F477220

General Info

Members Datasets Scaffolds Average Seq Length
719 330 1438 251

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100039762|Ga0070713_1000397622
Length 288
Sequence MGNETAPDEGQEAVMDSQTPNEALTPNQAQATAARRLDGCTAVVTGASSGIGEATALTLAARGASVVLIARRADRLDALADKIISAGGAALALPADITDADGARAAIDTAAAAFGHARIDILVNNAGVMLLGPAADAPFDEWRRMVDLNLTALLACSHAALPHLLAAAESGPRRVSDMVNISSVAGRQVRLGSGVYNATKHGVGAFSESLRLEFTRRHLRVSLVEPGATDTELREHLRPEVLEAQLKRFAGMERLEAQDIADAVEYIVTRPRHVAINEILVRPTEQDA

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
196 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
249 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
315 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
316 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
317 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
318 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
319 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
322 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
323 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
326 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
327 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 5.15
Rhizosphere 84.84
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100039762 3300005436 Bacteria 3820
2 JGI25406J46586_10051927 3300003203 Bacteria 1369
3 Ga0070658_10032393 3300005327 Bacteria 4201
4 Ga0070658_10096177 3300005327 Bacteria 2445
5 Ga0070658_10404240 3300005327 Bacteria 1173
6 Ga0070658_10407686 3300005327 Bacteria 1168
7 Ga0070676_10004019 3300005328 Bacteria 7721
8 Ga0070683_100000367 3300005329 Bacteria 31252
9 Ga0070683_100001266 3300005329 Bacteria 19233
10 Ga0070683_100013602 3300005329 Bacteria 7101
11 Ga0070683_100097699 3300005329 Bacteria 2763
12 Ga0070683_100362695 3300005329 Bacteria 1380
13 Ga0070683_100640707 3300005329 Bacteria 1017
14 Ga0070683_100713404 3300005329 Bacteria 961
15 Ga0070683_100811855 3300005329 Bacteria 897
16 Ga0070666_10021003 3300005335 Bacteria 4228
17 Ga0070680_100008392 3300005336 Bacteria 7910
18 Ga0070680_100013137 3300005336 Bacteria 6446
19 Ga0070682_100003229 3300005337 Bacteria 9039
20 Ga0070682_100013454 3300005337 Bacteria 4708
21 Ga0070682_100111319 3300005337 Bacteria 1825
22 Ga0070682_100156350 3300005337 Bacteria 1570
23 Ga0068868_100005977 3300005338 Bacteria 8589
24 Ga0068868_100170850 3300005338 Bacteria 1799
25 Ga0070660_100010940 3300005339 Bacteria 6424
26 Ga0070691_10033513 3300005341 Bacteria 2417
27 Ga0070687_100149857 3300005343 Bacteria 1368
28 Ga0070687_100231732 3300005343 Bacteria 1137
29 Ga0070692_10283801 3300005345 Bacteria 1004
30 Ga0070668_100002556 3300005347 Bacteria 13378
31 Ga0070668_100009170 3300005347 Bacteria 7340
32 Ga0070668_100073089 3300005347 Bacteria 2673
33 Ga0070688_100000264 3300005365 Bacteria 27397
34 Ga0070659_100111601 3300005366 Bacteria 2207
35 Ga0070659_100182883 3300005366 Bacteria 1721
36 Ga0070667_100024460 3300005367 Bacteria 5016
37 Ga0070667_100037224 3300005367 Bacteria 4079
38 Ga0070709_10009402 3300005434 Bacteria 5392
39 Ga0070709_10097588 3300005434 Bacteria 1951
40 Ga0070714_100005134 3300005435 Bacteria 9962
41 Ga0070714_100023417 3300005435 Bacteria 5072
42 Ga0070714_100060026 3300005435 Bacteria 3263
43 Ga0070714_100076229 3300005435 Bacteria 2911
44 Ga0070714_100209914 3300005435 Bacteria 1784
45 Ga0070713_100000014 3300005436 Bacteria 124804
46 Ga0070713_100037557 3300005436 Bacteria 3917
47 Ga0070713_100056839 3300005436 Bacteria 3255
48 Ga0070713_100092423 3300005436 Bacteria 2605
49 Ga0070713_100644150 3300005436 Bacteria 1009
50 Ga0070711_100017399 3300005439 Bacteria 4576
51 Ga0070711_100095329 3300005439 Bacteria 2153
52 Ga0070711_100285814 3300005439 Bacteria 1307
53 Ga0070705_100298623 3300005440 Bacteria 1153
54 Ga0070663_100084488 3300005455 Bacteria 2340
55 Ga0070678_100048075 3300005456 Bacteria 3070
56 Ga0070678_100173843 3300005456 Bacteria 1757
57 Ga0070662_100401290 3300005457 Bacteria 1131
58 Ga0070681_10001919 3300005458 Bacteria 18753
59 Ga0070681_10073561 3300005458 Bacteria 3379
60 Ga0070681_10330105 3300005458 Bacteria 1435
61 Ga0068867_100088175 3300005459 Bacteria 2351
62 Ga0070685_10000367 3300005466 Bacteria 27384
63 Ga0070685_10011848 3300005466 Bacteria 4570
64 Ga0070685_10061314 3300005466 Bacteria 2202
65 Ga0070698_100460511 3300005471 Bacteria 1207
66 Ga0070679_100027409 3300005530 Bacteria 5607
67 Ga0070679_100065757 3300005530 Bacteria 3614
68 Ga0070679_100068623 3300005530 Bacteria 3536
69 Ga0070679_100149418 3300005530 Bacteria 2313
70 Ga0070679_100201081 3300005530 Bacteria 1958
71 Ga0070679_100270659 3300005530 Bacteria 1653
72 Ga0070684_100008541 3300005535 Bacteria 8016
73 Ga0070684_100011710 3300005535 Bacteria 6995
74 Ga0070684_100092232 3300005535 Bacteria 2695
75 Ga0070684_100191839 3300005535 Bacteria 1859
76 Ga0070684_100694990 3300005535 Bacteria 948
77 Ga0070697_100254089 3300005536 Bacteria 1503
78 Ga0068853_100038521 3300005539 Bacteria 4072
79 Ga0068853_100104197 3300005539 Bacteria 2511
80 Ga0070686_100113492 3300005544 Bacteria 1850
81 Ga0070665_100001016 3300005548 Bacteria 35289
