F477361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 721 | 282 | 707 | 283 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10143472|Ga0105239_101434722 |
| Length | 316 |
| Sequence | LSYRNIAVRSIDPHAICINPIQNYKLTGVNMSRRTLGRTLKLCTIAALVSSAAAHAADWSDTSLSWRYGNSFREPFNTEDISKHILAFTHADGYKYGTNFFNIDFLMSDSKDPGSLTQSGGAQEAYIVYRNTFDIGKIQGKDVKFGAVRGVGITVGFDVNTKNDVGYNSRKRMIVAGPTLMWDVPGFLNTSLLILEESNAPSGAFPPISGVTGRYHYKTHPMLTAAWGIPVGANLSFEGYANFIASKGKDEVGGDTAAETNIDMELMFDVGAATGGAKNTFKVGLEYQYWKNKFGNPSSVPGSKASTPMIRAEYHF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 3 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 4 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 5 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 6 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 7 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 8 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 9 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 10 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 11 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 12 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 13 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 14 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 15 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 16 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 89 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 148 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 149 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 156 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 167 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 168 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 169 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 268 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 269 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 270 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 271 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 280 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 281 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 282 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0 |
| Isolates | 1.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.21 |
| Nodule | 0 |
| Rhizoplane | 2.91 |
| Rhizosphere | 83.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000449 | 3300002704 | Bacteria | 10563 |
| 2 | JGI25156J39149_1000447 | 3300002705 | Bacteria | 25213 |
| 3 | JGI25156J39149_1001687 | 3300002705 | Bacteria | 8897 |
| 4 | JGI25154J39366_1000400 | 3300002738 | Bacteria | 23688 |
| 5 | JGI25154J39366_1002034 | 3300002738 | Bacteria | 5815 |
| 6 | JGI25154J39366_1002063 | 3300002738 | Bacteria | 5711 |
| 7 | JGI25157J39369_1000267 | 3300002741 | Bacteria | 38232 |
| 8 | JGI25164J39214_1003139 | 3300002772 | Bacteria | 2195 |
| 9 | rootH1_10027638 | 3300003316 | Bacteria | 5133 |
| 10 | rootL2_10141155 | 3300003322 | Bacteria | 10739 |
| 11 | rootH1_10000796 | 3300003323 | Bacteria | 3970 |
| 12 | rootH1_10028606 | 3300003323 | Bacteria | 2654 |
| 13 | rootH1_10281587 | 3300003323 | Bacteria | 1351 |
| 14 | Ga0055539_1000197 | 3300003752 | Bacteria | 49212 |
| 15 | Ga0055533_1000040 | 3300003756 | Bacteria | 242927 |
| 16 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 17 | Ga0055525_1001871 | 3300003759 | Bacteria | 2786 |
| 18 | Ga0055529_1000032 | 3300003763 | Bacteria | 255895 |
| 19 | Ga0055526_1000001 | 3300003771 | Bacteria | 669703 |
| 20 | Ga0055526_1000951 | 3300003771 | Bacteria | 21419 |
| 21 | Ga0055537_1000030 | 3300003773 | Bacteria | 100491 |
| 22 | Ga0055524_1012479 | 3300003775 | Bacteria | 3259 |
| 23 | Ga0055534_1000203 | 3300003784 | Bacteria | 43799 |
| 24 | Ga0055528_1000439 | 3300003790 | Bacteria | 33348 |
| 25 | Ga0065165_1004849 | 3300005262 | Bacteria | 7996 |
| 26 | Ga0065715_10136858 | 3300005293 | Bacteria | 1915 |
| 27 | Ga0070658_10227554 | 3300005327 | Bacteria | 1578 |
| 28 | Ga0070690_100003934 | 3300005330 | Bacteria | 8200 |
| 29 | Ga0070690_100012655 | 3300005330 | Bacteria | 4967 |
| 30 | Ga0068869_100002249 | 3300005334 | Bacteria | 11627 |
| 31 | Ga0070666_10024809 | 3300005335 | Unclassified | 3908 |
| 32 | Ga0068868_100040353 | 3300005338 | Unclassified | 3633 |
| 33 | Ga0070689_100418602 | 3300005340 | Bacteria | 1135 |
| 34 | Ga0070687_100009783 | 3300005343 | Bacteria | 4119 |
| 35 | Ga0070668_100001840 | 3300005347 | Bacteria | 15451 |
| 36 | Ga0070669_100005015 | 3300005353 | Bacteria | 9567 |
| 37 | Ga0070675_100011382 | 3300005354 | Bacteria | 6963 |
| 38 | Ga0070674_100001933 | 3300005356 | Bacteria | 11306 |
| 39 | Ga0070659_100070640 | 3300005366 | Bacteria | 2774 |
| 40 | Ga0070667_100011858 | 3300005367 | Bacteria | 7208 |
| 41 | Ga0070667_100464792 | 3300005367 | Bacteria | 1157 |
| 42 | Ga0070700_100017319 | 3300005441 | Bacteria | 4117 |
| 43 | Ga0070662_100010014 | 3300005457 | Bacteria | 6208 |
| 44 | Ga0068867_100004249 | 3300005459 | Bacteria | 10078 |
| 45 | Ga0070684_100343569 | 3300005535 | Bacteria | 1372 |
| 46 | Ga0068853_100120915 | 3300005539 | Bacteria | 2336 |
| 47 | Ga0068853_100226687 | 3300005539 | Unclassified | 1708 |
| 48 | Ga0070672_100012264 | 3300005543 | Bacteria | 6008 |
| 49 | Ga0068855_100012110 | 3300005563 | Bacteria | 10421 |
| 50 | Ga0068857_100019689 | 3300005577 | Bacteria | 5928 |
| 51 | Ga0068856_100001658 | 3300005614 | Bacteria | 23333 |
| 52 | Ga0068852_100016167 | 3300005616 | Bacteria | 5810 |
| 53 | Ga0068852_100053382 | 3300005616 | Bacteria | 3479 |
| 54 | Ga0068852_100551788 | 3300005616 | Bacteria | 1153 |
| 55 | Ga0068859_100033169 | 3300005617 | Bacteria | 5186 |
| 56 | Ga0068864_100014855 | 3300005618 | Bacteria | 6469 |
| 57 | Ga0068866_10002463 | 3300005718 | Bacteria | 7635 |
| 58 | Ga0068861_100009071 | 3300005719 | Bacteria | 6856 |
| 59 | Ga0068861_100022899 | 3300005719 | Bacteria | 4504 |
| 60 | Ga0068863_100006509 | 3300005841 | Bacteria | 11458 |
| 61 | Ga0068858_100059421 | 3300005842 | Unclassified | 3533 |
| 62 | Ga0068860_100037393 | 3300005843 | Bacteria | 4647 |
| 63 | Ga0068860_100286754 | 3300005843 | Bacteria | 1610 |
| 64 | Ga0068860_100746281 | 3300005843 | Bacteria | 990 |
| 65 | Ga0075363_100112634 | 3300006048 | Bacteria | 1513 |
| 66 | Ga0075366_10013595 | 3300006195 | Bacteria | 4638 |
| 67 | Ga0075366_10043139 | 3300006195 | Bacteria | 2671 |
| 68 | Ga0075366_10043223 | 3300006195 | Bacteria | 2669 |
| 69 | Ga0075370_10025252 | 3300006353 | Bacteria | 3285 |
| 70 | Ga0068865_100003333 | 3300006881 | Bacteria | 9616 |
| 71 | Ga0097620_100033170 | 3300006931 | Bacteria | 5186 |
| 72 | Ga0099795_10080417 | 3300007788 | Bacteria | 1246 |
| 73 | Ga0105240_10018053 | 3300009093 | Bacteria | 9488 |
| 74 | Ga0105240_10069749 | 3300009093 | Bacteria | 4350 |
| 75 | Ga0105245_10069680 | 3300009098 | Unclassified | 3189 |
| 76 | Ga0105243_10005749 | 3300009148 | Bacteria | 9632 |
| 77 | Ga0105242_10067100 | 3300009176 | Bacteria | 2965 |
| 78 | Ga0105242_10068765 | 3300009176 | Bacteria | 2931 |
| 79 | Ga0105238_10281555 | 3300009551 | Bacteria | 1644 |
| 80 | Ga0105249_10003818 | 3300009553 | Bacteria | 13005 |
| 81 | Ga0105239_10045708 | 3300010375 | Bacteria | 4799 |
| 82 | Ga0105239_10128780 | 3300010375 | Bacteria | 2814 |
| 83 | Ga0105239_10143472 | 3300010375 | Bacteria | 2662 |
| 84 | Ga0157369_10120704 | 3300013105 | Bacteria | 2781 |
| 85 | Ga0157378_10040424 | 3300013297 | Bacteria | 4135 |
| 86 | Ga0157378_10184633 | 3300013297 | Bacteria | 1963 |
| 87 | Ga0163162_10015948 | 3300013306 | Bacteria | 7342 |
| 88 | Ga0157375_10056412 | 3300013308 | Unclassified | 3878 |
| 89 | Ga0157375_10252616 | 3300013308 | Bacteria | 1924 |
| 90 | Ga0157380_10011647 | 3300014326 | Bacteria | 6357 |
| 91 | Ga0182008_10000303 | 3300014497 | Bacteria | 38737 |
| 92 | Ga0157379_10004848 | 3300014968 | Bacteria | 11551 |
| 93 | Ga0157379_10022057 | 3300014968 | Bacteria | 5643 |
| 94 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 95 | Ga0182007_10000018 | 3300015262 | Bacteria | 198916 |
| 96 | Ga0182005_1000011 | 3300015265 | Bacteria | 420605 |
| 97 | Ga0163161_10004156 | 3300017792 | Bacteria | 10123 |
| 98 | Ga0163161_10016812 | 3300017792 | Bacteria | 5115 |
| 99 | Ga0213872_10005914 | 3300021361 | Bacteria | 6207 |
| 100 | Ga0213872_10013618 | 3300021361 | Bacteria | 3808 |
| 101 | Ga0209435_100112 | 3300025206 | Bacteria | 31239 |
| 102 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 103 | Ga0209566_100039 | 3300025225 | Bacteria | 303368 |
| 104 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 105 | Ga0209674_100066 | 3300025226 | Bacteria | 256739 |
| 106 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 107 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 108 | Ga0209563_100129 | 3300025230 | Bacteria | 99977 |
| 109 | Ga0207427_100314 | 3300025231 | Bacteria | 33014 |
| 110 | Ga0209437_101493 | 3300025233 | Bacteria | 5588 |
| 111 | Ga0209258_100419 | 3300025242 | Bacteria | 50513 |
| 112 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 113 | Ga0209646_1000054 | 3300025246 | Bacteria | 279447 |
| 114 | Ga0209646_1000076 | 3300025246 | Bacteria | 212891 |
| 115 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 116 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 117 | Ga0209677_100157 | 3300025253 | Bacteria | 62213 |
| 118 | Ga0209677_100160 | 3300025253 | Bacteria | 60301 |
| 119 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 120 | Ga0209759_1000073 | 3300025256 | Bacteria | 178048 |
| 121 | Ga0209759_1000352 | 3300025256 | Bacteria | 59801 |
| 122 | Ga0209759_1014509 | 3300025256 | Bacteria | 2079 |
| 123 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 124 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 125 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 126 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 127 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 128 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 129 | Ga0209256_1000559 | 3300025299 | Bacteria | 53325 |
| 130 | Ga0209051_1004150 | 3300025303 | Bacteria | 9056 |
| 131 | Ga0207642_10002016 | 3300025899 | Bacteria | 6264 |
| 132 | Ga0207680_10008600 | 3300025903 | Bacteria | 5021 |
| 133 | Ga0207645_10000262 | 3300025907 | Bacteria | 43561 |
| 134 | Ga0207705_10277109 | 3300025909 | Bacteria | 1283 |
| 135 | Ga0207654_10021849 | 3300025911 | Bacteria | 3408 |
| 136 | Ga0207695_10009345 | 3300025913 | Bacteria | 12125 |
| 137 | Ga0207695_10022459 | 3300025913 | Bacteria | 7159 |
| 138 | Ga0207671_10032860 | 3300025914 | Bacteria | 3861 |
| 139 | Ga0207662_10002649 | 3300025918 | Bacteria | 9029 |
| 140 | Ga0207657_10028964 | 3300025919 | Bacteria | 5045 |
| 141 | Ga0207657_10099837 | 3300025919 | Bacteria | 2410 |
| 142 | Ga0207681_10007608 | 3300025923 | Bacteria | 6639 |
| 143 | Ga0207694_10040610 | 3300025924 | Bacteria | 3583 |
| 144 | Ga0207687_10154904 | 3300025927 | Unclassified | 1752 |
| 145 | Ga0207690_10285974 | 3300025932 | Bacteria | 1285 |
| 146 | Ga0207690_10541175 | 3300025932 | Bacteria | 946 |
| 147 | Ga0207706_10002487 | 3300025933 | Bacteria | 17961 |
| 148 | Ga0207686_10083547 | 3300025934 | Bacteria | 2090 |
| 149 | Ga0207709_10009363 | 3300025935 | Bacteria | 5389 |
| 150 | Ga0207669_10006468 | 3300025937 | Bacteria | 5357 |
| 151 | Ga0207704_10005165 | 3300025938 | Bacteria | 6012 |
| 152 | Ga0207691_10004507 | 3300025940 | Bacteria | 13486 |
| 153 | Ga0207689_10001349 | 3300025942 | Bacteria | 23560 |
| 154 | Ga0207689_10314573 | 3300025942 | Bacteria | 1299 |
| 155 | Ga0207667_10012991 | 3300025949 | Bacteria | 9559 |
| 156 | Ga0207651_10024234 | 3300025960 | Unclassified | 3749 |
| 157 | Ga0207712_10023893 | 3300025961 | Bacteria | 4041 |
| 158 | Ga0207668_10005376 | 3300025972 | Bacteria | 7536 |
| 159 | Ga0207640_10015038 | 3300025981 | Bacteria | 4471 |
| 160 | Ga0207658_10002923 | 3300025986 | Bacteria | 12231 |
| 161 | Ga0207677_10025514 | 3300026023 | Bacteria | 3689 |
| 162 | Ga0207703_10031541 | 3300026035 | Bacteria | 4191 |
| 163 | Ga0207639_10096759 | 3300026041 | Bacteria | 2376 |
| 164 | Ga0207708_10010773 | 3300026075 | Bacteria | 6795 |
| 165 | Ga0207702_10002567 | 3300026078 | Bacteria | 17081 |
| 166 | Ga0207641_10003275 | 3300026088 | Bacteria | 14413 |
| 167 | Ga0207648_10003878 | 3300026089 | Bacteria | 15609 |
| 168 | Ga0207648_10343067 | 3300026089 | Bacteria | 1345 |
| 169 | Ga0207676_10038326 | 3300026095 | Bacteria | 3657 |
| 170 | Ga0207674_10007284 | 3300026116 | Bacteria | 12896 |
