80 | 3.30.70.100 |
| af_O06569_1_91_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7294 | 1 | 82 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V2GUK5-F1-model_v4 | deleted | 0.9187 | 2 | 77 |
|
| AF-A0A379K550-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.8915 | 1 | 75 |
GO:0004497
GO:0005829 |
| AF-A0A5C5SDI7-F1-model_v4 | ABM domain-containing protein | 0.8892 | 3 | 77 |
|
| AF-A0A372KQ20-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.8844 | 2 | 82 |
GO:0004497
|
| AF-A0A7V4PS86-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.8787 | 1 | 77 |
GO:0004497
GO:0005829 |