82 Ga0070665_100001253 3300005548 Bacteria 30634
83 Ga0070665_100001942 3300005548 Bacteria 23317
84 Ga0070665_100058707 3300005548 Bacteria 3856
85 Ga0070665_100065022 3300005548 Bacteria 3659
86 Ga0070665_100118137 3300005548 Bacteria 2654
87 Ga0070665_100337967 3300005548 Bacteria 1510
88 Ga0070704_100471840 3300005549 Bacteria 1084
89 Ga0068855_100070210 3300005563 Bacteria 4076
90 Ga0068855_100096778 3300005563 Bacteria 3400
91 Ga0070664_100330432 3300005564 Bacteria 1383
92 Ga0068857_100107922 3300005577 Bacteria 2501
93 Ga0068857_100209374 3300005577 Bacteria 1779
94 Ga0068857_100234471 3300005577 Bacteria 1679
95 Ga0068857_100259101 3300005577 Bacteria 1596
96 Ga0068857_100971713 3300005577 Bacteria 817
97 Ga0068854_100043732 3300005578 Bacteria 3176
98 Ga0068854_100050142 3300005578 Bacteria 2985
99 Ga0068854_100314339 3300005578 Bacteria 1271
100 Ga0068856_100059412 3300005614 Bacteria 3777
101 Ga0068856_100069549 3300005614 Bacteria 3481
102 Ga0070702_100088129 3300005615 Bacteria 1876
103 Ga0068852_100012907 3300005616 Bacteria 6370
104 Ga0068852_100033516 3300005616 Bacteria 4265
105 Ga0068852_100039887 3300005616 Bacteria 3957
106 Ga0068852_100065194 3300005616 Bacteria 3177
107 Ga0068852_100082727 3300005616 Bacteria 2853
108 Ga0068852_100551630 3300005616 Bacteria 1153
109 Ga0068864_100001159 3300005618 Bacteria 21922
110 Ga0068864_100092121 3300005618 Bacteria 2675
111 Ga0068864_100280504 3300005618 Bacteria 1555
112 Ga0068866_10017877 3300005718 Bacteria 3196
113 Ga0068861_100066325 3300005719 Bacteria 2782
114 Ga0068861_100101926 3300005719 Bacteria 2285
115 Ga0068861_100279504 3300005719 Bacteria 1437
116 Ga0068851_10034245 3300005834 Bacteria 2534
117 Ga0068870_10247712 3300005840 Bacteria 1103
118 Ga0068863_100093303 3300005841 Bacteria 2856
119 Ga0068863_100369225 3300005841 Bacteria 1400
120 Ga0068858_100451182 3300005842 Bacteria 1239
121 Ga0068860_100000300 3300005843 Bacteria 68717
122 Ga0068860_100040605 3300005843 Bacteria 4447
123 Ga0068860_100112974 3300005843 Bacteria 2597
124 Ga0068862_100005926 3300005844 Bacteria 10177
125 Ga0068862_100102209 3300005844 Bacteria 2509
126 Ga0081455_10002270 3300005937 Bacteria 22922
127 Ga0081455_10003612 3300005937 Bacteria 17730
128 Ga0081455_10256661 3300005937 Bacteria 1275
129 Ga0081538_10007805 3300005981 Bacteria 9191
130 Ga0081538_10008592 3300005981 Bacteria 8641
131 Ga0081540_1068029 3300005983 Bacteria 1661
132 Ga0081539_10000674 3300005985 Bacteria 68446
133 Ga0081539_10003868 3300005985 Bacteria 17519
134 Ga0081539_10006570 3300005985 Bacteria 11071
135 Ga0070717_10001875 3300006028 Bacteria 14687
136 Ga0070717_10020138 3300006028 Bacteria 5242
137 Ga0070717_10036134 3300006028 Bacteria 4004
138 Ga0070717_10105738 3300006028 Bacteria 2396
139 Ga0070717_10275913 3300006028 Bacteria 1490
140 Ga0075365_10012122 3300006038 Bacteria 5103
141 Ga0075365_10038387 3300006038 Bacteria 3113
142 Ga0075365_10075355 3300006038 Bacteria 2277
143 Ga0075365_10292375 3300006038 Bacteria 1146
144 Ga0075365_10419699 3300006038 Bacteria 944
145 Ga0075363_100015072 3300006048 Bacteria 3792
146 Ga0075363_100085254 3300006048 Bacteria 1733
147 Ga0075364_10006646 3300006051 Bacteria 6814
148 Ga0075364_10033243 3300006051 Bacteria 3319
149 Ga0075364_10034571 3300006051 Bacteria 3262
150 Ga0075364_10335108 3300006051 Bacteria 1031
151 Ga0070712_100017081 3300006175 Bacteria 4692
152 Ga0070712_100058851 3300006175 Bacteria 2704
153 Ga0070712_100169037 3300006175 Bacteria 1695
154 Ga0070712_100175181 3300006175 Bacteria 1667
155 Ga0097621_100225335 3300006237 Bacteria 1635
156 Ga0075370_10014440 3300006353 Bacteria 4213
157 Ga0075428_100020127 3300006844 Bacteria 7389
158 Ga0075431_100048368 3300006847 Bacteria 4386
159 Ga0075431_100287787 3300006847 Bacteria 1663
160 Ga0075433_10072500 3300006852 Bacteria 3028
161 Ga0075434_100051529 3300006871 Bacteria 4091
162 Ga0075429_100032211 3300006880 Bacteria 4556
163 Ga0075429_100072261 3300006880 Bacteria 3004
164 Ga0068865_100272323 3300006881 Bacteria 1345
165 Ga0068865_100318234 3300006881 Bacteria 1251
166 Ga0075436_100100312 3300006914 Bacteria 2016
167 Ga0075435_100000878 3300007076 Bacteria 18862
168 Ga0075435_100376155 3300007076 Bacteria 1220
169 Ga0105240_10057269 3300009093 Bacteria 4870
170 Ga0105240_10262051 3300009093 Bacteria 1993
171 Ga0105240_10731682 3300009093 Bacteria 1077
172 Ga0111539_10009415 3300009094 Bacteria 12326
173 Ga0111539_10216033 3300009094 Bacteria 2234
174 Ga0105245_10033466 3300009098 Bacteria 4557
175 Ga0105245_10216990 3300009098 Bacteria 1844
176 Ga0105245_10347213 3300009098 Bacteria 1469
177 Ga0105247_10248311 3300009101 Bacteria 1215
178 Ga0114129_10006737 3300009147 Bacteria 16311
179 Ga0114129_10018248 3300009147 Bacteria 9991
180 Ga0114129_10071814 3300009147 Bacteria 4826
181 Ga0105243_10107926 3300009148 Bacteria 2323
182 Ga0105243_10236900 3300009148 Bacteria 1622
183 Ga0105241_10127298 3300009174 Bacteria 2058
184 Ga0105242_10015203 3300009176 Bacteria 5977
185 Ga0105248_10095090 3300009177 Bacteria 3355
186 Ga0105248_10108965 3300009177 Bacteria 3123
187 Ga0105237_10593709 3300009545 Bacteria 1114