| 171 | Ga0207675_100011808 | 3300026118 | Bacteria | 8164 |
| 172 | Ga0207675_100021794 | 3300026118 | Bacteria | 5964 |
| 173 | Ga0207683_10055825 | 3300026121 | Unclassified | 3464 |
| 174 | Ga0207683_10154393 | 3300026121 | Bacteria | 2073 |
| 175 | Ga0207698_10009829 | 3300026142 | Bacteria | 6113 |
| 176 | Ga0207698_10032690 | 3300026142 | Bacteria | 3772 |
| 177 | Ga0207698_10434803 | 3300026142 | Bacteria | 1263 |
| 178 | Ga0268264_10054528 | 3300028381 | Unclassified | 3338 |
| 179 | Ga0307515_10205931 | 3300028794 | Bacteria | 1827 |
| 180 | Ga0307511_10000574 | 3300030521 | Bacteria | 39348 |
| 181 | Ga0316182_1375358 | 3300030745 | Bacteria | 2514 |
| 182 | Ga0265331_10003107 | 3300031250 | Bacteria | 10866 |
| 183 | Ga0265327_10000083 | 3300031251 | Bacteria | 204923 |
| 184 | Ga0307513_10006896 | 3300031456 | Bacteria | 14785 |
| 185 | Ga0307412_10516676 | 3300031911 | Bacteria | 997 |
| 186 | Ga0307414_10054142 | 3300032004 | Bacteria | 2802 |
| 187 | Ga0307507_10180068 | 3300033179 | Bacteria | 1513 |
| 188 | Ga0373934_0050556 | 3300035086 | Bacteria | 1647 |
| 189 | Ga0373939_0000097 | 3300035114 | Bacteria | 27307 |
| 190 | Ga0373931_0000147 | 3300035691 | Bacteria | 30931 |
| 191 | Ga0373931_0060823 | 3300035691 | Bacteria | 2035 |
| 192 | Ga0395899_0060977 | 3300037312 | Bacteria | 2778 |
| 193 | Ga0395900_0055755 | 3300037418 | Bacteria | 4069 |
| 194 | Ga0395898_0044271 | 3300037466 | Bacteria | 4383 |
| 195 | Ga0395905_0026780 | 3300037471 | Bacteria | 5437 |
| 196 | Ga0395905_0222610 | 3300037471 | Bacteria | 1766 |
| 197 | Ga0395905_0314674 | 3300037471 | Bacteria | 1454 |
| 198 | Ga0395901_0002036 | 3300038443 | Bacteria | 20762 |
| 199 | Ga0436360_0997915 | 3300039438 | Bacteria | 1444 |
| 200 | Ga0436361_0420166 | 3300039447 | Bacteria | 2774 |
| 201 | Ga0436361_0534903 | 3300039447 | Bacteria | 8061 |
| 202 | Ga0436361_0695712 | 3300039447 | Bacteria | 3931 |
| 203 | Ga0451577_0015275 | 3300042876 | Bacteria | 7145 |
| 204 | Ga0451577_0124285 | 3300042876 | Bacteria | 2312 |
| 205 | Ga0466972_0026272 | 3300044658 | Bacteria | 2885 |
| 206 | Ga0466972_0053888 | 3300044658 | Bacteria | 1936 |
| 207 | Ga0466965_0041380 | 3300044683 | Bacteria | 2270 |
| 208 | Ga0466965_0042023 | 3300044683 | Bacteria | 2253 |
| 209 | Ga0466964_0008294 | 3300044706 | Bacteria | 3898 |
| 210 | Ga0466964_0041507 | 3300044706 | Bacteria | 1861 |
| 211 | Ga0453684_0113609 | 3300044712 | Bacteria | 3285 |
| 212 | Ga0466968_0002881 | 3300044735 | Bacteria | 6360 |
| 213 | Ga0466968_0007155 | 3300044735 | Bacteria | 4239 |
| 214 | Ga0451576_0269599 | 3300045051 | Bacteria | 1780 |
| 215 | Ga0466967_0083388 | 3300045976 | Bacteria | 2890 |
| 216 | Ga0495617_000087 | 3300046452 | Bacteria | 67401 |
| 217 | Ga0495617_000290 | 3300046452 | Bacteria | 28770 |
| 218 | Ga0495627_000463 | 3300046453 | Bacteria | 35122 |
| 219 | Ga0495627_022867 | 3300046453 | Bacteria | 2053 |
| 220 | Ga0495603_0025372 | 3300046455 | Bacteria | 3584 |
| 221 | Ga0495603_0069133 | 3300046455 | Bacteria | 2078 |
| 222 | Ga0495603_0137007 | 3300046455 | Bacteria | 1424 |
| 223 | Ga0495590_0000034 | 3300046457 | Bacteria | 129910 |
| 224 | Ga0495590_0000069 | 3300046457 | Bacteria | 73784 |
| 225 | Ga0495590_0005517 | 3300046457 | Bacteria | 5010 |
| 226 | Ga0495590_0013494 | 3300046457 | Bacteria | 3001 |
| 227 | Ga0495591_000370 | 3300046458 | Bacteria | 38562 |
| 228 | Ga0495591_011655 | 3300046458 | Bacteria | 3313 |
| 229 | Ga0495629_0002150 | 3300046459 | Bacteria | 15267 |
| 230 | Ga0495629_0035370 | 3300046459 | Bacteria | 3530 |
| 231 | Ga0495629_0040206 | 3300046459 | Bacteria | 3289 |
| 232 | Ga0495638_0000072 | 3300046460 | Bacteria | 164926 |
| 233 | Ga0495638_0004326 | 3300046460 | Bacteria | 10769 |
| 234 | Ga0495638_0031645 | 3300046460 | Bacteria | 3398 |
| 235 | Ga0495638_0097807 | 3300046460 | Bacteria | 1759 |
| 236 | Ga0495638_0201746 | 3300046460 | Bacteria | 1122 |
| 237 | Ga0495638_0203808 | 3300046460 | Bacteria | 1115 |
| 238 | Ga0495653_0031373 | 3300046463 | Bacteria | 4223 |
| 239 | Ga0495650_0005074 | 3300046471 | Bacteria | 8712 |
| 240 | Ga0495650_0009804 | 3300046471 | Bacteria | 5413 |
| 241 | Ga0495582_0036959 | 3300046473 | Bacteria | 2686 |
| 242 | Ga0495605_0000238 | 3300046474 | Bacteria | 66355 |
| 243 | Ga0495605_0004352 | 3300046474 | Bacteria | 8327 |
| 244 | Ga0495605_0007732 | 3300046474 | Bacteria | 6093 |
| 245 | Ga0495605_0008039 | 3300046474 | Bacteria | 5972 |
| 246 | Ga0495605_0018205 | 3300046474 | Bacteria | 3770 |
| 247 | Ga0495605_0023450 | 3300046474 | Bacteria | 3244 |
| 248 | Ga0495605_0032973 | 3300046474 | Bacteria | 2633 |
| 249 | Ga0495605_0079681 | 3300046474 | Bacteria | 1533 |
| 250 | Ga0495584_0000165 | 3300046491 | Bacteria | 46858 |
| 251 | Ga0495584_0000573 | 3300046491 | Bacteria | 24792 |
| 252 | Ga0495584_0001012 | 3300046491 | Bacteria | 17554 |
| 253 | Ga0495584_0003264 | 3300046491 | Bacteria | 8989 |
| 254 | Ga0495584_0011854 | 3300046491 | Bacteria | 4458 |
| 255 | Ga0495584_0012480 | 3300046491 | Bacteria | 4337 |
| 256 | Ga0495584_0035410 | 3300046491 | Bacteria | 2523 |
| 257 | Ga0495584_0052214 | 3300046491 | Bacteria | 2057 |
| 258 | Ga0495584_0065504 | 3300046491 | Bacteria | 1827 |
| 259 | Ga0495585_0000114 | 3300046492 | Bacteria | 86587 |
| 260 | Ga0495585_0000249 | 3300046492 | Bacteria | 55924 |
| 261 | Ga0495585_0001056 | 3300046492 | Bacteria | 22787 |
| 262 | Ga0495585_0001261 | 3300046492 | Bacteria | 20317 |
| 263 | Ga0495585_0007090 | 3300046492 | Bacteria | 6885 |
| 264 | Ga0495585_0008225 | 3300046492 | Bacteria | 6331 |
| 265 | Ga0495585_0010267 | 3300046492 | Bacteria | 5583 |
| 266 | Ga0495585_0012029 | 3300046492 | Bacteria | 5107 |
| 267 | Ga0495585_0012749 | 3300046492 | Bacteria | 4946 |
| 268 | Ga0495585_0016207 | 3300046492 | Bacteria | 4318 |
| 269 | Ga0495585_0018643 | 3300046492 | Bacteria | 4002 |
| 270 | Ga0495585_0025681 | 3300046492 | Bacteria | 3370 |
| 271 | Ga0495585_0028872 | 3300046492 | Bacteria | 3161 |
| 272 | Ga0495585_0030953 | 3300046492 | Bacteria | 3041 |
| 273 | Ga0495585_0031175 | 3300046492 | Bacteria | 3028 |
| 274 | Ga0495585_0052330 | 3300046492 | Bacteria | 2260 |
| 275 | Ga0495585_0116020 | 3300046492 | Bacteria | 1420 |
| 276 | Ga0495585_0211257 | 3300046492 | Bacteria | 983 |
| 277 | Ga0495594_0000661 | 3300046499 | Bacteria | 17833 |
| 278 | Ga0495594_0009492 | 3300046499 | Bacteria | 5028 |
| 279 | Ga0495594_0011150 | 3300046499 | Bacteria | 4666 |
| 280 | Ga0495594_0138748 | 3300046499 | Bacteria | 1378 |
| 281 | Ga0495596_0000286 | 3300046500 | Bacteria | 33687 |
| 282 | Ga0495596_0001162 | 3300046500 | Bacteria | 15439 |
| 283 | Ga0495596_0002482 | 3300046500 | Bacteria | 9894 |
| 284 | Ga0495596_0004823 | 3300046500 | Bacteria | 6484 |
| 285 | Ga0495596_0009669 | 3300046500 | Bacteria | 4236 |
| 286 | Ga0495596_0010660 | 3300046500 | Bacteria | 3993 |
| 287 | Ga0495596_0019401 | 3300046500 | Bacteria | 2793 |
| 288 | Ga0495596_0024009 | 3300046500 | Bacteria | 2472 |
| 289 | Ga0495596_0025834 | 3300046500 | Bacteria | 2371 |
| 290 | Ga0495607_0009178 | 3300046501 | Bacteria | 6721 |
| 291 | Ga0495607_0010087 | 3300046501 | Bacteria | 6360 |
| 292 | Ga0495607_0011159 | 3300046501 | Bacteria | 6000 |
| 293 | Ga0495607_0015607 | 3300046501 | Bacteria | 4920 |
| 294 | Ga0495607_0024614 | 3300046501 | Bacteria | 3750 |
| 295 | Ga0495607_0032554 | 3300046501 | Bacteria | 3181 |
| 296 | Ga0495607_0038547 | 3300046501 | Bacteria | 2862 |
| 297 | Ga0495607_0058959 | 3300046501 | Bacteria | 2191 |
| 298 | Ga0495607_0071431 | 3300046501 | Bacteria | 1935 |
| 299 | Ga0495607_0073431 | 3300046501 | Bacteria | 1901 |
| 300 | Ga0495583_0000148 | 3300046506 | Bacteria | 118749 |
| 301 | Ga0495583_0000272 | 3300046506 | Bacteria | 84886 |
| 302 | Ga0495583_0000336 | 3300046506 | Bacteria | 74005 |
| 303 | Ga0495583_0000340 | 3300046506 | Bacteria | 73583 |
| 304 | Ga0495583_0000374 | 3300046506 | Bacteria | 69535 |
| 305 | Ga0495583_0000873 | 3300046506 | Bacteria | 36542 |
| 306 | Ga0495583_0001741 | 3300046506 | Bacteria | 20775 |
| 307 | Ga0495583_0006709 | 3300046506 | Bacteria | 7457 |
| 308 | Ga0495583_0008300 | 3300046506 | Bacteria | 6368 |
| 309 | Ga0495583_0024307 | 3300046506 | Bacteria | 3047 |
| 310 | Ga0495583_0025925 | 3300046506 | Bacteria | 2918 |
| 311 | Ga0495583_0055718 | 3300046506 | Bacteria | 1785 |
| 312 | Ga0495583_0118455 | 3300046506 | Bacteria | 1116 |
| 313 | Ga0495583_0163038 | 3300046506 | Bacteria | 919 |
| 314 | Ga0495606_0001703 | 3300046507 | Bacteria | 28385 |
| 315 | Ga0495606_0011209 | 3300046507 | Bacteria | 7337 |
| 316 | Ga0495606_0027198 | 3300046507 | Bacteria | 4061 |
| 317 | Ga0495606_0043982 | 3300046507 | Bacteria | 2973 |
| 318 | Ga0495606_0050745 | 3300046507 | Bacteria | 2711 |
| 319 | Ga0495606_0063133 | 3300046507 | Bacteria | 2362 |
| 320 | Ga0495606_0079285 | 3300046507 | Bacteria | 2045 |
| 321 | Ga0495606_0104565 | 3300046507 | Bacteria | 1718 |
| 322 | Ga0495606_0175792 | 3300046507 | Bacteria | 1238 |
| 323 | Ga0495610_0000448 | 3300046512 | Bacteria | 42572 |
| 324 | Ga0495610_0031255 | 3300046512 | Bacteria | 2780 |
| 325 | Ga0495610_0068082 | 3300046512 | Bacteria | 1670 |
| 326 | Ga0495610_0089803 | 3300046512 | Bacteria | 1395 |
| 327 | Ga0495616_0000255 | 3300046513 | Bacteria | 43270 |
| 328 | Ga0495616_0002876 | 3300046513 | Bacteria | 11237 |
| 329 | Ga0495616_0003165 | 3300046513 | Bacteria | 10626 |
| 330 | Ga0495616_0006552 | 3300046513 | Bacteria | 7033 |
| 331 | Ga0495616_0018313 | 3300046513 | Bacteria | 3846 |
| 332 | Ga0495616_0029944 | 3300046513 | Bacteria | 2866 |
| 333 | Ga0495616_0036975 | 3300046513 | Bacteria | 2515 |
| 334 | Ga0495616_0072604 | 3300046513 | Bacteria | 1661 |
| 335 | Ga0495616_0118751 | 3300046513 | Bacteria | 1223 |
| 336 | Ga0495620_0053584 | 3300046515 | Bacteria | 1707 |
| 337 | Ga0495631_0001384 | 3300046518 | Bacteria | 14735 |
| 338 | Ga0495631_0001392 | 3300046518 | Bacteria | 14697 |
| 339 | Ga0495631_0002906 | 3300046518 | Bacteria | 9490 |
| 340 | Ga0495631_0005307 | 3300046518 | Bacteria | 6767 |
| 341 | Ga0495631_0009828 | 3300046518 | Bacteria | 4762 |
| 342 | Ga0495631_0015726 | 3300046518 | Bacteria | 3618 |
| 343 | Ga0495631_0018610 | 3300046518 | Bacteria | 3267 |
| 344 | Ga0495631_0022866 | 3300046518 | Bacteria | 2904 |
| 345 | Ga0495631_0024806 | 3300046518 | Bacteria | 2766 |
| 346 | Ga0495631_0025266 | 3300046518 | Bacteria | 2737 |
| 347 | Ga0495631_0029718 | 3300046518 | Bacteria | 2483 |
| 348 | Ga0495631_0046494 | 3300046518 | Bacteria | 1907 |
| 349 | Ga0495632_0000145 | 3300046519 | Bacteria | 72949 |
| 350 | Ga0495632_0000160 | 3300046519 | Bacteria | 69602 |
| 351 | Ga0495632_0000958 | 3300046519 | Bacteria | 25232 |
| 352 | Ga0495632_0004211 | 3300046519 | Bacteria | 9834 |
| 353 | Ga0495632_0020304 | 3300046519 | Bacteria | 3598 |
| 354 | Ga0495632_0022255 | 3300046519 | Bacteria | 3399 |
| 355 | Ga0495637_0000095 | 3300046520 | Bacteria | 69092 |
| 356 | Ga0495637_0021936 | 3300046520 | Bacteria | 2919 |
| 357 | Ga0495643_0000099 | 3300046522 | Bacteria | 145425 |
| 358 | Ga0495643_0000135 | 3300046522 | Bacteria | 118587 |
| 359 | Ga0495643_0036636 | 3300046522 | Bacteria | 2694 |
| 360 | Ga0495643_0090542 | 3300046522 | Bacteria | 1578 |
| 361 | Ga0495643_0149433 | 3300046522 | Bacteria | 1158 |
| 362 | Ga0495644_0000135 | 3300046523 | Bacteria | 35398 |
| 363 | Ga0495644_0001024 | 3300046523 | Bacteria | 11647 |
| 364 | Ga0495644_0003309 | 3300046523 | Bacteria | 6372 |
| 365 | Ga0495644_0010915 | 3300046523 | Bacteria | 3501 |
| 366 | Ga0495644_0016030 | 3300046523 | Bacteria | 2871 |
| 367 | Ga0495644_0016962 | 3300046523 | Bacteria | 2786 |
| 368 | Ga0495644_0022768 | 3300046523 | Bacteria | 2386 |
| 369 | Ga0495644_0025877 | 3300046523 | Bacteria | 2226 |
| 370 | Ga0495644_0028194 | 3300046523 | Bacteria | 2125 |
| 371 | Ga0495644_0030021 | 3300046523 | Bacteria | 2052 |
| 372 | Ga0495644_0045397 | 3300046523 | Bacteria | 1652 |
| 373 | Ga0495648_0000037 | 3300046524 | Bacteria | 195401 |
| 374 | Ga0495648_0000174 | 3300046524 | Bacteria | 74225 |
| 375 | Ga0495648_0000540 | 3300046524 | Bacteria | 40830 |
| 376 | Ga0495648_0000622 | 3300046524 | Bacteria | 37974 |
| 377 | Ga0495648_0001727 | 3300046524 | Bacteria | 21088 |
| 378 | Ga0495648_0016428 | 3300046524 | Bacteria | 5338 |
| 379 | Ga0495648_0020390 | 3300046524 | Bacteria | 4624 |
| 380 | Ga0495648_0025668 | 3300046524 | Bacteria | 3984 |