188 Ga0105238_10019703 3300009551 Bacteria 6870
189 Ga0105238_10128999 3300009551 Bacteria 2507
190 Ga0105238_10157849 3300009551 Bacteria 2244
191 Ga0105238_10213570 3300009551 Bacteria 1906
192 Ga0105238_10239879 3300009551 Bacteria 1790
193 Ga0105249_10008240 3300009553 Bacteria 9076
194 Ga0105249_10070472 3300009553 Bacteria 3227
195 Ga0105249_10219999 3300009553 Bacteria 1868
196 Ga0105249_10528213 3300009553 Bacteria 1228
197 Ga0105239_10093423 3300010375 Bacteria 3321
198 Ga0105239_10232025 3300010375 Bacteria 2070
199 Ga0105246_10376563 3300011119 Bacteria 1171
200 Ga0105246_10554093 3300011119 Bacteria 986
201 Ga0157370_10002478 3300013104 Bacteria 22261
202 Ga0157370_10007993 3300013104 Bacteria 11463
203 Ga0157370_10116911 3300013104 Bacteria 2491
204 Ga0157370_10176350 3300013104 Bacteria 1987
205 Ga0157369_10036670 3300013105 Bacteria 5371
206 Ga0157369_10084451 3300013105 Bacteria 3394
207 Ga0157369_10429183 3300013105 Bacteria 1370
208 Ga0163162_10202951 3300013306 Bacteria 2112
209 Ga0163162_10365535 3300013306 Bacteria 1576
210 Ga0157372_10027336 3300013307 Bacteria 6212
211 Ga0157372_10081050 3300013307 Bacteria 3673
212 Ga0157372_10266756 3300013307 Bacteria 1989
213 Ga0157372_10277065 3300013307 Bacteria 1950
214 Ga0157372_10848419 3300013307 Bacteria 1060
215 Ga0157372_10936303 3300013307 Bacteria 1004
216 Ga0157372_11218295 3300013307 Bacteria 870
217 Ga0157375_10164735 3300013308 Bacteria 2361
218 Ga0157375_10926746 3300013308 Bacteria 1014
219 Ga0163163_10019963 3300014325 Bacteria 6304
220 Ga0163163_10046547 3300014325 Bacteria 4261
221 Ga0182008_10159341 3300014497 Bacteria 1135
222 Ga0157379_10027803 3300014968 Bacteria 5034
223 Ga0157379_10068192 3300014968 Bacteria 3180
224 Ga0157379_10165875 3300014968 Bacteria 1993
225 Ga0157376_10016828 3300014969 Bacteria 5562
226 Ga0157376_10075334 3300014969 Bacteria 2880
227 Ga0157376_10239113 3300014969 Bacteria 1691
228 Ga0163161_10156576 3300017792 Bacteria 1735
229 Ga0206356_10677277 3300020070 Bacteria 1420
230 Ga0206353_11075556 3300020082 Bacteria 3419
231 Ga0206353_11699056 3300020082 Bacteria 1727
232 Ga0213874_10002096 3300021377 Bacteria 4227
233 Ga0213876_10001851 3300021384 Bacteria 12748
234 Ga0213876_10023734 3300021384 Bacteria 3237
235 Ga0213876_10094544 3300021384 Bacteria 1583
236 Ga0213875_10002672 3300021388 Bacteria 10520
237 Ga0213875_10005317 3300021388 Bacteria 6925
238 Ga0213875_10019475 3300021388 Bacteria 3264
239 Ga0213875_10021077 3300021388 Bacteria 3125
240 Ga0213875_10035551 3300021388 Bacteria 2350
241 Ga0213871_10056297 3300021441 Bacteria 1088
242 Ga0207656_10019720 3300025321 Bacteria 2670
243 Ga0207642_10113528 3300025899 Bacteria 1384
244 Ga0207688_10008723 3300025901 Bacteria 5516
245 Ga0207688_10037291 3300025901 Bacteria 2695
246 Ga0207680_10019198 3300025903 Bacteria 3651
247 Ga0207680_10080523 3300025903 Bacteria 2045
248 Ga0207699_10009235 3300025906 Bacteria 4900
249 Ga0207699_10149045 3300025906 Bacteria 1546
250 Ga0207645_10013105 3300025907 Bacteria 5600
251 Ga0207643_10243201 3300025908 Bacteria 1107
252 Ga0207705_10073837 3300025909 Bacteria 2475
253 Ga0207705_10134656 3300025909 Bacteria 1841
254 Ga0207705_10309246 3300025909 Bacteria 1213
255 Ga0207705_10406882 3300025909 Bacteria 1053
256 Ga0207707_10005672 3300025912 Bacteria 10924
257 Ga0207707_10009377 3300025912 Bacteria 8490
258 Ga0207707_10303622 3300025912 Bacteria 1380
259 Ga0207695_10023782 3300025913 Bacteria 6915
260 Ga0207695_10107862 3300025913 Bacteria 2770
261 Ga0207693_10002610 3300025915 Bacteria 15668
262 Ga0207693_10046013 3300025915 Bacteria 3428
263 Ga0207663_10030416 3300025916 Bacteria 3185
264 Ga0207663_10266690 3300025916 Bacteria 1267
265 Ga0207660_10008195 3300025917 Bacteria 6762
266 Ga0207660_10009982 3300025917 Bacteria 6150
267 Ga0207660_10137775 3300025917 Bacteria 1864
268 Ga0207662_10126660 3300025918 Bacteria 1606
269 Ga0207657_10085357 3300025919 Bacteria 2644
270 Ga0207657_10129502 3300025919 Bacteria 2070
271 Ga0207649_10125567 3300025920 Bacteria 1736
272 Ga0207649_10297379 3300025920 Bacteria 1179
273 Ga0207652_10030121 3300025921 Bacteria 4542
274 Ga0207652_10042894 3300025921 Bacteria 3851
275 Ga0207652_10140571 3300025921 Bacteria 2158
276 Ga0207646_10105289 3300025922 Bacteria 2530
277 Ga0207646_10475211 3300025922 Bacteria 1127
278 Ga0207694_10029100 3300025924 Bacteria 4213
279 Ga0207694_10125340 3300025924 Bacteria 2054
280 Ga0207694_10302017 3300025924 Bacteria 1318
281 Ga0207694_10409246 3300025924 Bacteria 1129
282 Ga0207659_10000032 3300025926 Bacteria 119492
283 Ga0207659_10119193 3300025926 Unclassified 2020
284 Ga0207687_10224371 3300025927 Bacteria 1481
285 Ga0207687_10262570 3300025927 Bacteria 1377
286 Ga0207700_10000009 3300025928 Bacteria 314953
287 Ga0207700_10022389 3300025928 Bacteria 4336
288 Ga0207700_10028661 3300025928 Bacteria 3919
289 Ga0207700_10368996 3300025928 Bacteria 1253
290 Ga0207700_10692898 3300025928 Bacteria 909
291 Ga0207664_10000011 3300025929 Bacteria 279264
292 Ga0207664_10001728 3300025929 Bacteria 14380
293 Ga0207664_10012314 3300025929 Bacteria 6110
294 Ga0207664_10189621 3300025929 Bacteria 1769
295 Ga0207664_10203403 3300025929 Bacteria 1710
296 Ga0207664_10212655 3300025929 Bacteria 1674
297 Ga0207664_10629117 3300025929 Bacteria 964
298 Ga0207690_10022667 3300025932 Bacteria 3909
299 Ga0207690_10159493 3300025932 Bacteria 1680
300 Ga0207706_10007843 3300025933 Bacteria 9853
301 Ga0207706_10029980 3300025933 Bacteria 4855
302 Ga0207686_10193311 3300025934 Bacteria 1452
303 Ga0207709_10012974 3300025935 Unclassified 4594
304 Ga0207709_10024288 3300025935 Bacteria 3459
305 Ga0207704_10030754 3300025938 Bacteria 3015
306 Ga0207704_10326017 3300025938 Bacteria 1186
307 Ga0207665_10047767 3300025939 Bacteria 2870
308 Ga0207711_10121037 3300025941 Bacteria 2336
309 Ga0207689_10064137 3300025942 Bacteria 3023
310 Ga0207661_10000064 3300025944 Bacteria 75730
311 Ga0207661_10000086 3300025944 Bacteria 64501
312 Ga0207661_10003251 3300025944 Bacteria 11265
313 Ga0207661_10013386 3300025944 Bacteria 5991
314 Ga0207661_10051168 3300025944 Bacteria 3295
315 Ga0207661_10063534 3300025944 Bacteria 2991
316 Ga0207661_10137192 3300025944 Bacteria 2102
317 Ga0207661_10328711 3300025944 Bacteria 1376
318 Ga0207661_10668114 3300025944 Bacteria 955
319 Ga0207679_10225652 3300025945 Bacteria 1578
320 Ga0207667_10060553 3300025949 Bacteria 3962
321 Ga0207667_10075074 3300025949 Bacteria 3511
322 Ga0207712_10011344 3300025961 Bacteria 5676
323 Ga0207712_10039599 3300025961 Bacteria 3230
324 Ga0207668_10006598 3300025972 Bacteria 6862
325 Ga0207668_10007542 3300025972 Bacteria 6476
326 Ga0207668_10030520 3300025972 Bacteria 3543
327 Ga0207668_10055938 3300025972 Bacteria 2746
328 Ga0207640_10114263 3300025981 Bacteria 1921
329 Ga0207640_10175496 3300025981 Bacteria 1601
330 Ga0207658_10014110 3300025986 Bacteria 5472
331 Ga0207658_10016206 3300025986 Bacteria 5123
332 Ga0207658_10128229 3300025986 Bacteria 2034
333 Ga0207658_10436162 3300025986 Bacteria 1158
334 Ga0207677_10009475 3300026023 Bacteria 5481
335 Ga0207677_10139040 3300026023 Bacteria 1856
336 Ga0207677_10611217 3300026023 Bacteria 958
337 Ga0207703_10523483 3300026035 Bacteria 1116
338 Ga0207639_10610483 3300026041 Bacteria 1007
339 Ga0207708_10197021 3300026075 Bacteria 1606
340 Ga0207702_10006670 3300026078 Bacteria 9926
341 Ga0207702_10138042 3300026078 Bacteria 2202
342 Ga0207702_10201009 3300026078 Bacteria 1847
343 Ga0207702_10435187 3300026078 Bacteria 1270
344 Ga0207641_10272348 3300026088 Bacteria 1589
345 Ga0207648_10021579 3300026089 Bacteria 5788
346 Ga0207648_10150740 3300026089 Bacteria 2052
347 Ga0207676_10102480 3300026095 Bacteria 2376
348 Ga0207676_10167321 3300026095 Bacteria 1912
349 Ga0207674_10029276 3300026116 Bacteria 5799
350 Ga0207674_10042636 3300026116 Bacteria 4685
351 Ga0207674_10249528 3300026116 Bacteria 1722
352 Ga0207674_10435215 3300026116 Bacteria 1268
353 Ga0207675_100005861 3300026118 Bacteria 11732
354 Ga0207675_100048365 3300026118 Bacteria 3970
355 Ga0207675_100309908 3300026118 Bacteria 1539
356 Ga0207683_10070474 3300026121 Bacteria 3088
357 Ga0207698_10014460 3300026142 Bacteria 5248
358 Ga0207698_10023094 3300026142 Bacteria 4340
359 Ga0207698_10449722 3300026142 Bacteria 1243
360 Ga0207698_10781668 3300026142 Bacteria 956
361 Ga0207428_10192690 3300027907 Bacteria 1536
362 Ga0268266_10000368 3300028379 Bacteria 69355
363 Ga0268266_10000985 3300028379 Bacteria 35931
364 Ga0268266_10010943 3300028379 Bacteria 7897
365 Ga0268266_10020084 3300028379 Bacteria 5694
366 Ga0268266_10041449 3300028379 Bacteria 3928
367 Ga0268266_10052232 3300028379 Bacteria 3510
368 Ga0268266_10093982 3300028379 Bacteria 2632
369 Ga0268266_10111342 3300028379 Bacteria 2426
370 Ga0268266_10729345 3300028379 Bacteria 956
371 Ga0268265_10017910 3300028380 Bacteria 4899
372 Ga0268264_10000916 3300028381 Bacteria 30848
373 Ga0268264_10336881 3300028381 Bacteria 1432
374 Ga0265338_10131796 3300028800 Bacteria 1972
375 Ga0265338_10291262 3300028800 Bacteria 1190
376 Ga0265332_10031059 3300031238 Bacteria 2330
377 Ga0265340_10000328 3300031247 Bacteria 25179
378 Ga0265339_10011053 3300031249 Bacteria 5576
379 Ga0265327_10000252 3300031251 Bacteria 106339
380 Ga0265327_10004436 3300031251 Bacteria 12428
381 Ga0265327_10036388 3300031251 Bacteria 2706
382 Ga0265316_10001032 3300031344 Bacteria 30180
383 Ga0307513_10330381 3300031456 Bacteria 1279
384 Ga0307509_10159735 3300031507 Bacteria 2154
385 Ga0307508_10003287 3300031616 Bacteria 16478
386 Ga0265314_10000001 3300031711 Bacteria 3792860
387 Ga0307405_10077793 3300031731 Bacteria 2157
388 Ga0307405_10145182 3300031731 Bacteria 1661
389 Ga0307410_10079628 3300031852 Bacteria 2296
390 Ga0307407_10074387 3300031903 Bacteria 2033
391 Ga0307409_100028650 3300031995 Bacteria 3972
392 Ga0307416_100083149 3300032002 Bacteria 2715
393 Ga0307415_100005899 3300032126 Bacteria 6553
394 Ga0373940_0001638 3300035088 Bacteria 4118
395 Ga0373945_0092688 3300035116 Bacteria 1172
396 Ga0373954_0084089 3300035118 Bacteria 1523
397 Ga0373954_0195018 3300035118 Bacteria 995
398 Ga0373956_0007854 3300035119 Bacteria 4304
399 Ga0373957_0135980 3300035120 Bacteria 1003