| 381 | Ga0495648_0132844 | 3300046524 | Bacteria | 1321 |
| 382 | Ga0495663_0005750 | 3300046525 | Bacteria | 3433 |
| 383 | Ga0495663_0022940 | 3300046525 | Bacteria | 1805 |
| 384 | Ga0495666_0002988 | 3300046526 | Bacteria | 8486 |
| 385 | Ga0495642_0000102 | 3300046528 | Bacteria | 48179 |
| 386 | Ga0495642_0000404 | 3300046528 | Bacteria | 23219 |
| 387 | Ga0495642_0000540 | 3300046528 | Bacteria | 19040 |
| 388 | Ga0495642_0001408 | 3300046528 | Bacteria | 10781 |
| 389 | Ga0495642_0002114 | 3300046528 | Bacteria | 8212 |
| 390 | Ga0495642_0011415 | 3300046528 | Bacteria | 3413 |
| 391 | Ga0495642_0012299 | 3300046528 | Bacteria | 3298 |
| 392 | Ga0495642_0013070 | 3300046528 | Bacteria | 3207 |
| 393 | Ga0495642_0015048 | 3300046528 | Bacteria | 3003 |
| 394 | Ga0495642_0030408 | 3300046528 | Bacteria | 2160 |
| 395 | Ga0495642_0050791 | 3300046528 | Bacteria | 1705 |
| 396 | Ga0495642_0052474 | 3300046528 | Bacteria | 1679 |
| 397 | Ga0495654_0003810 | 3300046530 | Bacteria | 9118 |
| 398 | Ga0495654_0003860 | 3300046530 | Bacteria | 9051 |
| 399 | Ga0495654_0017026 | 3300046530 | Bacteria | 3828 |
| 400 | Ga0495665_0035123 | 3300046531 | Bacteria | 2679 |
| 401 | Ga0495640_0043506 | 3300046533 | Bacteria | 3127 |
| 402 | Ga0495586_0000564 | 3300046535 | Bacteria | 21474 |
| 403 | Ga0495587_0045980 | 3300046536 | Bacteria | 2593 |
| 404 | Ga0495587_0200203 | 3300046536 | Bacteria | 1129 |
| 405 | Ga0495609_0000992 | 3300046538 | Bacteria | 20251 |
| 406 | Ga0495609_0001788 | 3300046538 | Bacteria | 13793 |
| 407 | Ga0495609_0002768 | 3300046538 | Bacteria | 10554 |
| 408 | Ga0495609_0003858 | 3300046538 | Bacteria | 8429 |
| 409 | Ga0495609_0004975 | 3300046538 | Bacteria | 7120 |
| 410 | Ga0495609_0009226 | 3300046538 | Bacteria | 4780 |
| 411 | Ga0495609_0012527 | 3300046538 | Bacteria | 4023 |
| 412 | Ga0495609_0013043 | 3300046538 | Bacteria | 3931 |
| 413 | Ga0495609_0051931 | 3300046538 | Bacteria | 1824 |
| 414 | Ga0495609_0123099 | 3300046538 | Bacteria | 1114 |
| 415 | Ga0495597_0000156 | 3300046542 | Bacteria | 60520 |
| 416 | Ga0495597_0000172 | 3300046542 | Bacteria | 57536 |
| 417 | Ga0495597_0000279 | 3300046542 | Bacteria | 46410 |
| 418 | Ga0495597_0000298 | 3300046542 | Bacteria | 44574 |
| 419 | Ga0495597_0000318 | 3300046542 | Bacteria | 43381 |
| 420 | Ga0495597_0001246 | 3300046542 | Bacteria | 18849 |
| 421 | Ga0495597_0003999 | 3300046542 | Bacteria | 8283 |
| 422 | Ga0495597_0004715 | 3300046542 | Bacteria | 7394 |
| 423 | Ga0495597_0005162 | 3300046542 | Bacteria | 6956 |
| 424 | Ga0495597_0009704 | 3300046542 | Bacteria | 4743 |
| 425 | Ga0495597_0074508 | 3300046542 | Bacteria | 1457 |
| 426 | Ga0495597_0079024 | 3300046542 | Bacteria | 1409 |
| 427 | Ga0495597_0085927 | 3300046542 | Bacteria | 1340 |
| 428 | Ga0495645_0027365 | 3300046543 | Bacteria | 4143 |
| 429 | Ga0495622_0000040 | 3300046557 | Bacteria | 118542 |
| 430 | Ga0495622_0001638 | 3300046557 | Bacteria | 11062 |
| 431 | Ga0495622_0025512 | 3300046557 | Bacteria | 2760 |
| 432 | Ga0495622_0028151 | 3300046557 | Bacteria | 2623 |
| 433 | Ga0495622_0038292 | 3300046557 | Bacteria | 2232 |
| 434 | Ga0495622_0177392 | 3300046557 | Bacteria | 956 |
| 435 | Ga0495633_0000121 | 3300046558 | Bacteria | 105197 |
| 436 | Ga0495633_0000349 | 3300046558 | Bacteria | 50979 |
| 437 | Ga0495633_0000455 | 3300046558 | Bacteria | 42004 |
| 438 | Ga0495633_0002132 | 3300046558 | Bacteria | 14171 |
| 439 | Ga0495633_0002398 | 3300046558 | Bacteria | 13265 |
| 440 | Ga0495633_0002575 | 3300046558 | Bacteria | 12699 |
| 441 | Ga0495633_0003155 | 3300046558 | Bacteria | 11156 |
| 442 | Ga0495633_0005792 | 3300046558 | Bacteria | 7456 |
| 443 | Ga0495633_0006230 | 3300046558 | Bacteria | 7121 |
| 444 | Ga0495633_0013639 | 3300046558 | Bacteria | 4274 |
| 445 | Ga0495633_0033290 | 3300046558 | Bacteria | 2485 |
| 446 | Ga0495633_0050694 | 3300046558 | Bacteria | 1956 |
| 447 | Ga0495633_0068729 | 3300046558 | Bacteria | 1653 |
| 448 | Ga0495633_0071886 | 3300046558 | Bacteria | 1613 |
| 449 | Ga0495633_0092913 | 3300046558 | Bacteria | 1402 |
| 450 | Ga0495633_0096108 | 3300046558 | Bacteria | 1376 |
| 451 | Ga0495633_0110648 | 3300046558 | Bacteria | 1273 |
| 452 | Ga0495633_0130375 | 3300046558 | Bacteria | 1163 |
| 453 | Ga0495667_0164163 | 3300046559 | Bacteria | 1428 |
| 454 | Ga0495656_0002423 | 3300046615 | Bacteria | 6187 |
| 455 | Ga0495656_0040517 | 3300046615 | Bacteria | 1941 |
| 456 | Ga0495668_0000285 | 3300046616 | Bacteria | 70023 |
| 457 | Ga0495668_0000404 | 3300046616 | Bacteria | 56317 |
| 458 | Ga0495668_0002059 | 3300046616 | Bacteria | 17461 |
| 459 | Ga0495668_0002934 | 3300046616 | Bacteria | 13461 |
| 460 | Ga0495668_0004168 | 3300046616 | Bacteria | 10433 |
| 461 | Ga0495668_0005606 | 3300046616 | Bacteria | 8444 |
| 462 | Ga0495668_0008722 | 3300046616 | Bacteria | 6296 |
| 463 | Ga0495668_0016009 | 3300046616 | Bacteria | 4367 |
| 464 | Ga0495668_0023122 | 3300046616 | Bacteria | 3547 |
| 465 | Ga0495668_0023903 | 3300046616 | Bacteria | 3479 |
| 466 | Ga0495668_0030062 | 3300046616 | Bacteria | 3068 |
| 467 | Ga0495668_0030333 | 3300046616 | Bacteria | 3053 |
| 468 | Ga0495668_0045168 | 3300046616 | Bacteria | 2448 |
| 469 | Ga0495668_0123369 | 3300046616 | Bacteria | 1417 |
| 470 | Ga0495668_0128119 | 3300046616 | Bacteria | 1389 |
| 471 | Ga0495611_0000173 | 3300046648 | Bacteria | 46907 |
| 472 | Ga0495611_0000924 | 3300046648 | Bacteria | 15830 |
| 473 | Ga0495611_0003078 | 3300046648 | Bacteria | 7405 |
| 474 | Ga0495611_0003527 | 3300046648 | Bacteria | 6887 |
| 475 | Ga0495611_0006515 | 3300046648 | Bacteria | 4975 |
| 476 | Ga0495611_0013911 | 3300046648 | Bacteria | 3432 |
| 477 | Ga0495611_0015931 | 3300046648 | Bacteria | 3212 |
| 478 | Ga0495611_0019296 | 3300046648 | Bacteria | 2927 |
| 479 | Ga0495611_0024690 | 3300046648 | Bacteria | 2615 |
| 480 | Ga0495625_0000023 | 3300046660 | Bacteria | 274067 |
| 481 | Ga0495625_0004975 | 3300046660 | Bacteria | 12344 |
| 482 | Ga0495625_0007596 | 3300046660 | Bacteria | 9413 |
| 483 | Ga0495625_0011673 | 3300046660 | Bacteria | 7146 |
| 484 | Ga0495625_0012646 | 3300046660 | Bacteria | 6830 |
| 485 | Ga0495625_0019667 | 3300046660 | Bacteria | 5229 |
| 486 | Ga0495625_0026549 | 3300046660 | Bacteria | 4375 |
| 487 | Ga0495625_0085821 | 3300046660 | Bacteria | 2184 |
| 488 | Ga0495625_0199258 | 3300046660 | Bacteria | 1322 |
| 489 | Ga0495625_0220737 | 3300046660 | Bacteria | 1242 |
| 490 | Ga0495659_0001953 | 3300046664 | Bacteria | 6789 |
| 491 | Ga0495659_0003081 | 3300046664 | Bacteria | 5355 |
| 492 | Ga0495659_0042254 | 3300046664 | Bacteria | 1631 |
| 493 | Ga0495659_0079060 | 3300046664 | Bacteria | 1245 |
| 494 | Ga0495661_0000559 | 3300046665 | Bacteria | 38444 |
| 495 | Ga0495661_0000741 | 3300046665 | Bacteria | 31777 |
| 496 | Ga0495661_0007629 | 3300046665 | Bacteria | 7538 |
| 497 | Ga0495661_0010844 | 3300046665 | Bacteria | 6198 |
| 498 | Ga0495661_0017689 | 3300046665 | Bacteria | 4702 |
| 499 | Ga0495661_0030115 | 3300046665 | Bacteria | 3458 |
| 500 | Ga0495661_0033199 | 3300046665 | Bacteria | 3256 |
| 501 | Ga0495661_0035341 | 3300046665 | Bacteria | 3136 |
| 502 | Ga0495661_0057391 | 3300046665 | Bacteria | 2324 |
| 503 | Ga0495661_0066202 | 3300046665 | Bacteria | 2127 |
| 504 | Ga0495661_0092619 | 3300046665 | Bacteria | 1716 |
| 505 | Ga0495661_0183407 | 3300046665 | Bacteria | 1107 |
| 506 | Ga0495588_0003827 | 3300046674 | Bacteria | 6593 |
| 507 | Ga0495588_0029355 | 3300046674 | Bacteria | 2758 |
| 508 | Ga0495588_0116572 | 3300046674 | Bacteria | 1407 |
| 509 | Ga0495623_0082622 | 3300046679 | Bacteria | 1985 |
| 510 | Ga0495669_0000079 | 3300046684 | Bacteria | 64091 |
| 511 | Ga0495669_0002027 | 3300046684 | Bacteria | 8305 |
| 512 | Ga0495669_0002782 | 3300046684 | Bacteria | 7170 |
| 513 | Ga0495669_0004395 | 3300046684 | Bacteria | 5820 |
| 514 | Ga0495669_0013658 | 3300046684 | Bacteria | 3465 |
| 515 | Ga0495613_0009834 | 3300046689 | Bacteria | 7113 |
| 516 | Ga0495613_0188557 | 3300046689 | Bacteria | 1458 |
| 517 | Ga0495624_0008965 | 3300046690 | Bacteria | 6951 |
| 518 | Ga0495624_0059677 | 3300046690 | Bacteria | 2393 |
| 519 | Ga0495670_0000174 | 3300046691 | Bacteria | 28766 |
| 520 | Ga0495670_0001062 | 3300046691 | Bacteria | 13322 |
| 521 | Ga0495670_0004373 | 3300046691 | Bacteria | 6928 |
| 522 | Ga0495670_0008286 | 3300046691 | Bacteria | 5111 |
| 523 | Ga0495670_0011396 | 3300046691 | Bacteria | 4372 |
| 524 | Ga0495670_0019955 | 3300046691 | Bacteria | 3303 |
| 525 | Ga0495670_0020440 | 3300046691 | Bacteria | 3265 |
| 526 | Ga0495670_0045816 | 3300046691 | Bacteria | 2183 |
| 527 | Ga0495670_0092823 | 3300046691 | Bacteria | 1546 |
| 528 | Ga0495671_0000233 | 3300046692 | Bacteria | 47785 |
| 529 | Ga0495671_0006510 | 3300046692 | Bacteria | 6743 |
| 530 | Ga0495671_0007352 | 3300046692 | Bacteria | 6285 |
| 531 | Ga0495671_0011162 | 3300046692 | Bacteria | 4955 |
| 532 | Ga0495671_0020289 | 3300046692 | Bacteria | 3502 |
| 533 | Ga0495671_0024472 | 3300046692 | Bacteria | 3144 |
| 534 | Ga0495671_0070053 | 3300046692 | Bacteria | 1723 |
| 535 | Ga0495649_0000433 | 3300046694 | Bacteria | 36167 |
| 536 | Ga0495649_0001256 | 3300046694 | Bacteria | 19524 |
| 537 | Ga0495649_0013109 | 3300046694 | Bacteria | 4791 |
| 538 | Ga0495649_0019677 | 3300046694 | Bacteria | 3791 |
| 539 | Ga0495649_0104600 | 3300046694 | Bacteria | 1503 |
| 540 | Ga0495649_0104714 | 3300046694 | Bacteria | 1502 |
| 541 | Ga0495649_0166534 | 3300046694 | Bacteria | 1154 |
| 542 | Ga0495649_0247895 | 3300046694 | Bacteria | 915 |
| 543 | Ga0495589_0000410 | 3300046794 | Bacteria | 32229 |
| 544 | Ga0495589_0006370 | 3300046794 | Bacteria | 6235 |
| 545 | Ga0495589_0027743 | 3300046794 | Bacteria | 2861 |
| 546 | Ga0495589_0047043 | 3300046794 | Bacteria | 2138 |
| 547 | Ga0495589_0084022 | 3300046794 | Bacteria | 1547 |
| 548 | Ga0495589_0084525 | 3300046794 | Bacteria | 1542 |
| 549 | Ga0495589_0135404 | 3300046794 | Bacteria | 1181 |
| 550 | Ga0495589_0173785 | 3300046794 | Bacteria | 1023 |
| 551 | Ga0495600_0304443 | 3300046809 | Bacteria | 1005 |
| 552 | Ga0495660_0002258 | 3300046810 | Bacteria | 12399 |
| 553 | Ga0495660_0008047 | 3300046810 | Bacteria | 6194 |
| 554 | Ga0495660_0010318 | 3300046810 | Bacteria | 5431 |
| 555 | Ga0495660_0021917 | 3300046810 | Bacteria | 3653 |
| 556 | Ga0495660_0029176 | 3300046810 | Bacteria | 3114 |
| 557 | Ga0495660_0030404 | 3300046810 | Bacteria | 3042 |
| 558 | Ga0495660_0044375 | 3300046810 | Bacteria | 2445 |
| 559 | Ga0495660_0185110 | 3300046810 | Bacteria | 1004 |
| 560 | Ga0495581_0023057 | 3300047315 | Bacteria | 3607 |
| 561 | Ga0495604_0007669 | 3300047317 | Bacteria | 8547 |
| 562 | Ga0495604_0035726 | 3300047317 | Bacteria | 3922 |
| 563 | Ga0495604_0093325 | 3300047317 | Bacteria | 2227 |
| 564 | Ga0495636_0001041 | 3300047318 | Bacteria | 10404 |
| 565 | Ga0495636_0001847 | 3300047318 | Bacteria | 8101 |
| 566 | Ga0495636_0004009 | 3300047318 | Bacteria | 5755 |
| 567 | Ga0495636_0005679 | 3300047318 | Bacteria | 4890 |
| 568 | Ga0495636_0024505 | 3300047318 | Bacteria | 2447 |
| 569 | Ga0495636_0034617 | 3300047318 | Bacteria | 2079 |
| 570 | Ga0495636_0034699 | 3300047318 | Bacteria | 2076 |
| 571 | Ga0495636_0129851 | 3300047318 | Bacteria | 1120 |
| 572 | Ga0495672_0000277 | 3300047320 | Bacteria | 71082 |
| 573 | Ga0495672_0000557 | 3300047320 | Bacteria | 42365 |
| 574 | Ga0495672_0000771 | 3300047320 | Bacteria | 34831 |
| 575 | Ga0495672_0005240 | 3300047320 | Bacteria | 10330 |
| 576 | Ga0495672_0006405 | 3300047320 | Bacteria | 9135 |
| 577 | Ga0495672_0036338 | 3300047320 | Bacteria | 3026 |
| 578 | Ga0495676_0000084 | 3300047321 | Bacteria | 68514 |
| 579 | Ga0495676_0031692 | 3300047321 | Bacteria | 4466 |
| 580 | Ga0495676_0041437 | 3300047321 | Bacteria | 3790 |
| 581 | Ga0495680_0011851 | 3300047322 | Bacteria | 7695 |
| 582 | Ga0495683_0000293 | 3300047323 | Bacteria | 43121 |
| 583 | Ga0495683_0000853 | 3300047323 | Bacteria | 21599 |
| 584 | Ga0495683_0003728 | 3300047323 | Bacteria | 8817 |
| 585 | Ga0495683_0036871 | 3300047323 | Bacteria | 2480 |
| 586 | Ga0495683_0055048 | 3300047323 | Bacteria | 1981 |
| 587 | Ga0495687_000274 | 3300047443 | Bacteria | 68218 |
| 588 | Ga0495687_000306 | 3300047443 | Bacteria | 64641 |
| 589 | Ga0495687_000666 | 3300047443 | Bacteria | 39241 |
| 590 | Ga0495687_000677 | 3300047443 | Bacteria | 38715 |
| 591 | Ga0495687_000710 | 3300047443 | Bacteria | 36977 |