400 Ga0373955_0017112 3300035172 Bacteria 3581
401 Ga0373942_0000541 3300035207 Bacteria 10622
402 Ga0373942_0003741 3300035207 Bacteria 3566
403 Ga0373924_0084056 3300035410 Bacteria 1356
404 Ga0373931_0110559 3300035691 Bacteria 1559
405 Ga0373947_0145248 3300035725 Bacteria 1524
406 Ga0373947_0196530 3300035725 Bacteria 1318
407 Ga0373937_0154224 3300036401 Bacteria 2152
408 Ga0373937_0252733 3300036401 Bacteria 1662
409 Ga0373937_0712381 3300036401 Bacteria 950
410 Ga0373925_0006714 3300037068 Bacteria 8441
411 Ga0373925_0007085 3300037068 Bacteria 8192
412 Ga0395899_0045547 3300037312 Bacteria 3268
413 Ga0395900_0024454 3300037418 Bacteria 6186
414 Ga0395900_0025180 3300037418 Bacteria 6092
415 Ga0395900_0216644 3300037418 Bacteria 1932
416 Ga0395898_0481792 3300037466 Bacteria 1180
417 Ga0395905_0084530 3300037471 Bacteria 2973
418 Ga0436364_0095359 3300037853 Bacteria 6594
419 Ga0436364_0303129 3300037853 Bacteria 102080
420 Ga0436364_0627035 3300037853 Bacteria 24912
421 Ga0436364_0681665 3300037853 Bacteria 5057
422 Ga0436364_0705168 3300037853 Bacteria 4072
423 Ga0436364_1352270 3300037853 Bacteria 8904
424 Ga0436364_1478496 3300037853 Bacteria 16430
425 Ga0436364_1551375 3300037853 Bacteria 11285
426 Ga0395901_0015372 3300038443 Bacteria 7790
427 Ga0395901_0062499 3300038443 Bacteria 3875
428 Ga0436365_0312781 3300039437 Bacteria 7282
429 Ga0436365_0726926 3300039437 Bacteria 6791
430 Ga0436365_1877254 3300039437 Bacteria 1073
431 Ga0436360_0038032 3300039438 Bacteria 2968
432 Ga0436363_0550832 3300039450 Bacteria 1174
433 Ga0436363_0867277 3300039450 Bacteria 1011
434 Ga0436363_1521228 3300039450 Bacteria 8468
435 Ga0436362_0543332 3300039453 Bacteria 5991
436 Ga0436362_0703833 3300039453 Bacteria 1317
437 Ga0451793_0771591 3300041452 Bacteria 1883
438 Ga0451795_1511199 3300041456 Bacteria 2479
439 Ga0451833_1264443 3300041491 Bacteria 933
440 Ga0451851_0254194 3300041507 Bacteria 1450
441 Ga0451577_0071618 3300042876 Bacteria 3091
442 Ga0466965_0317878 3300044683 Bacteria 848
443 Ga0466965_0321290 3300044683 Bacteria 843
444 Ga0466966_0020510 3300044684 Bacteria 4344
445 Ga0466966_0187418 3300044684 Bacteria 1254
446 Ga0466961_0012011 3300044693 Bacteria 5534
447 Ga0466963_0018311 3300044694 Bacteria 4376
448 Ga0466963_0049487 3300044694 Bacteria 2780
449 Ga0466963_0135138 3300044694 Bacteria 1706
450 Ga0466963_0135694 3300044694 Bacteria 1702
451 Ga0466963_0304134 3300044694 Bacteria 1122
452 Ga0466963_0376159 3300044694 Bacteria 1001
453 Ga0466968_0112207 3300044735 Bacteria 1227
454 Ga0466968_0230818 3300044735 Bacteria 874
455 Ga0466970_0017202 3300044765 Bacteria 3734
456 Ga0466970_0028646 3300044765 Bacteria 2928
457 Ga0466970_0075208 3300044765 Bacteria 1819
458 Ga0466957_0139875 3300044842 Bacteria 1559
459 Ga0466957_0176159 3300044842 Bacteria 1395
460 Ga0466957_0195240 3300044842 Bacteria 1327
461 Ga0466959_0050866 3300045049 Bacteria 3041
462 Ga0466959_0164657 3300045049 Bacteria 1557
463 Ga0466958_0000570 3300045836 Bacteria 15724
464 Ga0466958_0052723 3300045836 Bacteria 2466
465 Ga0466958_0413678 3300045836 Bacteria 871
466 Ga0466967_0001282 3300045976 Bacteria 14293
467 Ga0466967_0084224 3300045976 Bacteria 2877
468 Ga0495603_0154658 3300046455 Bacteria 1331
469 Ga0495629_0000014 3300046459 Bacteria 201801
470 Ga0495629_0056886 3300046459 Bacteria 2735
471 Ga0495629_0173589 3300046459 Bacteria 1495
472 Ga0495629_0203112 3300046459 Bacteria 1370
473 Ga0495638_0057959 3300046460 Bacteria 2401
474 Ga0495641_0000458 3300046461 Bacteria 33934
475 Ga0495641_0050716 3300046461 Bacteria 1896
476 Ga0495651_0002025 3300046462 Bacteria 15653
477 Ga0495651_0010822 3300046462 Bacteria 7014
478 Ga0495651_0052298 3300046462 Bacteria 3146
479 Ga0495653_0022066 3300046463 Bacteria 5153
480 Ga0495653_0047472 3300046463 Bacteria 3321
481 Ga0495580_0092034 3300046472 Bacteria 2110
482 Ga0495664_0020943 3300046477 Bacteria 3775
483 Ga0495664_0029309 3300046477 Bacteria 3218
484 Ga0495664_0089166 3300046477 Bacteria 1854
485 Ga0495664_0126130 3300046477 Bacteria 1549
486 Ga0495664_0467589 3300046477 Bacteria 754
487 Ga0495594_0004665 3300046499 Bacteria 7062
488 Ga0495594_0070001 3300046499 Bacteria 1950
489 Ga0495594_0203254 3300046499 Bacteria 1129
490 Ga0495594_0351041 3300046499 Bacteria 840
491 Ga0495596_0026131 3300046500 Bacteria 2355
492 Ga0495606_0000045 3300046507 Bacteria 212105
493 Ga0495608_0000001 3300046511 Bacteria 411278
494 Ga0495608_0019178 3300046511 Bacteria 4710
495 Ga0495608_0119271 3300046511 Bacteria 1692
496 Ga0495608_0154441 3300046511 Bacteria 1461
497 Ga0495618_0114763 3300046514 Bacteria 1724
498 Ga0495618_0295936 3300046514 Bacteria 1006
499 Ga0495628_0016675 3300046516 Bacteria 6125
500 Ga0495628_0018592 3300046516 Bacteria 5754
501 Ga0495628_0059027 3300046516 Bacteria 3013
502 Ga0495628_0407157 3300046516 Bacteria 993
503 Ga0495628_0474543 3300046516 Bacteria 906
504 Ga0495630_0000007 3300046517 Bacteria 376915
505 Ga0495630_0015895 3300046517 Bacteria 5500
506 Ga0495630_0081573 3300046517 Bacteria 2441
507 Ga0495630_0129783 3300046517 Bacteria 1914
508 Ga0495630_0254185 3300046517 Bacteria 1342
509 Ga0495630_0374791 3300046517 Bacteria 1090
510 Ga0495630_0440142 3300046517 Bacteria 999
511 Ga0495644_0004379 3300046523 Bacteria 5546
512 Ga0495666_0018463 3300046526 Bacteria 3470
513 Ga0495666_0125372 3300046526 Bacteria 1201
514 Ga0495652_0001417 3300046529 Bacteria 26594
515 Ga0495652_0018674 3300046529 Bacteria 6180
516 Ga0495652_0105079 3300046529 Bacteria 2283
517 Ga0495652_0116019 3300046529 Bacteria 2145
518 Ga0495652_0351063 3300046529 Bacteria 1057
519 Ga0495640_0012581 3300046533 Bacteria 6459
520 Ga0495640_0081433 3300046533 Bacteria 2152
521 Ga0495640_0274284 3300046533 Bacteria 1051
522 Ga0495586_0106389 3300046535 Bacteria 1560
523 Ga0495587_0005401 3300046536 Bacteria 8343
524 Ga0495587_0020628 3300046536 Bacteria 4065
525 Ga0495587_0037897 3300046536 Bacteria 2892
526 Ga0495645_0009153 3300046543 Bacteria 6919
527 Ga0495645_0030110 3300046543 Bacteria 3953
528 Ga0495622_0000016 3300046557 Bacteria 177089
529 Ga0495667_0000482 3300046559 Bacteria 25465
530 Ga0495667_0054392 3300046559 Bacteria 2633
531 Ga0495656_0002127 3300046615 Bacteria 6540
532 Ga0495634_0037433 3300046642 Bacteria 3314
533 Ga0495625_0000020 3300046660 Bacteria 290440
534 Ga0495635_0017531 3300046663 Bacteria 5001
535 Ga0495635_0434093 3300046663 Bacteria 869
536 Ga0495657_0000002 3300046675 Bacteria 411958
537 Ga0495657_0002263 3300046675 Bacteria 16264
538 Ga0495657_0057287 3300046675 Bacteria 2591
539 Ga0495657_0164326 3300046675 Bacteria 1371
540 Ga0495599_0006654 3300046678 Bacteria 6975
541 Ga0495599_0023127 3300046678 Bacteria 3884
542 Ga0495599_0140377 3300046678 Bacteria 1499
543 Ga0495623_0018709 3300046679 Bacteria 4472
544 Ga0495623_0274341 3300046679 Bacteria 940
545 Ga0495646_0010411 3300046680 Bacteria 5910
546 Ga0495647_0007312 3300046681 Bacteria 3694
547 Ga0495647_0063149 3300046681 Bacteria 1466
548 Ga0495647_0194570 3300046681 Bacteria 887
549 Ga0495658_0200589 3300046683 Bacteria 1243
550 Ga0495613_0000040 3300046689 Bacteria 131633
551 Ga0495624_0000140 3300046690 Bacteria 51928
552 Ga0495624_0082521 3300046690 Bacteria 1989
553 Ga0495600_0000589 3300046809 Bacteria 18760
554 Ga0495600_0015133 3300046809 Bacteria 4873
555 Ga0495600_0036003 3300046809 Bacteria 3216
556 Ga0495600_0078692 3300046809 Bacteria 2153
557 Ga0495581_0053767 3300047315 Bacteria 2325
558 Ga0495581_0070790 3300047315 Bacteria 2018
559 Ga0495604_0001037 3300047317 Bacteria 23128
560 Ga0495604_0002241 3300047317 Bacteria 15481
561 Ga0495604_0019729 3300047317 Bacteria 5393
562 Ga0495604_0020654 3300047317 Bacteria 5258
563 Ga0495604_0167948 3300047317 Bacteria 1545
564 Ga0495674_0006097 3300047319 Bacteria 11576
565 Ga0495674_0013967 3300047319 Bacteria 7532
566 Ga0495674_0016817 3300047319 Bacteria 6821
567 Ga0495674_0020302 3300047319 Bacteria 6153
568 Ga0495674_0193404 3300047319 Bacteria 1690
569 Ga0495674_0208976 3300047319 Bacteria 1617
570 Ga0495676_0028659 3300047321 Bacteria 4751
571 Ga0495676_0204710 3300047321 Bacteria 1369
572 Ga0495676_0389778 3300047321 Bacteria 926
573 Ga0495680_0000725 3300047322 Bacteria 37092
574 Ga0495680_0025767 3300047322 Bacteria 4862
575 Ga0495680_0026857 3300047322 Bacteria 4739
576 Ga0495680_0108621 3300047322 Bacteria 2058
577 Ga0495675_0000019 3300047444 Bacteria 113641
578 Ga0495675_0006443 3300047444 Bacteria 7186
579 Ga0495675_0168827 3300047444 Bacteria 1344
580 Ga0495679_059463 3300047446 Bacteria 1124
581 Ga0495684_0012578 3300047471 Bacteria 6524
582 Ga0495684_0051187 3300047471 Bacteria 3152
583 Ga0495684_0085359 3300047471 Bacteria 2394
584 Ga0495684_0254196 3300047471 Bacteria 1277
585 Ga0495686_0000011 3300047472 Bacteria 514750
586 Ga0495686_0019502 3300047472 Bacteria 4531
587 Ga0495686_0033951 3300047472 Bacteria 3289
588 Ga0495686_0083162 3300047472 Bacteria 1953
589 Ga0495686_0141520 3300047472 Bacteria 1419
590 Ga0495593_0010078 3300047673 Bacteria 5471
591 Ga0495602_0000010 3300048088 Bacteria 212121
592 Ga0495602_0048860 3300048088 Bacteria 3796
593 Ga0495602_0056686 3300048088 Bacteria 3443
594 Ga0495602_0065465 3300048088 Bacteria 3136
595 Ga0496100_0082798 3300048903 Bacteria 2171
596 Ga0496100_0228874 3300048903 Bacteria 1367
597 Ga0496101_0090252 3300048904 Bacteria 2279
598 Ga0496101_0564439 3300048904 Bacteria 900
599 Ga0496102_0246154 3300048905 Bacteria 1686
600 Ga0496103_0162019 3300048906 Bacteria 1435
601 Ga0496104_0042652 3300048907 Bacteria 4258
602 Ga0496104_0055663 3300048907 Bacteria 3740
603 Ga0496104_0061720 3300048907 Bacteria 3554
604 Ga0496104_0149827 3300048907 Bacteria 2240
605 Ga0496105_0036671 3300048908 Bacteria 4040
606 Ga0496106_0525605 3300048909 Bacteria 950
607 Ga0496108_0010390 3300048911 Bacteria 7560
608 Ga0496108_0010761 3300048911 Bacteria 7426
609 Ga0496108_0057522 3300048911 Bacteria 3267
610 Ga0496108_0388960 3300048911 Bacteria 1218
611 Ga0496108_0436266 3300048911 Bacteria 1144
612 Ga0496109_0000146 3300048912 Bacteria 69777
613 Ga0496109_0033803 3300048912 Bacteria 4602
614 Ga0496109_0134526 3300048912 Bacteria 2309
615 Ga0496109_0302115 3300048912 Bacteria 1509
616 Ga0496109_0425053 3300048912 Bacteria 1255