| 592 | Ga0495687_057267 | 3300047443 | Bacteria | 1621 |
| 593 | Ga0495675_0000965 | 3300047444 | Bacteria | 17473 |
| 594 | Ga0495677_0000335 | 3300047445 | Bacteria | 20261 |
| 595 | Ga0495677_0001846 | 3300047445 | Bacteria | 8465 |
| 596 | Ga0495677_0003809 | 3300047445 | Bacteria | 5834 |
| 597 | Ga0495677_0011700 | 3300047445 | Bacteria | 3207 |
| 598 | Ga0495677_0012507 | 3300047445 | Bacteria | 3094 |
| 599 | Ga0495677_0015759 | 3300047445 | Bacteria | 2744 |
| 600 | Ga0495677_0038816 | 3300047445 | Bacteria | 1740 |
| 601 | Ga0495677_0043034 | 3300047445 | Bacteria | 1655 |
| 602 | Ga0495677_0063800 | 3300047445 | Bacteria | 1368 |
| 603 | Ga0495677_0107977 | 3300047445 | Bacteria | 1056 |
| 604 | Ga0495679_001821 | 3300047446 | Bacteria | 11567 |
| 605 | Ga0495679_007612 | 3300047446 | Bacteria | 4498 |
| 606 | Ga0495679_016717 | 3300047446 | Bacteria | 2647 |
| 607 | Ga0495679_027617 | 3300047446 | Bacteria | 1869 |
| 608 | Ga0495679_029895 | 3300047446 | Bacteria | 1773 |
| 609 | Ga0495685_000014 | 3300047447 | Bacteria | 77520 |
| 610 | Ga0495685_010885 | 3300047447 | Bacteria | 3057 |
| 611 | Ga0495685_018612 | 3300047447 | Bacteria | 2384 |
| 612 | Ga0495685_033554 | 3300047447 | Bacteria | 1763 |
| 613 | Ga0495685_043184 | 3300047447 | Bacteria | 1538 |
| 614 | Ga0495673_0003321 | 3300047469 | Bacteria | 10668 |
| 615 | Ga0495673_0012427 | 3300047469 | Bacteria | 4516 |
| 616 | Ga0495681_0000147 | 3300047470 | Bacteria | 59493 |
| 617 | Ga0495681_0000260 | 3300047470 | Bacteria | 43076 |
| 618 | Ga0495681_0002009 | 3300047470 | Bacteria | 14874 |
| 619 | Ga0495681_0012016 | 3300047470 | Bacteria | 5111 |
| 620 | Ga0495681_0017096 | 3300047470 | Bacteria | 4040 |
| 621 | Ga0495681_0035679 | 3300047470 | Bacteria | 2467 |
| 622 | Ga0495681_0040690 | 3300047470 | Bacteria | 2261 |
| 623 | Ga0495686_0004325 | 3300047472 | Bacteria | 11741 |
| 624 | Ga0495686_0005772 | 3300047472 | Bacteria | 9668 |
| 625 | Ga0495686_0005849 | 3300047472 | Bacteria | 9589 |
| 626 | Ga0495686_0014823 | 3300047472 | Bacteria | 5354 |
| 627 | Ga0495686_0015905 | 3300047472 | Bacteria | 5116 |
| 628 | Ga0495686_0051227 | 3300047472 | Bacteria | 2591 |
| 629 | Ga0495686_0116848 | 3300047472 | Bacteria | 1594 |
| 630 | Ga0495593_0017028 | 3300047673 | Bacteria | 4091 |
| 631 | Ga0495593_0034941 | 3300047673 | Bacteria | 2731 |
| 632 | Ga0495593_0116752 | 3300047673 | Bacteria | 1359 |
| 633 | Ga0495602_0047551 | 3300048088 | Bacteria | 3865 |
| 634 | Ga0495614_0001003 | 3300048089 | Bacteria | 12041 |
| 635 | Ga0495614_0002147 | 3300048089 | Bacteria | 8732 |
| 636 | Ga0495626_0003144 | 3300048091 | Bacteria | 10805 |
| 637 | Ga0495626_0004662 | 3300048091 | Bacteria | 8324 |
| 638 | Ga0495626_0005832 | 3300048091 | Bacteria | 7105 |
| 639 | Ga0495626_0007478 | 3300048091 | Bacteria | 6078 |
| 640 | Ga0495626_0008966 | 3300048091 | Bacteria | 5429 |
| 641 | Ga0495626_0011597 | 3300048091 | Bacteria | 4657 |
| 642 | Ga0495626_0014126 | 3300048091 | Bacteria | 4130 |
| 643 | Ga0495626_0027651 | 3300048091 | Bacteria | 2756 |
| 644 | Ga0495626_0029826 | 3300048091 | Bacteria | 2635 |
| 645 | Ga0495626_0051113 | 3300048091 | Bacteria | 1907 |
| 646 | Ga0495626_0077340 | 3300048091 | Bacteria | 1483 |
| 647 | Ga0496100_0061979 | 3300048903 | Bacteria | 2466 |
| 648 | Ga0496101_0136408 | 3300048904 | Bacteria | 1867 |
| 649 | Ga0496102_0000300 | 3300048905 | Bacteria | 63230 |
| 650 | Ga0496103_0008742 | 3300048906 | Bacteria | 6008 |
| 651 | Ga0496103_0042535 | 3300048906 | Bacteria | 2796 |
| 652 | Ga0496103_0163703 | 3300048906 | Bacteria | 1427 |
| 653 | Ga0496106_0018136 | 3300048909 | Bacteria | 5205 |
| 654 | Ga0496106_0434297 | 3300048909 | Bacteria | 1055 |
| 655 | Ga0496107_0021505 | 3300048910 | Bacteria | 4559 |
| 656 | Ga0496108_0431465 | 3300048911 | Bacteria | 1151 |
| 657 | Ga0496108_0463177 | 3300048911 | Bacteria | 1107 |
| 658 | Ga0496109_0201291 | 3300048912 | Bacteria | 1872 |
| 659 | Ga0496110_0000186 | 3300048913 | Bacteria | 39023 |
| 660 | Ga0496110_0726503 | 3300048913 | Bacteria | 895 |
| 661 | Ga0496111_0024155 | 3300048914 | Bacteria | 4277 |
| 662 | Ga0496113_0011652 | 3300048916 | Bacteria | 5880 |
| 663 | Ga0496115_0032132 | 3300048918 | Bacteria | 4140 |
| 664 | Ga0496115_0082588 | 3300048918 | Bacteria | 2618 |
| 665 | Ga0496115_0104805 | 3300048918 | Bacteria | 2321 |
| 666 | Ga0496115_0324216 | 3300048918 | Bacteria | 1259 |
| 667 | Ga0496116_0016950 | 3300048919 | Bacteria | 5679 |
| 668 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 669 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 670 | Ga0496121_0010997 | 3300048924 | Bacteria | 10102 |
| 671 | Ga0496121_0016538 | 3300048924 | Bacteria | 7609 |
| 672 | Ga0496121_0348423 | 3300048924 | Bacteria | 987 |
| 673 | Ga0496122_0000628 | 3300048925 | Bacteria | 71974 |
| 674 | Ga0496122_0002807 | 3300048925 | Bacteria | 23886 |
| 675 | Ga0496123_0000537 | 3300048926 | Bacteria | 65355 |
| 676 | Ga0496123_0001409 | 3300048926 | Bacteria | 33622 |
| 677 | Ga0496124_0031761 | 3300048927 | Bacteria | 4671 |
| 678 | Ga0496124_0115964 | 3300048927 | Bacteria | 2148 |
| 679 | Ga0496124_0240913 | 3300048927 | Bacteria | 1345 |
| 680 | Ga0496125_0000674 | 3300048928 | Bacteria | 56950 |
| 681 | Ga0496125_0020221 | 3300048928 | Bacteria | 6254 |
| 682 | Ga0495678_000181 | 3300049459 | Bacteria | 72694 |
| 683 | Ga0495678_000195 | 3300049459 | Bacteria | 71179 |
| 684 | Ga0495678_000262 | 3300049459 | Bacteria | 58570 |
| 685 | Ga0495678_000491 | 3300049459 | Bacteria | 39051 |
| 686 | Ga0495678_003500 | 3300049459 | Bacteria | 9660 |
| 687 | Ga0495678_012244 | 3300049459 | Bacteria | 4072 |
| 688 | Ga0495678_029752 | 3300049459 | Bacteria | 2291 |
| 689 | Ga0495678_043015 | 3300049459 | Bacteria | 1797 |
| 690 | Ga0495682_0000121 | 3300049460 | Bacteria | 68179 |
| 691 | Ga0495682_0000195 | 3300049460 | Bacteria | 48762 |
| 692 | Ga0495682_0000306 | 3300049460 | Bacteria | 36976 |
| 693 | Ga0495682_0000782 | 3300049460 | Bacteria | 20155 |
| 694 | Ga0495682_0010739 | 3300049460 | Bacteria | 3536 |
| 695 | nmdc:mga03683_135658_c1 | 3300050489 | Bacteria | 1104 |
| 696 | nmdc:mga03683_64020_c1 | 3300050489 | Bacteria | 1559 |
| 697 | nmdc:mga03n38_197802_c1 | 3300050490 | Bacteria | 1039 |
| 698 | nmdc:mga00v17_71093_c1 | 3300050491 | Bacteria | 2157 |
| 699 | nmdc:mga0k408_138114_c1 | 3300050493 | Bacteria | 1449 |
| 700 | nmdc:mga0k408_32983_c1 | 3300050493 | Bacteria | 2959 |
| 701 | nmdc:mga0k408_72121_c1 | 3300050493 | Bacteria | 2016 |
| 702 | nmdc:mga07m45_82887_c1 | 3300050496 | Bacteria | 1832 |
| 703 | nmdc:mga0sz30_27928_c1 | 3300050516 | Bacteria | 2320 |
| 704 | Ga0500644_0064032 | 3300053088 | Bacteria | 1305 |
| 705 | Ga0500646_0011557 | 3300053090 | Bacteria | 2272 |
| 706 | Ga0500583_0004651 | 3300053092 | Bacteria | 4505 |
| 707 | Ga0500637_0042673 | 3300053178 | Bacteria | 2565 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300033179 | Ga0307507_10180068 | Ga0307507_101800681 | 232 |
| 2 | 3300003323 | rootH1_10281587 | rootH1_102815871 | 233 |
| 3 | 3300046500 | Ga0495596_0000286 | Ga0495596_0000286_7457_8317 | 236 |
| 4 | 3300046501 | Ga0495607_0071431 | Ga0495607_0071431_833_1693 | 236 |
| 5 | 3300046558 | Ga0495633_0050694 | Ga0495633_0050694_187_1047 | 236 |
| 6 | 3300046665 | Ga0495661_0183407 | Ga0495661_0183407_47_907 | 237 |
| 7 | 3300046684 | Ga0495669_0002027 | Ga0495669_0002027_7363_8223 | 237 |
| 8 | 3300046691 | Ga0495670_0008286 | Ga0495670_0008286_1556_2416 | 237 |
| 9 | iso_pu_bacteria | 2885080285 | 2885085125 | 238 |
| 10 | 3300005293 | Ga0065715_10136858 | Ga0065715_101368582 | 239 |
| 11 | 3300014497 | Ga0182008_10000303 | Ga0182008_1000030323 | 239 |
| 12 | 3300015261 | Ga0182006_1000004 | Ga0182006_1000004205 | 239 |
| 13 | 3300015262 | Ga0182007_10000018 | Ga0182007_10000018166 | 239 |
| 14 | 3300015265 | Ga0182005_1000011 | Ga0182005_1000011176 | 239 |
| 15 | 3300031911 | Ga0307412_10516676 | Ga0307412_105166761 | 239 |
| 16 | 3300046506 | Ga0495583_0163038 | Ga0495583_0163038_20_892 | 239 |
| 17 | 3300046809 | Ga0495600_0304443 | Ga0495600_0304443_31_846 | 239 |
| 18 | 3300047315 | Ga0495581_0023057 | Ga0495581_0023057_2018_2872 | 239 |
| 19 | 3300047318 | Ga0495636_0005679 | Ga0495636_0005679_1366_2223 | 239 |
| 20 | 3300047318 | Ga0495636_0034699 | Ga0495636_0034699_687_1544 | 239 |
| 21 | 3300048905 | Ga0496102_0000300 | Ga0496102_0000300_25686_26588 | 239 |
| 22 | 3300048919 | Ga0496116_0016950 | Ga0496116_0016950_1997_2809 | 239 |
| 23 | 3300048920 | Ga0496117_0000011 | Ga0496117_0000011_247520_248332 | 239 |
| 24 | 3300048921 | Ga0496118_0000010 | Ga0496118_0000010_362599_363411 | 239 |
| 25 | 3300048924 | Ga0496121_0016538 | Ga0496121_0016538_1462_2274 | 239 |
| 26 | 3300048925 | Ga0496122_0002807 | Ga0496122_0002807_7490_8302 | 239 |
| 27 | 3300048926 | Ga0496123_0001409 | Ga0496123_0001409_20447_21259 | 239 |
| 28 | 3300048927 | Ga0496124_0115964 | Ga0496124_0115964_663_1475 | 239 |
| 29 | 3300035114 | Ga0373939_0000097 | Ga0373939_0000097_9027_9878 | 240 |
| 30 | 3300035691 | Ga0373931_0000147 | Ga0373931_0000147_10226_11077 | 240 |
| 31 | 3300046528 | Ga0495642_0052474 | Ga0495642_0052474_809_1663 | 240 |
| 32 | 3300046616 | Ga0495668_0002059 | Ga0495668_0002059_5040_5936 | 240 |
| 33 | 3300047470 | Ga0495681_0035679 | Ga0495681_0035679_17_838 | 240 |
| 34 | 3300048913 | Ga0496110_0726503 | Ga0496110_0726503_37_879 | 240 |
| 35 | 3300046501 | Ga0495607_0015607 | Ga0495607_0015607_3284_4192 | 241 |
| 36 | 3300003763 | Ga0055529_1000032 | Ga0055529_1000032131 | 242 |
| 37 | 3300005262 | Ga0065165_1004849 | Ga0065165_10048495 | 242 |
| 38 | 3300025272 | Ga0209455_1000043 | Ga0209455_1000043222 | 242 |
| 39 | 3300030521 | Ga0307511_10000574 | Ga0307511_1000057410 | 242 |
| 40 | 3300046492 | Ga0495585_0010267 | Ga0495585_0010267_1245_2006 | 242 |
| 41 | 3300046558 | Ga0495633_0002132 | Ga0495633_0002132_10512_11273 | 242 |
| 42 | 3300046665 | Ga0495661_0000559 | Ga0495661_0000559_7381_8274 | 242 |
| 43 | 3300046665 | Ga0495661_0033199 | Ga0495661_0033199_1116_1877 | 242 |
| 44 | 3300046691 | Ga0495670_0045816 | Ga0495670_0045816_671_1432 | 242 |
| 45 | 3300046694 | Ga0495649_0019677 | Ga0495649_0019677_2167_3057 | 242 |
| 46 | 3300047320 | Ga0495672_0006405 | Ga0495672_0006405_8357_9118 | 242 |
| 47 | 3300047445 | Ga0495677_0003809 | Ga0495677_0003809_15_776 | 242 |
| 48 | 3300048904 | Ga0496101_0136408 | Ga0496101_0136408_937_1830 | 242 |
| 49 | 3300053088 | Ga0500644_0064032 | Ga0500644_0064032_370_1212 | 242 |
| 50 | 3300053090 | Ga0500646_0011557 | Ga0500646_0011557_674_1516 | 242 |
| 51 | 3300046500 | Ga0495596_0019401 | Ga0495596_0019401_1508_2410 | 243 |
| 52 | 3300046500 | Ga0495596_0024009 | Ga0495596_0024009_304_1155 | 243 |
| 53 | 3300046518 | Ga0495631_0046494 | Ga0495631_0046494_368_1270 | 243 |
| 54 | 3300046524 | Ga0495648_0000622 | Ga0495648_0000622_10468_11319 | 243 |
| 55 | 3300046528 | Ga0495642_0000102 | Ga0495642_0000102_34514_35416 | 243 |
| 56 | 3300046615 | Ga0495656_0002423 | Ga0495656_0002423_3285_4187 | 243 |
| 57 | 3300046665 | Ga0495661_0007629 | Ga0495661_0007629_1254_2156 | 243 |
| 58 | 3300046794 | Ga0495589_0173785 | Ga0495589_0173785_53_904 | 243 |
| 59 | 3300048903 | Ga0496100_0061979 | Ga0496100_0061979_1379_2272 | 243 |
| 60 | 3300048911 | Ga0496108_0431465 | Ga0496108_0431465_128_1021 | 243 |
| 61 | 3300048916 | Ga0496113_0011652 | Ga0496113_0011652_4013_4906 | 243 |
| 62 | 3300048925 | Ga0496122_0000628 | Ga0496122_0000628_30263_31156 | 243 |
| 63 | 3300048926 | Ga0496123_0000537 | Ga0496123_0000537_34306_35199 | 243 |
| 64 | 3300048928 | Ga0496125_0000674 | Ga0496125_0000674_15022_15915 | 243 |
| 65 | 3300031456 | Ga0307513_10006896 | Ga0307513_100068962 | 244 |
| 66 | 3300046558 | Ga0495633_0002575 | Ga0495633_0002575_287_1147 | 244 |
| 67 | 3300046665 | Ga0495661_0017689 | Ga0495661_0017689_887_1747 | 244 |
| 68 | 3300046691 | Ga0495670_0019955 | Ga0495670_0019955_1678_2538 | 244 |
| 69 | 3300003316 | rootH1_10027638 | rootH1_100276385 | 245 |
| 70 | 3300046457 | Ga0495590_0000069 | Ga0495590_0000069_40425_41315 | 245 |
| 71 | 3300046458 | Ga0495591_000370 | Ga0495591_000370_32281_33171 | 245 |
| 72 | 3300046491 | Ga0495584_0000165 | Ga0495584_0000165_40567_41457 | 245 |
| 73 | 3300046492 | Ga0495585_0052330 | Ga0495585_0052330_773_1663 | 245 |
| 74 | 3300046501 | Ga0495607_0011159 | Ga0495607_0011159_3042_3932 | 245 |
| 75 | 3300046506 | Ga0495583_0001741 | Ga0495583_0001741_12178_13068 | 245 |
| 76 | 3300046507 | Ga0495606_0104565 | Ga0495606_0104565_445_1335 | 245 |
| 77 | 3300046512 | Ga0495610_0000448 | Ga0495610_0000448_17127_18017 | 245 |
| 78 | 3300046518 | Ga0495631_0001392 | Ga0495631_0001392_3886_4776 | 245 |
| 79 | 3300046520 | Ga0495637_0000095 | Ga0495637_0000095_32000_32890 | 245 |
| 80 | 3300046523 | Ga0495644_0003309 | Ga0495644_0003309_559_1449 | 245 |
| 81 | 3300046524 | Ga0495648_0132844 | Ga0495648_0132844_317_1207 | 245 |
| 82 | 3300046528 | Ga0495642_0001408 | Ga0495642_0001408_4644_5534 | 245 |
| 83 | 3300046542 | Ga0495597_0000318 | Ga0495597_0000318_3615_4514 | 245 |
| 84 | 3300046542 | Ga0495597_0079024 | Ga0495597_0079024_359_1249 | 245 |
| 85 | 3300046558 | Ga0495633_0006230 | Ga0495633_0006230_622_1512 | 245 |
| 86 | 3300046616 | Ga0495668_0030062 | Ga0495668_0030062_1353_2243 | 245 |
| 87 | 3300046648 | Ga0495611_0000173 | Ga0495611_0000173_40590_41480 | 245 |
| 88 | 3300046684 | Ga0495669_0002782 | Ga0495669_0002782_1134_2024 | 245 |
| 89 | 3300046694 | Ga0495649_0000433 | Ga0495649_0000433_5396_6286 | 245 |
| 90 | 3300046794 | Ga0495589_0047043 | Ga0495589_0047043_851_1741 | 245 |
| 91 | 3300046810 | Ga0495660_0029176 | Ga0495660_0029176_1817_2707 | 245 |
| 92 | 3300047320 | Ga0495672_0000557 | Ga0495672_0000557_32325_33215 | 245 |
| 93 | 3300047321 | Ga0495676_0041437 | Ga0495676_0041437_11_844 | 245 |
| 94 | 3300047323 | Ga0495683_0000853 | Ga0495683_0000853_14157_15047 | 245 |
| 95 | 3300047445 | Ga0495677_0001846 | Ga0495677_0001846_6870_7760 | 245 |
| 96 | 3300047446 | Ga0495679_016717 | Ga0495679_016717_473_1363 | 245 |
| 97 | 3300047447 | Ga0495685_010885 | Ga0495685_010885_953_1843 | 245 |
| 98 | 3300047472 | Ga0495686_0014823 | Ga0495686_0014823_2500_3390 | 245 |
| 99 | 3300048091 | Ga0495626_0004662 | Ga0495626_0004662_4046_4936 | 245 |
| 100 | 3300049459 | Ga0495678_000195 | Ga0495678_000195_30029_30919 | 245 |
| 101 | 3300046452 | Ga0495617_000087 | Ga0495617_000087_25940_26848 | 246 |
| 102 | 3300046474 | Ga0495605_0000238 | Ga0495605_0000238_39706_40614 | 246 |
| 103 | 3300046492 | Ga0495585_0001261 | Ga0495585_0001261_11038_11946 | 246 |
| 104 | 3300046522 | Ga0495643_0000099 | Ga0495643_0000099_48696_49535 | 246 |
| 105 | 3300046524 | Ga0495648_0000540 | Ga0495648_0000540_12764_13672 | 246 |
| 106 | 3300046616 | Ga0495668_0002934 | Ga0495668_0002934_11497_12405 | 246 |
| 107 | 3300046648 | Ga0495611_0015931 | Ga0495611_0015931_1665_2573 | 246 |
| 108 | 3300046660 | Ga0495625_0026549 | Ga0495625_0026549_1665_2522 | 246 |
| 109 | 3300046794 | Ga0495589_0006370 | Ga0495589_0006370_1380_2288 | 246 |
| 110 | 3300047320 | Ga0495672_0000277 | Ga0495672_0000277_36619_37458 | 246 |
| 111 | 3300047445 | Ga0495677_0043034 | Ga0495677_0043034_382_1221 | 246 |
| 112 | 3300047472 | Ga0495686_0051227 | Ga0495686_0051227_1130_2038 | 246 |
| 113 | 3300049459 | Ga0495678_000262 | Ga0495678_000262_10800_11639 | 246 |
| 114 | 3300046557 | Ga0495622_0177392 | Ga0495622_0177392_13_792 | 247 |
| 115 | 3300003759 | Ga0055525_1000038 | Ga0055525_1000038189 | 248 |
| 116 | 3300007788 | Ga0099795_10080417 | Ga0099795_100804172 | 248 |
| 117 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051082 | 248 |
| 118 | 3300031250 | Ga0265331_10003107 | Ga0265331_100031076 | 248 |
| 119 | 3300031251 | Ga0265327_10000083 | Ga0265327_10000083155 | 248 |
| 120 | 3300046557 | Ga0495622_0038292 | Ga0495622_0038292_481_1320 | 248 |
| 121 | 3300046558 | Ga0495633_0000455 | Ga0495633_0000455_26160_26999 | 248 |
| 122 | 3300048924 | Ga0496121_0010997 | Ga0496121_0010997_3454_4293 | 248 |
| 123 | 3300049460 | Ga0495682_0000782 | Ga0495682_0000782_19221_20060 | 248 |
| 124 | 3300003323 | rootH1_10028606 | rootH1_100286063 | 249 |
| 125 | 3300028794 | Ga0307515_10205931 | Ga0307515_102059311 | 249 |
| 126 | 3300046512 | Ga0495610_0068082 | Ga0495610_0068082_226_1095 | 249 |
| 127 | 3300046524 | Ga0495648_0025668 | Ga0495648_0025668_318_1229 | 249 |
| 128 | 3300047445 | Ga0495677_0038816 | Ga0495677_0038816_369_1280 | 249 |
| 129 | 3300005843 | Ga0068860_100286754 | Ga0068860_1002867542 | 250 |
| 130 | 3300046519 | Ga0495632_0004211 | Ga0495632_0004211_2438_3340 | 250 |
| 131 | 3300046694 | Ga0495649_0001256 | Ga0495649_0001256_413_1315 | 250 |
| 132 | 3300047320 | Ga0495672_0036338 | Ga0495672_0036338_145_1047 | 250 |
| 133 | 3300048091 | Ga0495626_0003144 | Ga0495626_0003144_8450_9352 | 250 |
| 134 | iso_pu_bacteria | 2842711865 | 2842715653 | 250 |
| 135 | 3300006195 | Ga0075366_10013595 | Ga0075366_100135952 | 251 |
| 136 | 3300046522 | Ga0495643_0090542 | Ga0495643_0090542_156_1067 | 251 |
| 137 | 3300047443 | Ga0495687_000274 | Ga0495687_000274_24544_25455 | 251 |
| 138 | 3300050493 | nmdc:mga0k408_138114_c1 | nmdc:mga0k408_138114_c1_279_1205 | 251 |
| 139 | 3300021361 | Ga0213872_10005914 | Ga0213872_100059145 | 252 |
| 140 | 3300039447 | Ga0436361_0420166 | Ga0436361_0420166_284_1138 | 252 |
| 141 | 3300046474 | Ga0495605_0023450 | Ga0495605_0023450_458_1360 | 252 |
| 142 | 3300046500 | Ga0495596_0009669 | Ga0495596_0009669_952_1851 | 252 |
| 143 | 3300046501 | Ga0495607_0009178 | Ga0495607_0009178_3387_4370 | 252 |
| 144 | 3300046506 | Ga0495583_0000336 | Ga0495583_0000336_9389_10243 | 252 |
| 145 | 3300046506 | Ga0495583_0000340 | Ga0495583_0000340_33614_34597 | 252 |
| 146 | 3300046506 | Ga0495583_0118455 | Ga0495583_0118455_97_954 | 252 |
| 147 | 3300046507 | Ga0495606_0063133 | Ga0495606_0063133_727_1584 | 252 |
| 148 | 3300046507 | Ga0495606_0175792 | Ga0495606_0175792_183_1040 | 252 |
| 149 | 3300046513 | Ga0495616_0072604 | Ga0495616_0072604_259_1161 | 252 |
| 150 | 3300046515 | Ga0495620_0053584 | Ga0495620_0053584_624_1481 | 252 |
| 151 | 3300046518 | Ga0495631_0029718 | Ga0495631_0029718_488_1345 | 252 |
| 152 | 3300046528 | Ga0495642_0000540 | Ga0495642_0000540_13705_14562 | 252 |
| 153 | 3300046528 | Ga0495642_0030408 | Ga0495642_0030408_626_1525 | 252 |
| 154 | 3300046558 | Ga0495633_0130375 | Ga0495633_0130375_53_910 | 252 |
| 155 | 3300046648 | Ga0495611_0013911 | Ga0495611_0013911_1120_2022 | 252 |
| 156 | 3300046665 | Ga0495661_0066202 | Ga0495661_0066202_970_1866 | 252 |
| 157 | 3300046694 | Ga0495649_0104600 | Ga0495649_0104600_444_1346 | 252 |
| 158 | 3300046810 | Ga0495660_0185110 | Ga0495660_0185110_30_932 | 252 |
| 159 | 3300047446 | Ga0495679_001821 | Ga0495679_001821_4610_5512 | 252 |
| 160 | 3300047673 | Ga0495593_0116752 | Ga0495593_0116752_273_1127 | 252 |
| 161 | 3300048091 | Ga0495626_0011597 | Ga0495626_0011597_1655_2542 | 252 |
| 162 | 3300048906 | Ga0496103_0008742 | Ga0496103_0008742_770_1639 | 252 |
| 163 | iso_pu_bacteria | 2600255292 | 2601669373 | 252 |
| 164 | iso_pu_bacteria | 2857547612 | 2857549492 | 252 |
| 165 | iso_pu_bacteria | 2932410948 | 2932414643 | 252 |
| 166 | iso_pu_bacteria | 2932416698 | 2932420837 | 252 |
| 167 | 3300003771 | Ga0055526_1000951 | Ga0055526_10009512 | 253 |
| 168 | 3300003773 | Ga0055537_1000030 | Ga0055537_100003060 | 253 |
| 169 | 3300003775 | Ga0055524_1012479 | Ga0055524_10124792 | 253 |
| 170 | 3300003784 | Ga0055534_1000203 | Ga0055534_100020326 | 253 |
| 171 | 3300003790 | Ga0055528_1000439 | Ga0055528_100043931 | 253 |
| 172 | 3300006195 | Ga0075366_10043139 | Ga0075366_100431392 | 253 |
| 173 | 3300006195 | Ga0075366_10043223 | Ga0075366_100432233 | 253 |
| 174 | 3300025263 | Ga0209565_1000017 | Ga0209565_100001746 | 253 |
| 175 | 3300025273 | Ga0209673_1000007 | Ga0209673_1000007383 | 253 |
| 176 | 3300025291 | Ga0209675_1000009 | Ga0209675_1000009135 | 253 |
| 177 | 3300025295 | Ga0209564_1000055 | Ga0209564_100005570 | 253 |
| 178 | 3300025299 | Ga0209256_1000559 | Ga0209256_100055910 | 253 |
| 179 | 3300044658 | Ga0466972_0026272 | Ga0466972_0026272_1987_2835 | 253 |
| 180 | 3300044683 | Ga0466965_0042023 | Ga0466965_0042023_140_988 | 253 |
| 181 | 3300044706 | Ga0466964_0008294 | Ga0466964_0008294_2448_3296 | 253 |
| 182 | 3300046455 | Ga0495603_0025372 | Ga0495603_0025372_1679_2536 | 253 |
| 183 | 3300046457 | Ga0495590_0013494 | Ga0495590_0013494_2130_2990 | 253 |
| 184 | 3300046459 | Ga0495629_0035370 | Ga0495629_0035370_2571_3473 | 253 |
| 185 | 3300046460 | Ga0495638_0031645 | Ga0495638_0031645_1275_2135 | 253 |
| 186 | 3300046460 | Ga0495638_0203808 | Ga0495638_0203808_203_1000 | 253 |
| 187 | 3300046463 | Ga0495653_0031373 | Ga0495653_0031373_1898_2800 | 253 |
| 188 | 3300046474 | Ga0495605_0032973 | Ga0495605_0032973_18_878 | 253 |
| 189 | 3300046474 | Ga0495605_0079681 | Ga0495605_0079681_266_1123 | 253 |
| 190 | 3300046491 | Ga0495584_0001012 | Ga0495584_0001012_10526_11386 | 253 |
| 191 | 3300046491 | Ga0495584_0012480 | Ga0495584_0012480_3013_3915 | 253 |
| 192 | 3300046491 | Ga0495584_0035410 | Ga0495584_0035410_114_971 | 253 |
| 193 | 3300046491 | Ga0495584_0052214 | Ga0495584_0052214_1134_1994 | 253 |
| 194 | 3300046491 | Ga0495584_0065504 | Ga0495584_0065504_597_1454 | 253 |
| 195 | 3300046492 | Ga0495585_0000114 | Ga0495585_0000114_43211_44071 | 253 |
| 196 | 3300046492 | Ga0495585_0000249 | Ga0495585_0000249_14395_15252 | 253 |
| 197 | 3300046492 | Ga0495585_0001056 | Ga0495585_0001056_9912_10772 | 253 |
| 198 | 3300046492 | Ga0495585_0012749 | Ga0495585_0012749_3904_4764 | 253 |
| 199 | 3300046492 | Ga0495585_0016207 | Ga0495585_0016207_2526_3386 | 253 |
| 200 | 3300046492 | Ga0495585_0018643 | Ga0495585_0018643_2374_3276 | 253 |
| 201 | 3300046492 | Ga0495585_0025681 | Ga0495585_0025681_271_1128 | 253 |
| 202 | 3300046492 | Ga0495585_0031175 | Ga0495585_0031175_1978_2835 | 253 |
| 203 | 3300046492 | Ga0495585_0211257 | Ga0495585_0211257_47_904 | 253 |
| 204 | 3300046499 | Ga0495594_0011150 | Ga0495594_0011150_3103_3960 | 253 |
| 205 | 3300046499 | Ga0495594_0138748 | Ga0495594_0138748_396_1253 | 253 |
| 206 | 3300046500 | Ga0495596_0004823 | Ga0495596_0004823_2511_3368 | 253 |
| 207 | 3300046500 | Ga0495596_0025834 | Ga0495596_0025834_1399_2301 | 253 |
| 208 | 3300046501 | Ga0495607_0024614 | Ga0495607_0024614_1719_2579 | 253 |
| 209 | 3300046501 | Ga0495607_0073431 | Ga0495607_0073431_1010_1807 | 253 |
| 210 | 3300046506 | Ga0495583_0000272 | Ga0495583_0000272_40938_41798 | 253 |
| 211 | 3300046506 | Ga0495583_0025925 | Ga0495583_0025925_1976_2773 | 253 |
| 212 | 3300046506 | Ga0495583_0055718 | Ga0495583_0055718_134_994 | 253 |
| 213 | 3300046507 | Ga0495606_0027198 | Ga0495606_0027198_692_1552 | 253 |
| 214 | 3300046512 | Ga0495610_0089803 | Ga0495610_0089803_481_1338 | 253 |
| 215 | 3300046513 | Ga0495616_0002876 | Ga0495616_0002876_8889_9749 | 253 |
| 216 | 3300046513 | Ga0495616_0003165 | Ga0495616_0003165_1120_1980 | 253 |
| 217 | 3300046513 | Ga0495616_0118751 | Ga0495616_0118751_26_883 | 253 |
| 218 | 3300046518 | Ga0495631_0009828 | Ga0495631_0009828_1517_2419 | 253 |
| 219 | 3300046518 | Ga0495631_0015726 | Ga0495631_0015726_808_1668 | 253 |
| 220 | 3300046518 | Ga0495631_0022866 | Ga0495631_0022866_1300_2157 | 253 |
| 221 | 3300046518 | Ga0495631_0024806 | Ga0495631_0024806_701_1558 | 253 |
| 222 | 3300046518 | Ga0495631_0025266 | Ga0495631_0025266_1669_2526 | 253 |
| 223 | 3300046519 | Ga0495632_0022255 | Ga0495632_0022255_1979_2839 | 253 |
| 224 | 3300046523 | Ga0495644_0016030 | Ga0495644_0016030_1049_1909 | 253 |
| 225 | 3300046523 | Ga0495644_0025877 | Ga0495644_0025877_787_1647 | 253 |
| 226 | 3300046523 | Ga0495644_0028194 | Ga0495644_0028194_456_1316 | 253 |
| 227 | 3300046524 | Ga0495648_0000174 | Ga0495648_0000174_26683_27543 | 253 |
| 228 | 3300046525 | Ga0495663_0005750 | Ga0495663_0005750_1061_1921 | 253 |
| 229 | 3300046528 | Ga0495642_0002114 | Ga0495642_0002114_1728_2585 | 253 |
| 230 | 3300046528 | Ga0495642_0011415 | Ga0495642_0011415_862_1722 | 253 |
| 231 | 3300046528 | Ga0495642_0013070 | Ga0495642_0013070_1847_2704 | 253 |
| 232 | 3300046528 | Ga0495642_0015048 | Ga0495642_0015048_1638_2498 | 253 |
| 233 | 3300046535 | Ga0495586_0000564 | Ga0495586_0000564_11094_11996 | 253 |
| 234 | 3300046536 | Ga0495587_0045980 | Ga0495587_0045980_1661_2518 | 253 |
| 235 | 3300046538 | Ga0495609_0000992 | Ga0495609_0000992_18777_19574 | 253 |
| 236 | 3300046538 | Ga0495609_0003858 | Ga0495609_0003858_5232_6089 | 253 |
| 237 | 3300046538 | Ga0495609_0009226 | Ga0495609_0009226_2393_3253 | 253 |
| 238 | 3300046538 | Ga0495609_0012527 | Ga0495609_0012527_1177_2037 | 253 |
| 239 | 3300046538 | Ga0495609_0123099 | Ga0495609_0123099_78_938 | 253 |
| 240 | 3300046542 | Ga0495597_0001246 | Ga0495597_0001246_17686_18543 | 253 |
| 241 | 3300046542 | Ga0495597_0004715 | Ga0495597_0004715_3364_4221 | 253 |