617 Ga0496109_0903004 3300048912 Bacteria 821
618 Ga0496110_0038646 3300048913 Bacteria 4154
619 Ga0496110_0082055 3300048913 Bacteria 2875
620 Ga0496110_0103090 3300048913 Bacteria 2559
621 Ga0496111_0059243 3300048914 Bacteria 2774
622 Ga0496112_0266045 3300048915 Bacteria 1663
623 Ga0496112_0332440 3300048915 Bacteria 1463
624 Ga0496112_0432121 3300048915 Bacteria 1255
625 Ga0496113_0022574 3300048916 Bacteria 4453
626 Ga0496114_0019897 3300048917 Bacteria 5444
627 Ga0496114_0028906 3300048917 Bacteria 4554
628 Ga0496114_0066182 3300048917 Bacteria 3029
629 Ga0496115_0208356 3300048918 Bacteria 1615
630 Ga0496116_0000974 3300048919 Bacteria 35126
631 Ga0496117_0001121 3300048920 Bacteria 40383
632 Ga0496117_0066766 3300048920 Bacteria 2438
633 Ga0496118_0001722 3300048921 Bacteria 31878
634 Ga0496119_0001485 3300048922 Bacteria 28118
635 Ga0496119_0002117 3300048922 Bacteria 22364
636 Ga0496119_0047161 3300048922 Bacteria 2683
637 Ga0496120_0010049 3300048923 Bacteria 6643
638 Ga0496121_0036996 3300048924 Bacteria 4341
639 Ga0496121_0143341 3300048924 Bacteria 1769
640 Ga0496124_0049683 3300048927 Bacteria 3577
641 Ga0496124_0076314 3300048927 Bacteria 2767
642 Ga0496124_0110889 3300048927 Bacteria 2208
643 Ga0496124_0378910 3300048927 Bacteria 990
644 Ga0496125_0054704 3300048928 Bacteria 3259
645 Ga0496126_0055845 3300048929 Bacteria 3571
646 Ga0496126_0156024 3300048929 Bacteria 1953
647 Ga0501031_0003941 3300049568 Bacteria 9559
648 Ga0501032_0077586 3300049569 Bacteria 2211
649 Ga0501033_0010193 3300049570 Bacteria 7215
650 Ga0501036_0057162 3300049572 Bacteria 3304
651 Ga0501037_0012053 3300049573 Bacteria 6366
652 Ga0501038_0007956 3300049574 Bacteria 9766
653 Ga0501039_0014075 3300049575 Bacteria 6124
654 Ga0501042_0352806 3300049578 Bacteria 1064
655 Ga0501046_0006817 3300049580 Bacteria 10082
656 Ga0501047_0024892 3300049581 Bacteria 5748
657 Ga0501047_0026419 3300049581 Bacteria 5585
658 Ga0501047_0080265 3300049581 Bacteria 3135
659 Ga0501048_0054213 3300049582 Bacteria 2848
660 Ga0501067_0005800 3300049583 Bacteria 6857
661 Ga0501068_0027701 3300049584 Bacteria 3347
662 Ga0501069_0013431 3300049585 Bacteria 4367
663 Ga0501070_0000793 3300049586 Bacteria 28685
664 Ga0501070_0089322 3300049586 Bacteria 2550
665 Ga0501073_0031509 3300049589 Bacteria 3782
666 Ga0501074_0096490 3300049590 Bacteria 2117
667 Ga0501079_0319898 3300049741 Bacteria 1215
668 Ga0501080_0040031 3300049742 Bacteria 4373
669 Ga0501080_0332760 3300049742 Bacteria 1373
670 Ga0501080_0537436 3300049742 Bacteria 1042
671 Ga0501083_0150208 3300049744 Bacteria 1525
672 Ga0501035_0043244 3300049822 Bacteria 4060
673 Ga0501035_0321467 3300049822 Bacteria 1300
674 Ga0501044_0368580 3300049823 Bacteria 1353
675 Ga0501044_0424541 3300049823 Bacteria 1239
676 Ga0501045_0026308 3300049824 Bacteria 4185
677 nmdc:mga03n38_47729_c1 3300050490 Bacteria 1897
678 nmdc:mga03n38_59040_c1 3300050490 Bacteria 1740
679 nmdc:mga00v17_40404_c1 3300050491 Bacteria 2798
680 nmdc:mga0yw44_10338_c1 3300050492 Bacteria 4762
681 nmdc:mga07m45_92978_c1 3300050496 Bacteria 1729
682 nmdc:mga05p37_213786_c1 3300050507 Bacteria 2330
683 nmdc:mga05p37_278051_c1 3300050507 Bacteria 1998
684 nmdc:mga05p37_429790_c1 3300050507 Bacteria 1534
685 nmdc:mga09592_128617_c1 3300050508 Bacteria 2178
686 nmdc:mga0qj67_106239_c1 3300050509 Bacteria 2265
687 nmdc:mga0qj67_347304_c1 3300050509 Bacteria 1200
688 nmdc:mga08y16_20921_c1 3300050511 Bacteria 6908
689 nmdc:mga08y16_4896_c1 3300050511 Bacteria 13995
690 nmdc:mga0n895_18716_c1 3300050512 Bacteria 6417
691 nmdc:mga0rr50_26966_c1 3300050513 Bacteria 4017
692 nmdc:mga08x19_482073_c1 3300050514 Bacteria 874
693 Ga0495601_0000012 3300053077 Bacteria 227853
694 Ga0495601_0051263 3300053077 Bacteria 2605
695 Ga0495601_0088431 3300053077 Bacteria 1992
696 Ga0495601_0390629 3300053077 Bacteria 902
697 Ga0495612_0000403 3300053078 Bacteria 17309
698 Ga0495612_0023730 3300053078 Bacteria 2462
699 Ga0495595_0000001 3300053084 Bacteria 495226
700 Ga0495595_0004192 3300053084 Bacteria 5798
701 Ga0495619_0000046 3300053085 Bacteria 104451
702 Ga0495619_0030330 3300053085 Bacteria 3500
703 Ga0495619_0098832 3300053085 Bacteria 1984
704 Ga0495619_0107500 3300053085 Bacteria 1903
705 Ga0500644_0059663 3300053088 Bacteria 1339
706 Ga0500646_0049581 3300053090 Bacteria 1207
707 Ga0500566_0143888 3300053094 Bacteria 1262
708 Ga0500641_0005990 3300053096 Bacteria 4302
709 Ga0500650_0040525 3300053098 Bacteria 2149
710 Ga0500654_060384 3300053099 Bacteria 1947
711 Ga0500556_0000702 3300053104 Bacteria 20467
712 Ga0500595_004709 3300053119 Bacteria 6058
713 Ga0500588_0014164 3300053146 Bacteria 2015
714 Ga0500599_006533 3300053736 Bacteria 1486
715 Ga0501084_0065773 3300054114 Bacteria 3034
716 Ga0501082_0023266 3300060353 Bacteria 5345
717 Ga0466962_0011727 3300061719 Bacteria 4220
718 Ga0466962_0052921 3300061719 Bacteria 1940
719 Ga0466962_0094173 3300061719 Bacteria 1436
720 Ga0070713_100039762
721 JGI25406J46586_10051927
722 Ga0070658_10032393
723 Ga0070658_10096177
724 Ga0070658_10404240
725 Ga0070658_10407686
726 Ga0070676_10004019
727 Ga0070683_100000367