| 242 | 3300046542 | Ga0495597_0009704 | Ga0495597_0009704_2877_3734 | 253 |
| 243 | 3300046557 | Ga0495622_0025512 | Ga0495622_0025512_1812_2669 | 253 |
| 244 | 3300046558 | Ga0495633_0002398 | Ga0495633_0002398_10514_11374 | 253 |
| 245 | 3300046558 | Ga0495633_0003155 | Ga0495633_0003155_1114_2016 | 253 |
| 246 | 3300046558 | Ga0495633_0005792 | Ga0495633_0005792_6535_7395 | 253 |
| 247 | 3300046558 | Ga0495633_0013639 | Ga0495633_0013639_1915_2775 | 253 |
| 248 | 3300046558 | Ga0495633_0092913 | Ga0495633_0092913_276_1136 | 253 |
| 249 | 3300046558 | Ga0495633_0110648 | Ga0495633_0110648_19_876 | 253 |
| 250 | 3300046616 | Ga0495668_0005606 | Ga0495668_0005606_5085_5945 | 253 |
| 251 | 3300046616 | Ga0495668_0008722 | Ga0495668_0008722_4388_5245 | 253 |
| 252 | 3300046616 | Ga0495668_0023122 | Ga0495668_0023122_1105_1965 | 253 |
| 253 | 3300046616 | Ga0495668_0023903 | Ga0495668_0023903_2002_2862 | 253 |
| 254 | 3300046616 | Ga0495668_0030333 | Ga0495668_0030333_1952_2749 | 253 |
| 255 | 3300046616 | Ga0495668_0045168 | Ga0495668_0045168_214_1116 | 253 |
| 256 | 3300046648 | Ga0495611_0006515 | Ga0495611_0006515_961_1818 | 253 |
| 257 | 3300046648 | Ga0495611_0019296 | Ga0495611_0019296_1756_2616 | 253 |
| 258 | 3300046648 | Ga0495611_0024690 | Ga0495611_0024690_680_1537 | 253 |
| 259 | 3300046660 | Ga0495625_0004975 | Ga0495625_0004975_1339_2136 | 253 |
| 260 | 3300046660 | Ga0495625_0012646 | Ga0495625_0012646_2641_3501 | 253 |
| 261 | 3300046664 | Ga0495659_0003081 | Ga0495659_0003081_165_962 | 253 |
| 262 | 3300046664 | Ga0495659_0079060 | Ga0495659_0079060_75_932 | 253 |
| 263 | 3300046665 | Ga0495661_0000741 | Ga0495661_0000741_5688_6590 | 253 |
| 264 | 3300046665 | Ga0495661_0030115 | Ga0495661_0030115_1495_2355 | 253 |
| 265 | 3300046665 | Ga0495661_0057391 | Ga0495661_0057391_21_881 | 253 |
| 266 | 3300046684 | Ga0495669_0000079 | Ga0495669_0000079_25211_26113 | 253 |
| 267 | 3300046684 | Ga0495669_0004395 | Ga0495669_0004395_3054_3851 | 253 |
| 268 | 3300046689 | Ga0495613_0188557 | Ga0495613_0188557_408_1310 | 253 |
| 269 | 3300046690 | Ga0495624_0059677 | Ga0495624_0059677_551_1453 | 253 |
| 270 | 3300046691 | Ga0495670_0000174 | Ga0495670_0000174_2711_3613 | 253 |
| 271 | 3300046691 | Ga0495670_0001062 | Ga0495670_0001062_7374_8234 | 253 |
| 272 | 3300046691 | Ga0495670_0004373 | Ga0495670_0004373_1319_2176 | 253 |
| 273 | 3300046692 | Ga0495671_0020289 | Ga0495671_0020289_1568_2425 | 253 |
| 274 | 3300046694 | Ga0495649_0247895 | Ga0495649_0247895_21_818 | 253 |
| 275 | 3300046794 | Ga0495589_0084022 | Ga0495589_0084022_432_1292 | 253 |
| 276 | 3300046794 | Ga0495589_0084525 | Ga0495589_0084525_176_1033 | 253 |
| 277 | 3300046794 | Ga0495589_0135404 | Ga0495589_0135404_304_1164 | 253 |
| 278 | 3300047317 | Ga0495604_0093325 | Ga0495604_0093325_1094_1951 | 253 |
| 279 | 3300047318 | Ga0495636_0001847 | Ga0495636_0001847_1035_1892 | 253 |
| 280 | 3300047318 | Ga0495636_0024505 | Ga0495636_0024505_698_1495 | 253 |
| 281 | 3300047318 | Ga0495636_0129851 | Ga0495636_0129851_122_982 | 253 |
| 282 | 3300047321 | Ga0495676_0000084 | Ga0495676_0000084_38449_39351 | 253 |
| 283 | 3300047321 | Ga0495676_0031692 | Ga0495676_0031692_1665_2522 | 253 |
| 284 | 3300047322 | Ga0495680_0011851 | Ga0495680_0011851_1308_2210 | 253 |
| 285 | 3300047323 | Ga0495683_0000293 | Ga0495683_0000293_21666_22526 | 253 |
| 286 | 3300047323 | Ga0495683_0003728 | Ga0495683_0003728_451_1311 | 253 |
| 287 | 3300047323 | Ga0495683_0055048 | Ga0495683_0055048_1101_1961 | 253 |
| 288 | 3300047443 | Ga0495687_057267 | Ga0495687_057267_805_1602 | 253 |
| 289 | 3300047444 | Ga0495675_0000965 | Ga0495675_0000965_6901_7803 | 253 |
| 290 | 3300047445 | Ga0495677_0011700 | Ga0495677_0011700_875_1735 | 253 |
| 291 | 3300047445 | Ga0495677_0012507 | Ga0495677_0012507_1162_2064 | 253 |
| 292 | 3300047445 | Ga0495677_0015759 | Ga0495677_0015759_664_1521 | 253 |
| 293 | 3300047445 | Ga0495677_0063800 | Ga0495677_0063800_19_876 | 253 |
| 294 | 3300047445 | Ga0495677_0107977 | Ga0495677_0107977_186_983 | 253 |
| 295 | 3300047447 | Ga0495685_018612 | Ga0495685_018612_1052_1912 | 253 |
| 296 | 3300047469 | Ga0495673_0012427 | Ga0495673_0012427_411_1268 | 253 |
| 297 | 3300047470 | Ga0495681_0002009 | Ga0495681_0002009_2405_3307 | 253 |
| 298 | 3300047470 | Ga0495681_0012016 | Ga0495681_0012016_1005_1862 | 253 |
| 299 | 3300047470 | Ga0495681_0040690 | Ga0495681_0040690_1389_2249 | 253 |
| 300 | 3300047472 | Ga0495686_0116848 | Ga0495686_0116848_147_1007 | 253 |
| 301 | 3300047673 | Ga0495593_0034941 | Ga0495593_0034941_1240_2142 | 253 |
| 302 | 3300048089 | Ga0495614_0002147 | Ga0495614_0002147_615_1517 | 253 |
| 303 | 3300048091 | Ga0495626_0008966 | Ga0495626_0008966_3893_4804 | 253 |
| 304 | 3300048091 | Ga0495626_0014126 | Ga0495626_0014126_1192_2094 | 253 |
| 305 | 3300048091 | Ga0495626_0029826 | Ga0495626_0029826_30_890 | 253 |
| 306 | 3300048091 | Ga0495626_0051113 | Ga0495626_0051113_864_1721 | 253 |
| 307 | 3300048918 | Ga0496115_0032132 | Ga0496115_0032132_239_1096 | 253 |
| 308 | 3300048918 | Ga0496115_0324216 | Ga0496115_0324216_281_1138 | 253 |
| 309 | 3300050489 | nmdc:mga03683_64020_c1 | nmdc:mga03683_64020_c1_86_937 | 253 |
| 310 | 3300050493 | nmdc:mga0k408_32983_c1 | nmdc:mga0k408_32983_c1_1629_2480 | 253 |
| 311 | 3300053092 | Ga0500583_0004651 | Ga0500583_0004651_591_1433 | 253 |
| 312 | 3300003322 | rootL2_10141155 | rootL2_1014115514 | 254 |
| 313 | 3300003771 | Ga0055526_1000001 | Ga0055526_1000001288 | 254 |
| 314 | 3300005327 | Ga0070658_10227554 | Ga0070658_102275542 | 254 |
| 315 | 3300005366 | Ga0070659_100070640 | Ga0070659_1000706404 | 254 |
| 316 | 3300025233 | Ga0209437_101493 | Ga0209437_1014934 | 254 |
| 317 | 3300025256 | Ga0209759_1000352 | Ga0209759_100035252 | 254 |
| 318 | 3300025256 | Ga0209759_1014509 | Ga0209759_10145092 | 254 |
| 319 | 3300025295 | Ga0209564_1000002 | Ga0209564_1000002279 | 254 |
| 320 | 3300025909 | Ga0207705_10277109 | Ga0207705_102771092 | 254 |
| 321 | 3300025919 | Ga0207657_10028964 | Ga0207657_100289645 | 254 |
| 322 | 3300042876 | Ga0451577_0015275 | Ga0451577_0015275_2478_3341 | 254 |
| 323 | 3300046457 | Ga0495590_0000034 | Ga0495590_0000034_34419_35282 | 254 |
| 324 | 3300046459 | Ga0495629_0002150 | Ga0495629_0002150_10119_10988 | 254 |
| 325 | 3300046460 | Ga0495638_0000072 | Ga0495638_0000072_38146_39009 | 254 |
| 326 | 3300046471 | Ga0495650_0005074 | Ga0495650_0005074_2509_3372 | 254 |
| 327 | 3300046506 | Ga0495583_0000148 | Ga0495583_0000148_38049_38912 | 254 |
| 328 | 3300046507 | Ga0495606_0001703 | Ga0495606_0001703_27058_27921 | 254 |
| 329 | 3300046512 | Ga0495610_0031255 | Ga0495610_0031255_533_1396 | 254 |
| 330 | 3300046522 | Ga0495643_0000135 | Ga0495643_0000135_79894_80757 | 254 |
| 331 | 3300046522 | Ga0495643_0036636 | Ga0495643_0036636_571_1458 | 254 |
| 332 | 3300046524 | Ga0495648_0000037 | Ga0495648_0000037_156488_157351 | 254 |
| 333 | 3300046528 | Ga0495642_0050791 | Ga0495642_0050791_390_1253 | 254 |
| 334 | 3300046536 | Ga0495587_0200203 | Ga0495587_0200203_97_966 | 254 |
| 335 | 3300046538 | Ga0495609_0013043 | Ga0495609_0013043_2442_3305 | 254 |
| 336 | 3300046542 | Ga0495597_0000156 | Ga0495597_0000156_21692_22555 | 254 |
| 337 | 3300046542 | Ga0495597_0000172 | Ga0495597_0000172_4017_4880 | 254 |
| 338 | 3300046557 | Ga0495622_0000040 | Ga0495622_0000040_79633_80496 | 254 |
| 339 | 3300046557 | Ga0495622_0001638 | Ga0495622_0001638_1074_1943 | 254 |
| 340 | 3300046558 | Ga0495633_0000121 | Ga0495633_0000121_2340_3203 | 254 |
| 341 | 3300046559 | Ga0495667_0164163 | Ga0495667_0164163_43_912 | 254 |
| 342 | 3300046616 | Ga0495668_0000404 | Ga0495668_0000404_21059_21922 | 254 |
| 343 | 3300046660 | Ga0495625_0000023 | Ga0495625_0000023_222624_223487 | 254 |
| 344 | 3300046660 | Ga0495625_0011673 | Ga0495625_0011673_2303_3166 | 254 |
| 345 | 3300046660 | Ga0495625_0085821 | Ga0495625_0085821_738_1601 | 254 |
| 346 | 3300046690 | Ga0495624_0008965 | Ga0495624_0008965_2130_2999 | 254 |
| 347 | 3300046694 | Ga0495649_0104714 | Ga0495649_0104714_159_1022 | 254 |
| 348 | 3300046810 | Ga0495660_0021917 | Ga0495660_0021917_1813_2676 | 254 |
| 349 | 3300047317 | Ga0495604_0007669 | Ga0495604_0007669_3279_4148 | 254 |
| 350 | 3300047443 | Ga0495687_000666 | Ga0495687_000666_32892_33755 | 254 |
| 351 | 3300047443 | Ga0495687_000710 | Ga0495687_000710_4520_5383 | 254 |
| 352 | 3300047472 | Ga0495686_0005849 | Ga0495686_0005849_4796_5644 | 254 |
| 353 | 3300048909 | Ga0496106_0434297 | Ga0496106_0434297_175_1044 | 254 |
| 354 | 3300048918 | Ga0496115_0104805 | Ga0496115_0104805_817_1686 | 254 |
| 355 | 3300002705 | JGI25156J39149_1000447 | JGI25156J39149_100044715 | 255 |
| 356 | 3300002738 | JGI25154J39366_1002034 | JGI25154J39366_10020345 | 255 |
| 357 | 3300002738 | JGI25154J39366_1002063 | JGI25154J39366_10020637 | 255 |
| 358 | 3300002741 | JGI25157J39369_1000267 | JGI25157J39369_10002678 | 255 |
| 359 | 3300002772 | JGI25164J39214_1003139 | JGI25164J39214_10031393 | 255 |
| 360 | 3300003323 | rootH1_10000796 | rootH1_100007964 | 255 |
| 361 | 3300003752 | Ga0055539_1000197 | Ga0055539_100019712 | 255 |
| 362 | 3300003756 | Ga0055533_1000040 | Ga0055533_100004031 | 255 |
| 363 | 3300003759 | Ga0055525_1001871 | Ga0055525_10018712 | 255 |
| 364 | 3300005330 | Ga0070690_100003934 | Ga0070690_1000039343 | 255 |
| 365 | 3300005330 | Ga0070690_100012655 | Ga0070690_1000126553 | 255 |
| 366 | 3300005334 | Ga0068869_100002249 | Ga0068869_1000022497 | 255 |
| 367 | 3300005335 | Ga0070666_10024809 | Ga0070666_100248093 | 255 |
| 368 | 3300005338 | Ga0068868_100040353 | Ga0068868_1000403533 | 255 |
| 369 | 3300005340 | Ga0070689_100418602 | Ga0070689_1004186021 | 255 |
| 370 | 3300005343 | Ga0070687_100009783 | Ga0070687_1000097834 | 255 |
| 371 | 3300005347 | Ga0070668_100001840 | Ga0070668_1000018407 | 255 |
| 372 | 3300005353 | Ga0070669_100005015 | Ga0070669_1000050154 | 255 |
| 373 | 3300005354 | Ga0070675_100011382 | Ga0070675_1000113824 | 255 |
| 374 | 3300005356 | Ga0070674_100001933 | Ga0070674_1000019334 | 255 |
| 375 | 3300005367 | Ga0070667_100011858 | Ga0070667_1000118584 | 255 |
| 376 | 3300005367 | Ga0070667_100464792 | Ga0070667_1004647921 | 255 |
| 377 | 3300005441 | Ga0070700_100017319 | Ga0070700_1000173193 | 255 |
| 378 | 3300005457 | Ga0070662_100010014 | Ga0070662_1000100144 | 255 |
| 379 | 3300005459 | Ga0068867_100004249 | Ga0068867_1000042497 | 255 |
| 380 | 3300005535 | Ga0070684_100343569 | Ga0070684_1003435692 | 255 |
| 381 | 3300005539 | Ga0068853_100120915 | Ga0068853_1001209153 | 255 |
| 382 | 3300005539 | Ga0068853_100226687 | Ga0068853_1002266871 | 255 |
| 383 | 3300005543 | Ga0070672_100012264 | Ga0070672_1000122645 | 255 |
| 384 | 3300005563 | Ga0068855_100012110 | Ga0068855_1000121103 | 255 |
| 385 | 3300005577 | Ga0068857_100019689 | Ga0068857_1000196893 | 255 |
| 386 | 3300005614 | Ga0068856_100001658 | Ga0068856_1000016588 | 255 |
| 387 | 3300005616 | Ga0068852_100016167 | Ga0068852_1000161673 | 255 |
| 388 | 3300005616 | Ga0068852_100053382 | Ga0068852_1000533822 | 255 |
| 389 | 3300005617 | Ga0068859_100033169 | Ga0068859_1000331693 | 255 |
| 390 | 3300005618 | Ga0068864_100014855 | Ga0068864_1000148554 | 255 |
| 391 | 3300005718 | Ga0068866_10002463 | Ga0068866_100024634 | 255 |
| 392 | 3300005719 | Ga0068861_100009071 | Ga0068861_1000090713 | 255 |
| 393 | 3300005719 | Ga0068861_100022899 | Ga0068861_1000228994 | 255 |
| 394 | 3300005841 | Ga0068863_100006509 | Ga0068863_1000065095 | 255 |
| 395 | 3300005842 | Ga0068858_100059421 | Ga0068858_1000594214 | 255 |
| 396 | 3300005843 | Ga0068860_100037393 | Ga0068860_1000373935 | 255 |
| 397 | 3300005843 | Ga0068860_100746281 | Ga0068860_1007462811 | 255 |
| 398 | 3300006881 | Ga0068865_100003333 | Ga0068865_1000033332 | 255 |
| 399 | 3300006931 | Ga0097620_100033170 | Ga0097620_1000331705 | 255 |
| 400 | 3300009093 | Ga0105240_10069749 | Ga0105240_100697494 | 255 |
| 401 | 3300009098 | Ga0105245_10069680 | Ga0105245_100696804 | 255 |
| 402 | 3300009148 | Ga0105243_10005749 | Ga0105243_100057497 | 255 |
| 403 | 3300009176 | Ga0105242_10067100 | Ga0105242_100671002 | 255 |
| 404 | 3300009176 | Ga0105242_10068765 | Ga0105242_100687654 | 255 |
| 405 | 3300009551 | Ga0105238_10281555 | Ga0105238_102815552 | 255 |
| 406 | 3300009553 | Ga0105249_10003818 | Ga0105249_100038185 | 255 |
| 407 | 3300010375 | Ga0105239_10045708 | Ga0105239_100457083 | 255 |
| 408 | 3300013105 | Ga0157369_10120704 | Ga0157369_101207044 | 255 |
| 409 | 3300013297 | Ga0157378_10040424 | Ga0157378_100404243 | 255 |
| 410 | 3300013297 | Ga0157378_10184633 | Ga0157378_101846332 | 255 |
| 411 | 3300013306 | Ga0163162_10015948 | Ga0163162_100159486 | 255 |
| 412 | 3300013308 | Ga0157375_10056412 | Ga0157375_100564124 | 255 |
| 413 | 3300013308 | Ga0157375_10252616 | Ga0157375_102526163 | 255 |
| 414 | 3300014326 | Ga0157380_10011647 | Ga0157380_100116474 | 255 |
| 415 | 3300014968 | Ga0157379_10004848 | Ga0157379_100048484 | 255 |
| 416 | 3300017792 | Ga0163161_10004156 | Ga0163161_100041564 | 255 |
| 417 | 3300021361 | Ga0213872_10013618 | Ga0213872_100136183 | 255 |
| 418 | 3300025226 | Ga0209674_100066 | Ga0209674_100066208 | 255 |
| 419 | 3300025230 | Ga0209563_100129 | Ga0209563_10012959 | 255 |
| 420 | 3300025231 | Ga0207427_100314 | Ga0207427_10031420 | 255 |
| 421 | 3300025242 | Ga0209258_100419 | Ga0209258_10041929 | 255 |
| 422 | 3300025246 | Ga0209646_1000054 | Ga0209646_1000054204 | 255 |
| 423 | 3300025246 | Ga0209646_1000076 | Ga0209646_1000076192 | 255 |
| 424 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011376 | 255 |
| 425 | 3300025253 | Ga0209677_100157 | Ga0209677_10015739 | 255 |
| 426 | 3300025253 | Ga0209677_100160 | Ga0209677_1001608 | 255 |
| 427 | 3300025256 | Ga0209759_1000034 | Ga0209759_1000034100 | 255 |
| 428 | 3300025899 | Ga0207642_10002016 | Ga0207642_100020166 | 255 |
| 429 | 3300025903 | Ga0207680_10008600 | Ga0207680_100086003 | 255 |
| 430 | 3300025907 | Ga0207645_10000262 | Ga0207645_100002624 | 255 |
| 431 | 3300025911 | Ga0207654_10021849 | Ga0207654_100218494 | 255 |
| 432 | 3300025913 | Ga0207695_10009345 | Ga0207695_100093454 | 255 |
| 433 | 3300025914 | Ga0207671_10032860 | Ga0207671_100328602 | 255 |
| 434 | 3300025918 | Ga0207662_10002649 | Ga0207662_100026497 | 255 |
| 435 | 3300025919 | Ga0207657_10099837 | Ga0207657_100998373 | 255 |
| 436 | 3300025923 | Ga0207681_10007608 | Ga0207681_100076083 | 255 |
| 437 | 3300025924 | Ga0207694_10040610 | Ga0207694_100406102 | 255 |
| 438 | 3300025927 | Ga0207687_10154904 | Ga0207687_101549042 | 255 |
| 439 | 3300025932 | Ga0207690_10285974 | Ga0207690_102859742 | 255 |
| 440 | 3300025932 | Ga0207690_10541175 | Ga0207690_105411751 | 255 |
| 441 | 3300025933 | Ga0207706_10002487 | Ga0207706_1000248715 | 255 |
| 442 | 3300025934 | Ga0207686_10083547 | Ga0207686_100835472 | 255 |
| 443 | 3300025935 | Ga0207709_10009363 | Ga0207709_100093634 | 255 |
| 444 | 3300025937 | Ga0207669_10006468 | Ga0207669_100064684 | 255 |
| 445 | 3300025938 | Ga0207704_10005165 | Ga0207704_100051653 | 255 |
| 446 | 3300025940 | Ga0207691_10004507 | Ga0207691_100045075 | 255 |
| 447 | 3300025942 | Ga0207689_10001349 | Ga0207689_100013497 | 255 |
| 448 | 3300025942 | Ga0207689_10314573 | Ga0207689_103145731 | 255 |
| 449 | 3300025949 | Ga0207667_10012991 | Ga0207667_100129912 | 255 |
| 450 | 3300025960 | Ga0207651_10024234 | Ga0207651_100242343 | 255 |
| 451 | 3300025961 | Ga0207712_10023893 | Ga0207712_100238933 | 255 |
| 452 | 3300025972 | Ga0207668_10005376 | Ga0207668_100053765 | 255 |
| 453 | 3300025981 | Ga0207640_10015038 | Ga0207640_100150384 | 255 |
| 454 | 3300025986 | Ga0207658_10002923 | Ga0207658_100029237 | 255 |
| 455 | 3300026023 | Ga0207677_10025514 | Ga0207677_100255143 | 255 |
| 456 | 3300026035 | Ga0207703_10031541 | Ga0207703_100315414 | 255 |
| 457 | 3300026041 | Ga0207639_10096759 | Ga0207639_100967593 | 255 |
| 458 | 3300026075 | Ga0207708_10010773 | Ga0207708_100107733 | 255 |
| 459 | 3300026078 | Ga0207702_10002567 | Ga0207702_1000256715 | 255 |
| 460 | 3300026088 | Ga0207641_10003275 | Ga0207641_100032754 | 255 |
| 461 | 3300026089 | Ga0207648_10003878 | Ga0207648_100038789 | 255 |
| 462 | 3300026089 | Ga0207648_10343067 | Ga0207648_103430672 | 255 |
| 463 | 3300026095 | Ga0207676_10038326 | Ga0207676_100383264 | 255 |
| 464 | 3300026116 | Ga0207674_10007284 | Ga0207674_100072844 | 255 |
| 465 | 3300026118 | Ga0207675_100011808 | Ga0207675_1000118085 | 255 |
| 466 | 3300026118 | Ga0207675_100021794 | Ga0207675_1000217942 | 255 |
| 467 | 3300026121 | Ga0207683_10055825 | Ga0207683_100558252 | 255 |
| 468 | 3300026121 | Ga0207683_10154393 | Ga0207683_101543932 | 255 |
| 469 | 3300026142 | Ga0207698_10009829 | Ga0207698_100098295 | 255 |
| 470 | 3300026142 | Ga0207698_10032690 | Ga0207698_100326902 | 255 |
| 471 | 3300028381 | Ga0268264_10054528 | Ga0268264_100545283 | 255 |
| 472 | 3300035086 | Ga0373934_0050556 | Ga0373934_0050556_569_1420 | 255 |
| 473 | 3300035691 | Ga0373931_0060823 | Ga0373931_0060823_187_1038 | 255 |
| 474 | 3300037312 | Ga0395899_0060977 | Ga0395899_0060977_1707_2594 | 255 |
| 475 | 3300037418 | Ga0395900_0055755 | Ga0395900_0055755_281_1168 | 255 |
| 476 | 3300037466 | Ga0395898_0044271 | Ga0395898_0044271_1958_2809 | 255 |
| 477 | 3300037471 | Ga0395905_0026780 | Ga0395905_0026780_3690_4577 | 255 |
| 478 | 3300037471 | Ga0395905_0222610 | Ga0395905_0222610_671_1522 | 255 |
| 479 | 3300037471 | Ga0395905_0314674 | Ga0395905_0314674_10_909 | 255 |
| 480 | 3300038443 | Ga0395901_0002036 | Ga0395901_0002036_587_1438 | 255 |
| 481 | 3300039447 | Ga0436361_0534903 | Ga0436361_0534903_3940_4797 | 255 |
| 482 | 3300039447 | Ga0436361_0695712 | Ga0436361_0695712_473_1324 | 255 |
| 483 | 3300042876 | Ga0451577_0124285 | Ga0451577_0124285_677_1534 | 255 |
| 484 | 3300045051 | Ga0451576_0269599 | Ga0451576_0269599_663_1520 | 255 |
| 485 | 3300045976 | Ga0466967_0083388 | Ga0466967_0083388_1588_2439 | 255 |
| 486 | 3300046457 | Ga0495590_0005517 | Ga0495590_0005517_3651_4544 | 255 |
| 487 | 3300046460 | Ga0495638_0097807 | Ga0495638_0097807_82_975 | 255 |
| 488 | 3300046460 | Ga0495638_0201746 | Ga0495638_0201746_122_1021 | 255 |
| 489 | 3300046471 | Ga0495650_0009804 | Ga0495650_0009804_2658_3545 | 255 |
| 490 | 3300046492 | Ga0495585_0116020 | Ga0495585_0116020_443_1336 | 255 |
| 491 | 3300046500 | Ga0495596_0001162 | Ga0495596_0001162_5517_6410 | 255 |
| 492 | 3300046501 | Ga0495607_0058959 | Ga0495607_0058959_1063_1956 | 255 |
| 493 | 3300046506 | Ga0495583_0000873 | Ga0495583_0000873_8996_9889 | 255 |
| 494 | 3300046506 | Ga0495583_0006709 | Ga0495583_0006709_2336_3229 | 255 |
| 495 | 3300046506 | Ga0495583_0008300 | Ga0495583_0008300_2961_3848 | 255 |
| 496 | 3300046506 | Ga0495583_0024307 | Ga0495583_0024307_583_1476 | 255 |
| 497 | 3300046507 | Ga0495606_0079285 | Ga0495606_0079285_82_975 | 255 |
| 498 | 3300046513 | Ga0495616_0006552 | Ga0495616_0006552_5063_5956 | 255 |
| 499 | 3300046518 | Ga0495631_0001384 | Ga0495631_0001384_12052_12945 | 255 |
| 500 | 3300046519 | Ga0495632_0000145 | Ga0495632_0000145_33470_34363 | 255 |
| 501 | 3300046519 | Ga0495632_0000160 | Ga0495632_0000160_31783_32694 | 255 |
| 502 | 3300046519 | Ga0495632_0020304 | Ga0495632_0020304_510_1409 | 255 |
| 503 | 3300046522 | Ga0495643_0149433 | Ga0495643_0149433_17_910 | 255 |
| 504 | 3300046523 | Ga0495644_0045397 | Ga0495644_0045397_375_1274 | 255 |
| 505 | 3300046524 | Ga0495648_0016428 | Ga0495648_0016428_2125_3018 | 255 |
| 506 | 3300046526 | Ga0495666_0002988 | Ga0495666_0002988_2238_3125 | 255 |
| 507 | 3300046530 | Ga0495654_0003860 | Ga0495654_0003860_2396_3289 | 255 |
| 508 | 3300046531 | Ga0495665_0035123 | Ga0495665_0035123_16_903 | 255 |
| 509 | 3300046533 | Ga0495640_0043506 | Ga0495640_0043506_1941_2828 | 255 |
| 510 | 3300046542 | Ga0495597_0000279 | Ga0495597_0000279_6657_7550 | 255 |
| 511 | 3300046542 | Ga0495597_0074508 | Ga0495597_0074508_474_1367 | 255 |
| 512 | 3300046542 | Ga0495597_0085927 | Ga0495597_0085927_54_965 | 255 |
| 513 | 3300046558 | Ga0495633_0071886 | Ga0495633_0071886_628_1521 | 255 |
| 514 | 3300046558 | Ga0495633_0096108 | Ga0495633_0096108_145_1038 | 255 |
| 515 | 3300046616 | Ga0495668_0004168 | Ga0495668_0004168_2590_3483 | 255 |
| 516 | 3300046616 | Ga0495668_0123369 | Ga0495668_0123369_153_1046 | 255 |
| 517 | 3300046660 | Ga0495625_0019667 | Ga0495625_0019667_2537_3430 | 255 |
| 518 | 3300046660 | Ga0495625_0199258 | Ga0495625_0199258_253_1155 | 255 |
| 519 | 3300046665 | Ga0495661_0010844 | Ga0495661_0010844_2184_3095 | 255 |
| 520 | 3300046674 | Ga0495588_0029355 | Ga0495588_0029355_130_1029 | 255 |
| 521 | 3300046674 | Ga0495588_0116572 | Ga0495588_0116572_352_1239 | 255 |
| 522 | 3300046679 | Ga0495623_0082622 | Ga0495623_0082622_669_1556 | 255 |
| 523 | 3300046691 | Ga0495670_0092823 | Ga0495670_0092823_564_1463 | 255 |
| 524 | 3300046692 | Ga0495671_0006510 | Ga0495671_0006510_1065_1958 | 255 |
| 525 | 3300046692 | Ga0495671_0007352 | Ga0495671_0007352_3151_4044 | 255 |
| 526 | 3300046692 | Ga0495671_0024472 | Ga0495671_0024472_1313_2206 | 255 |
| 527 | 3300046692 | Ga0495671_0070053 | Ga0495671_0070053_443_1345 | 255 |
| 528 | 3300046694 | Ga0495649_0013109 | Ga0495649_0013109_1858_2751 | 255 |
| 529 | 3300046794 | Ga0495589_0000410 | Ga0495589_0000410_27807_28700 | 255 |
| 530 | 3300046810 | Ga0495660_0008047 | Ga0495660_0008047_1269_2162 | 255 |
| 531 | 3300046810 | Ga0495660_0010318 | Ga0495660_0010318_1116_2018 | 255 |
| 532 | 3300047317 | Ga0495604_0035726 | Ga0495604_0035726_2628_3515 | 255 |
| 533 | 3300047320 | Ga0495672_0000771 | Ga0495672_0000771_3233_4156 | 255 |
| 534 | 3300047443 | Ga0495687_000306 | Ga0495687_000306_38765_39658 | 255 |
| 535 | 3300047446 | Ga0495679_007612 | Ga0495679_007612_1166_2059 | 255 |
| 536 | 3300047447 | Ga0495685_043184 | Ga0495685_043184_183_1076 | 255 |
| 537 | 3300047470 | Ga0495681_0000147 | Ga0495681_0000147_35131_36018 | 255 |
| 538 | 3300047470 | Ga0495681_0000260 | Ga0495681_0000260_5463_6356 | 255 |
| 539 | 3300047470 | Ga0495681_0017096 | Ga0495681_0017096_813_1706 | 255 |
| 540 | 3300047472 | Ga0495686_0005772 | Ga0495686_0005772_2233_3120 | 255 |
| 541 | 3300048088 | Ga0495602_0047551 | Ga0495602_0047551_547_1434 | 255 |
| 542 | 3300048091 | Ga0495626_0005832 | Ga0495626_0005832_2186_3085 | 255 |
| 543 | 3300048091 | Ga0495626_0027651 | Ga0495626_0027651_1152_2039 | 255 |
| 544 | 3300048091 | Ga0495626_0077340 | Ga0495626_0077340_200_1099 | 255 |
| 545 | 3300048906 | Ga0496103_0042535 | Ga0496103_0042535_1578_2465 | 255 |
| 546 | 3300048909 | Ga0496106_0018136 | Ga0496106_0018136_1170_2063 | 255 |
| 547 | 3300048910 | Ga0496107_0021505 | Ga0496107_0021505_449_1342 | 255 |
| 548 | 3300048911 | Ga0496108_0463177 | Ga0496108_0463177_176_1069 | 255 |
| 549 | 3300048912 | Ga0496109_0201291 | Ga0496109_0201291_65_952 | 255 |
| 550 | 3300048913 | Ga0496110_0000186 | Ga0496110_0000186_29435_30325 | 255 |
| 551 | 3300048914 | Ga0496111_0024155 | Ga0496111_0024155_35_925 | 255 |
| 552 | 3300048918 | Ga0496115_0082588 | Ga0496115_0082588_1374_2261 | 255 |
| 553 | 3300049459 | Ga0495678_000181 | Ga0495678_000181_42342_43235 | 255 |
| 554 | 3300049459 | Ga0495678_000491 | Ga0495678_000491_7233_8126 | 255 |
| 555 | 3300049459 | Ga0495678_003500 | Ga0495678_003500_2984_3877 | 255 |
| 556 | 3300049460 | Ga0495682_0000306 | Ga0495682_0000306_8485_9378 | 255 |
| 557 | 3300049460 | Ga0495682_0010739 | Ga0495682_0010739_2373_3260 | 255 |
| 558 | 3300050493 | nmdc:mga0k408_72121_c1 | nmdc:mga0k408_72121_c1_553_1413 | 255 |
| 559 | 3300053178 | Ga0500637_0042673 | Ga0500637_0042673_865_1731 | 255 |
| 560 | 3300010375 | Ga0105239_10143472 | Ga0105239_101434722 | 256 |
| 561 | 3300017792 | Ga0163161_10016812 | Ga0163161_100168122 | 256 |
| 562 | 3300025303 | Ga0209051_1004150 | Ga0209051_10041502 | 256 |
| 563 | 3300039438 | Ga0436360_0997915 | Ga0436360_0997915_90_1016 | 256 |
| 564 | 3300044712 | Ga0453684_0113609 | Ga0453684_0113609_1996_2856 | 256 |
| 565 | 3300046453 | Ga0495627_000463 | Ga0495627_000463_25577_26479 | 256 |
| 566 | 3300046453 | Ga0495627_022867 | Ga0495627_022867_511_1413 | 256 |
| 567 | 3300046455 | Ga0495603_0069133 | Ga0495603_0069133_256_1158 | 256 |
| 568 | 3300046455 | Ga0495603_0137007 | Ga0495603_0137007_69_971 | 256 |
| 569 | 3300046458 | Ga0495591_011655 | Ga0495591_011655_424_1314 | 256 |
| 570 | 3300046459 | Ga0495629_0040206 | Ga0495629_0040206_1846_2748 | 256 |
| 571 | 3300046473 | Ga0495582_0036959 | Ga0495582_0036959_1243_2145 | 256 |
| 572 | 3300046474 | Ga0495605_0007732 | Ga0495605_0007732_3895_4797 | 256 |
| 573 | 3300046474 | Ga0495605_0008039 | Ga0495605_0008039_3348_4250 | 256 |
| 574 | 3300046474 | Ga0495605_0018205 | Ga0495605_0018205_2143_3045 | 256 |
| 575 | 3300046491 | Ga0495584_0003264 | Ga0495584_0003264_1536_2438 | 256 |
| 576 | 3300046491 | Ga0495584_0011854 | Ga0495584_0011854_1436_2326 | 256 |
| 577 | 3300046492 | Ga0495585_0007090 | Ga0495585_0007090_4637_5569 | 256 |
| 578 | 3300046492 | Ga0495585_0012029 | Ga0495585_0012029_3757_4659 | 256 |