728 Ga0070683_100001266
729 Ga0070683_100013602
730 Ga0070683_100097699
731 Ga0070683_100362695
732 Ga0070683_100640707
733 Ga0070683_100713404
734 Ga0070683_100811855
735 Ga0070666_10021003
736 Ga0070680_100008392
737 Ga0070680_100013137
738 Ga0070682_100003229
739 Ga0070682_100013454
740 Ga0070682_100111319
741 Ga0070682_100156350
742 Ga0068868_100005977
743 Ga0068868_100170850
744 Ga0070660_100010940
745 Ga0070691_10033513
746 Ga0070687_100149857
747 Ga0070687_100231732
748 Ga0070692_10283801
749 Ga0070668_100002556
750 Ga0070668_100009170
751 Ga0070668_100073089
752 Ga0070688_100000264
753 Ga0070659_100111601
754 Ga0070659_100182883
755 Ga0070667_100024460
756 Ga0070667_100037224
757 Ga0070709_10009402
758 Ga0070709_10097588
759 Ga0070714_100005134
760 Ga0070714_100023417
761 Ga0070714_100060026
762 Ga0070714_100076229
763 Ga0070714_100209914
764 Ga0070713_100000014
765 Ga0070713_100037557
766 Ga0070713_100056839
767 Ga0070713_100092423
768 Ga0070713_100644150
769 Ga0070711_100017399
770 Ga0070711_100095329
771 Ga0070711_100285814
772 Ga0070705_100298623
773 Ga0070663_100084488
774 Ga0070678_100048075
775 Ga0070678_100173843
776 Ga0070662_100401290
777 Ga0070681_10001919
778 Ga0070681_10073561
779 Ga0070681_10330105
780 Ga0068867_100088175
781 Ga0070685_10000367
782 Ga0070685_10011848
783 Ga0070685_10061314
784 Ga0070698_100460511
785 Ga0070679_100027409
786 Ga0070679_100065757
787 Ga0070679_100068623
788 Ga0070679_100149418
789 Ga0070679_100201081
790 Ga0070679_100270659
791 Ga0070684_100008541
792 Ga0070684_100011710
793 Ga0070684_100092232
794 Ga0070684_100191839
795 Ga0070684_100694990
796 Ga0070697_100254089
797 Ga0068853_100038521
798 Ga0068853_100104197
799 Ga0070686_100113492
800 Ga0070665_100001016
801 Ga0070665_100001253
802 Ga0070665_100001942
803 Ga0070665_100058707
804 Ga0070665_100065022
805 Ga0070665_100118137
806 Ga0070665_100337967
807 Ga0070704_100471840
808 Ga0068855_100070210
809 Ga0068855_100096778
810 Ga0070664_100330432
811 Ga0068857_100107922
812 Ga0068857_100209374
813 Ga0068857_100234471
814 Ga0068857_100259101
815 Ga0068857_100971713
816 Ga0068854_100043732
817 Ga0068854_100050142
818 Ga0068854_100314339
819 Ga0068856_100059412
820 Ga0068856_100069549
821 Ga0070702_100088129
822 Ga0068852_100012907
823 Ga0068852_100033516
824 Ga0068852_100039887
825 Ga0068852_100065194
826 Ga0068852_100082727
827 Ga0068852_100551630
828 Ga0068864_100001159
829 Ga0068864_100092121
830 Ga0068864_100280504
831 Ga0068866_10017877
832 Ga0068861_100066325
833 Ga0068861_100101926
834 Ga0068861_100279504
835 Ga0068851_10034245
836 Ga0068870_10247712
837 Ga0068863_100093303
838 Ga0068863_100369225
839 Ga0068858_100451182
840 Ga0068860_100000300
841 Ga0068860_100040605
842 Ga0068860_100112974
843 Ga0068862_100005926
844 Ga0068862_100102209
845 Ga0081455_10002270
846 Ga0081455_10003612
847 Ga0081455_10256661
848 Ga0081538_10007805
849 Ga0081538_10008592
850 Ga0081540_1068029
851 Ga0081539_10000674
852 Ga0081539_10003868
853 Ga0081539_10006570
854 Ga0070717_10001875
855 Ga0070717_10020138
856 Ga0070717_10036134
857 Ga0070717_10105738
858 Ga0070717_10275913
859 Ga0075365_10012122
860 Ga0075365_10038387
861 Ga0075365_10075355
862 Ga0075365_10292375
863 Ga0075365_10419699
864 Ga0075363_100015072
865 Ga0075363_100085254
866 Ga0075364_10006646
867 Ga0075364_10033243
868 Ga0075364_10034571
869 Ga0075364_10335108
870 Ga0070712_100017081
871 Ga0070712_100058851
872 Ga0070712_100169037
873 Ga0070712_100175181
874 Ga0097621_100225335
875 Ga0075370_10014440
876 Ga0075428_100020127
877 Ga0075431_100048368
878 Ga0075431_100287787
879 Ga0075433_10072500
880 Ga0075434_100051529
881 Ga0075429_100032211
882 Ga0075429_100072261
883 Ga0068865_100272323
884 Ga0068865_100318234
885 Ga0075436_100100312
886 Ga0075435_100000878
887 Ga0075435_100376155
888 Ga0105240_10057269
889 Ga0105240_10262051
890 Ga0105240_10731682
891 Ga0111539_10009415
892 Ga0111539_10216033
893 Ga0105245_10033466
894 Ga0105245_10216990
895 Ga0105245_10347213
896 Ga0105247_10248311
897 Ga0114129_10006737
898 Ga0114129_10018248
899 Ga0114129_10071814
900 Ga0105243_10107926
901 Ga0105243_10236900
902 Ga0105241_10127298
903 Ga0105242_10015203
904 Ga0105248_10095090
905 Ga0105248_10108965
906 Ga0105237_10593709
907 Ga0105238_10019703
908 Ga0105238_10128999
909 Ga0105238_10157849
910 Ga0105238_10213570
911 Ga0105238_10239879
912 Ga0105249_10008240
913 Ga0105249_10070472
914 Ga0105249_10219999
915 Ga0105249_10528213
916 Ga0105239_10093423
917 Ga0105239_10232025
918 Ga0105246_10376563
919 Ga0105246_10554093
920 Ga0157370_10002478
921 Ga0157370_10007993
922 Ga0157370_10116911
923 Ga0157370_10176350
924 Ga0157369_10036670
925 Ga0157369_10084451
926 Ga0157369_10429183
927 Ga0163162_10202951
928 Ga0163162_10365535
929 Ga0157372_10027336
930 Ga0157372_10081050
931 Ga0157372_10266756
932 Ga0157372_10277065
933 Ga0157372_10848419
934 Ga0157372_10936303
935 Ga0157372_11218295
936 Ga0157375_10164735
937 Ga0157375_10926746
938 Ga0163163_10019963
939 Ga0163163_10046547
940 Ga0182008_10159341
941 Ga0157379_10027803
942 Ga0157379_10068192
943 Ga0157379_10165875
944 Ga0157376_10016828
945 