| 579 | 3300046492 | Ga0495585_0028872 | Ga0495585_0028872_550_1452 | 256 |
| 580 | 3300046492 | Ga0495585_0030953 | Ga0495585_0030953_25_915 | 256 |
| 581 | 3300046499 | Ga0495594_0000661 | Ga0495594_0000661_4403_5335 | 256 |
| 582 | 3300046499 | Ga0495594_0009492 | Ga0495594_0009492_1411_2313 | 256 |
| 583 | 3300046500 | Ga0495596_0002482 | Ga0495596_0002482_3329_4261 | 256 |
| 584 | 3300046500 | Ga0495596_0010660 | Ga0495596_0010660_2000_2890 | 256 |
| 585 | 3300046501 | Ga0495607_0010087 | Ga0495607_0010087_1396_2298 | 256 |
| 586 | 3300046501 | Ga0495607_0032554 | Ga0495607_0032554_2245_3135 | 256 |
| 587 | 3300046507 | Ga0495606_0011209 | Ga0495606_0011209_2761_3651 | 256 |
| 588 | 3300046513 | Ga0495616_0000255 | Ga0495616_0000255_26303_27205 | 256 |
| 589 | 3300046513 | Ga0495616_0018313 | Ga0495616_0018313_733_1635 | 256 |
| 590 | 3300046513 | Ga0495616_0029944 | Ga0495616_0029944_669_1559 | 256 |
| 591 | 3300046518 | Ga0495631_0002906 | Ga0495631_0002906_5805_6707 | 256 |
| 592 | 3300046518 | Ga0495631_0005307 | Ga0495631_0005307_2561_3493 | 256 |
| 593 | 3300046518 | Ga0495631_0018610 | Ga0495631_0018610_1075_1965 | 256 |
| 594 | 3300046519 | Ga0495632_0000958 | Ga0495632_0000958_11974_12876 | 256 |
| 595 | 3300046520 | Ga0495637_0021936 | Ga0495637_0021936_489_1379 | 256 |
| 596 | 3300046523 | Ga0495644_0010915 | Ga0495644_0010915_26_958 | 256 |
| 597 | 3300046523 | Ga0495644_0016962 | Ga0495644_0016962_1796_2698 | 256 |
| 598 | 3300046523 | Ga0495644_0022768 | Ga0495644_0022768_1303_2193 | 256 |
| 599 | 3300046523 | Ga0495644_0030021 | Ga0495644_0030021_69_971 | 256 |
| 600 | 3300046524 | Ga0495648_0020390 | Ga0495648_0020390_321_1211 | 256 |
| 601 | 3300046528 | Ga0495642_0000404 | Ga0495642_0000404_11395_12297 | 256 |
| 602 | 3300046528 | Ga0495642_0012299 | Ga0495642_0012299_2192_3094 | 256 |
| 603 | 3300046530 | Ga0495654_0003810 | Ga0495654_0003810_7459_8361 | 256 |
| 604 | 3300046538 | Ga0495609_0002768 | Ga0495609_0002768_3879_4781 | 256 |
| 605 | 3300046542 | Ga0495597_0000298 | Ga0495597_0000298_34485_35387 | 256 |
| 606 | 3300046542 | Ga0495597_0003999 | Ga0495597_0003999_2331_3233 | 256 |
| 607 | 3300046557 | Ga0495622_0028151 | Ga0495622_0028151_457_1359 | 256 |
| 608 | 3300046558 | Ga0495633_0033290 | Ga0495633_0033290_355_1257 | 256 |
| 609 | 3300046616 | Ga0495668_0016009 | Ga0495668_0016009_324_1226 | 256 |
| 610 | 3300046616 | Ga0495668_0128119 | Ga0495668_0128119_48_950 | 256 |
| 611 | 3300046648 | Ga0495611_0003078 | Ga0495611_0003078_6002_6934 | 256 |
| 612 | 3300046660 | Ga0495625_0220737 | Ga0495625_0220737_10_900 | 256 |
| 613 | 3300046665 | Ga0495661_0092619 | Ga0495661_0092619_454_1356 | 256 |
| 614 | 3300046674 | Ga0495588_0003827 | Ga0495588_0003827_4956_5858 | 256 |
| 615 | 3300046684 | Ga0495669_0013658 | Ga0495669_0013658_707_1597 | 256 |
| 616 | 3300046689 | Ga0495613_0009834 | Ga0495613_0009834_1120_2022 | 256 |
| 617 | 3300046691 | Ga0495670_0011396 | Ga0495670_0011396_781_1683 | 256 |
| 618 | 3300046692 | Ga0495671_0000233 | Ga0495671_0000233_5591_6493 | 256 |
| 619 | 3300046694 | Ga0495649_0166534 | Ga0495649_0166534_54_944 | 256 |
| 620 | 3300046794 | Ga0495589_0027743 | Ga0495589_0027743_1303_2193 | 256 |
| 621 | 3300046810 | Ga0495660_0044375 | Ga0495660_0044375_1303_2193 | 256 |
| 622 | 3300047323 | Ga0495683_0036871 | Ga0495683_0036871_1436_2326 | 256 |
| 623 | 3300047446 | Ga0495679_027617 | Ga0495679_027617_842_1732 | 256 |
| 624 | 3300047446 | Ga0495679_029895 | Ga0495679_029895_296_1198 | 256 |
| 625 | 3300047447 | Ga0495685_033554 | Ga0495685_033554_442_1332 | 256 |
| 626 | 3300047673 | Ga0495593_0017028 | Ga0495593_0017028_1923_2825 | 256 |
| 627 | 3300048089 | Ga0495614_0001003 | Ga0495614_0001003_5136_6038 | 256 |
| 628 | 3300048091 | Ga0495626_0007478 | Ga0495626_0007478_4256_5188 | 256 |
| 629 | 3300048927 | Ga0496124_0240913 | Ga0496124_0240913_48_953 | 256 |
| 630 | 3300049459 | Ga0495678_029752 | Ga0495678_029752_221_1111 | 256 |
| 631 | 3300006048 | Ga0075363_100112634 | Ga0075363_1001126342 | 257 |
| 632 | 3300006353 | Ga0075370_10025252 | Ga0075370_100252522 | 257 |
| 633 | 3300014968 | Ga0157379_10022057 | Ga0157379_100220574 | 257 |
| 634 | 3300030745 | Ga0316182_1375358 | Ga0316182_13753582 | 257 |
| 635 | 3300032004 | Ga0307414_10054142 | Ga0307414_100541422 | 257 |
| 636 | 3300046530 | Ga0495654_0017026 | Ga0495654_0017026_1908_2816 | 257 |
| 637 | 3300050489 | nmdc:mga03683_135658_c1 | nmdc:mga03683_135658_c1_80_943 | 257 |
| 638 | 3300050490 | nmdc:mga03n38_197802_c1 | nmdc:mga03n38_197802_c1_71_934 | 257 |
| 639 | 3300050491 | nmdc:mga00v17_71093_c1 | nmdc:mga00v17_71093_c1_1116_1979 | 257 |
| 640 | 3300050496 | nmdc:mga07m45_82887_c1 | nmdc:mga07m45_82887_c1_693_1556 | 257 |
| 641 | 3300050516 | nmdc:mga0sz30_27928_c1 | nmdc:mga0sz30_27928_c1_1018_1881 | 257 |
| 642 | iso_pu_bacteria | 2643221664 | 2644360509 | 257 |
| 643 | iso_pu_bacteria | 2738543018 | 2739275619 | 257 |
| 644 | iso_pu_bacteria | 2738543030 | 2739344663 | 257 |
| 645 | iso_pu_bacteria | 2808606386 | 2808981370 | 257 |
| 646 | iso_pu_bacteria | 2808606415 | 2809128956 | 257 |
| 647 | iso_pu_bacteria | 2808606419 | 2809148577 | 257 |
| 648 | iso_pu_bacteria | 2852618963 | 2852621110 | 257 |
| 649 | 3300044658 | Ga0466972_0053888 | Ga0466972_0053888_170_1039 | 259 |
| 650 | 3300044683 | Ga0466965_0041380 | Ga0466965_0041380_771_1640 | 259 |
| 651 | 3300044706 | Ga0466964_0041507 | Ga0466964_0041507_682_1551 | 259 |
| 652 | 3300044735 | Ga0466968_0002881 | Ga0466968_0002881_185_1054 | 259 |
| 653 | 3300048927 | Ga0496124_0031761 | Ga0496124_0031761_3743_4636 | 259 |
| 654 | 3300044735 | Ga0466968_0007155 | Ga0466968_0007155_2421_3272 | 261 |
| 655 | 3300046452 | Ga0495617_000290 | Ga0495617_000290_15895_16716 | 261 |
| 656 | 3300046460 | Ga0495638_0004326 | Ga0495638_0004326_9103_9924 | 261 |
| 657 | 3300046474 | Ga0495605_0004352 | Ga0495605_0004352_5913_6734 | 261 |
| 658 | 3300046491 | Ga0495584_0000573 | Ga0495584_0000573_7812_8633 | 261 |
| 659 | 3300046492 | Ga0495585_0008225 | Ga0495585_0008225_3947_4768 | 261 |
| 660 | 3300046501 | Ga0495607_0038547 | Ga0495607_0038547_33_854 | 261 |
| 661 | 3300046506 | Ga0495583_0000374 | Ga0495583_0000374_9477_10298 | 261 |
| 662 | 3300046507 | Ga0495606_0043982 | Ga0495606_0043982_828_1649 | 261 |
| 663 | 3300046507 | Ga0495606_0050745 | Ga0495606_0050745_434_1255 | 261 |
| 664 | 3300046513 | Ga0495616_0036975 | Ga0495616_0036975_1637_2458 | 261 |
| 665 | 3300046523 | Ga0495644_0000135 | Ga0495644_0000135_4896_5717 | 261 |
| 666 | 3300046523 | Ga0495644_0001024 | Ga0495644_0001024_1305_2126 | 261 |
| 667 | 3300046524 | Ga0495648_0001727 | Ga0495648_0001727_20030_20851 | 261 |
| 668 | 3300046538 | Ga0495609_0001788 | Ga0495609_0001788_3501_4322 | 261 |
| 669 | 3300046538 | Ga0495609_0004975 | Ga0495609_0004975_4765_5586 | 261 |
| 670 | 3300046538 | Ga0495609_0051931 | Ga0495609_0051931_63_884 | 261 |
| 671 | 3300046542 | Ga0495597_0005162 | Ga0495597_0005162_3237_4058 | 261 |
| 672 | 3300046558 | Ga0495633_0000349 | Ga0495633_0000349_33432_34253 | 261 |
| 673 | 3300046558 | Ga0495633_0068729 | Ga0495633_0068729_186_1007 | 261 |
| 674 | 3300046615 | Ga0495656_0040517 | Ga0495656_0040517_215_1036 | 261 |
| 675 | 3300046616 | Ga0495668_0000285 | Ga0495668_0000285_34195_35016 | 261 |
| 676 | 3300046648 | Ga0495611_0000924 | Ga0495611_0000924_10121_10942 | 261 |
| 677 | 3300046648 | Ga0495611_0003527 | Ga0495611_0003527_1394_2215 | 261 |
| 678 | 3300046660 | Ga0495625_0007596 | Ga0495625_0007596_716_1537 | 261 |
| 679 | 3300046664 | Ga0495659_0001953 | Ga0495659_0001953_587_1408 | 261 |
| 680 | 3300046664 | Ga0495659_0042254 | Ga0495659_0042254_775_1596 | 261 |
| 681 | 3300046665 | Ga0495661_0035341 | Ga0495661_0035341_551_1372 | 261 |
| 682 | 3300046691 | Ga0495670_0020440 | Ga0495670_0020440_2389_3210 | 261 |
| 683 | 3300046692 | Ga0495671_0011162 | Ga0495671_0011162_3912_4733 | 261 |
| 684 | 3300046810 | Ga0495660_0002258 | Ga0495660_0002258_8036_8857 | 261 |
| 685 | 3300046810 | Ga0495660_0030404 | Ga0495660_0030404_949_1770 | 261 |
| 686 | 3300047318 | Ga0495636_0001041 | Ga0495636_0001041_9016_9837 | 261 |
| 687 | 3300047320 | Ga0495672_0005240 | Ga0495672_0005240_7919_8740 | 261 |
| 688 | 3300047443 | Ga0495687_000677 | Ga0495687_000677_19121_19942 | 261 |
| 689 | 3300047445 | Ga0495677_0000335 | Ga0495677_0000335_9163_9984 | 261 |
| 690 | 3300047447 | Ga0495685_000014 | Ga0495685_000014_2399_3220 | 261 |
| 691 | 3300047469 | Ga0495673_0003321 | Ga0495673_0003321_9629_10450 | 261 |
| 692 | 3300047472 | Ga0495686_0004325 | Ga0495686_0004325_2328_3149 | 261 |
| 693 | 3300047472 | Ga0495686_0015905 | Ga0495686_0015905_3962_4783 | 261 |
| 694 | 3300049459 | Ga0495678_012244 | Ga0495678_012244_642_1463 | 261 |
| 695 | 3300049459 | Ga0495678_043015 | Ga0495678_043015_264_1085 | 261 |
| 696 | 3300049460 | Ga0495682_0000121 | Ga0495682_0000121_32796_33617 | 261 |
| 697 | 3300049460 | Ga0495682_0000195 | Ga0495682_0000195_28839_29660 | 261 |
| 698 | 3300046525 | Ga0495663_0022940 | Ga0495663_0022940_144_965 | 262 |
| 699 | 3300047318 | Ga0495636_0004009 | Ga0495636_0004009_2905_3726 | 262 |
| 700 | 3300047318 | Ga0495636_0034617 | Ga0495636_0034617_439_1260 | 262 |
| 701 | 3300048906 | Ga0496103_0163703 | Ga0496103_0163703_375_1196 | 262 |
| 702 | 3300005616 | Ga0068852_100551788 | Ga0068852_1005517881 | 263 |
| 703 | 3300010375 | Ga0105239_10128780 | Ga0105239_101287802 | 263 |
| 704 | 3300025224 | Ga0209784_100021 | Ga0209784_100021106 | 263 |
| 705 | 3300025225 | Ga0209566_100039 | Ga0209566_100039107 | 263 |
| 706 | 3300025226 | Ga0209674_100036 | Ga0209674_100036106 | 263 |
| 707 | 3300025230 | Ga0209563_100040 | Ga0209563_100040106 | 263 |
| 708 | 3300025253 | Ga0209677_100023 | Ga0209677_100023106 | 263 |
| 709 | 3300026142 | Ga0207698_10434803 | Ga0207698_104348032 | 263 |
| 710 | 3300048924 | Ga0496121_0348423 | Ga0496121_0348423_29_853 | 263 |
| 711 | 3300048928 | Ga0496125_0020221 | Ga0496125_0020221_5158_5982 | 263 |
| 712 | iso_pu_bacteria | 2511231003 | 2511250136 | 267 |
| 713 | 3300002704 | JGI25155J39150_1000449 | JGI25155J39150_10004497 | 271 |
| 714 | 3300002705 | JGI25156J39149_1001687 | JGI25156J39149_10016872 | 271 |
| 715 | 3300002738 | JGI25154J39366_1000400 | JGI25154J39366_100040013 | 271 |
| 716 | 3300009093 | Ga0105240_10018053 | Ga0105240_100180536 | 271 |
| 717 | 3300025206 | Ga0209435_100112 | Ga0209435_1001128 | 271 |
| 718 | 3300025246 | Ga0209646_1000020 | Ga0209646_1000020218 | 271 |
| 719 | 3300025256 | Ga0209759_1000073 | Ga0209759_100007324 | 271 |
| 720 | 3300025913 | Ga0207695_10022459 | Ga0207695_100224594 | 271 |
| 721 | 3300046543 | Ga0495645_0027365 | Ga0495645_0027365_1213_2097 | 271 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tlz-assembly2.cif.gz_B | tsx structure complexed with uridine | 0.6452 | 37 | 271 |
| 1tlz-assembly2.cif.gz_B | tsx structure complexed with uridine | 0.6133 | 37 | 271 |
| 4fqe-assembly1.cif.gz_A | kdgm porin | 0.5723 | 42 | 271 |
| 4fqe-assembly1.cif.gz_A | kdgm porin | 0.5647 | 42 | 271 |
| 7ye6-assembly1.cif.gz_P | bam-espp complex structure with bama-n427c/espp-r1297c mutations in nanodisc | 0.5164 | 34 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tlyB00 | Mainly Beta;Beta Barrel;Outer membrane phospholipase (ompla); Chain C;Nucleoside-specific channel-forming protein, Tsx-like | 0.6702 | 37 | 271 | 2.40.230.20 |
| af_P76206_47_252_2.40.128.130 | Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain | 0.6597 | 42 | 269 | 2.40.128.130 |
| af_P76206_47_252_2.40.128.130 | Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain | 0.6484 | 42 | 269 | 2.40.128.130 |
| 1tlyB00 | Mainly Beta;Beta Barrel;Outer membrane phospholipase (ompla); Chain C;Nucleoside-specific channel-forming protein, Tsx-like | 0.6364 | 37 | 271 | 2.40.230.20 |
| af_Q5A893_109_250_3.90.1150.210 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit | 0.6228 | 174 | 257 | 3.90.1150.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0J9DMH1-F1-model_v4 | deleted | 0.965 | 38 | 226 |
|
| AF-A0A4R5Q981-F1-model_v4 | Outer envelope protein | 0.9493 | 40 | 271 |
GO:0009279
|
| AF-A0A132F449-F1-model_v4 | Nucleoside-specific outer membrane channel protein Tsx | 0.9488 | 38 | 271 |
GO:0009279
|
| AF-A0A3D2SH49-F1-model_v4 | Outer envelope protein | 0.9478 | 125 | 254 |
GO:0009279
|
| AF-A0A855HNE1-F1-model_v4 | deleted | 0.9388 | 163 | 271 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar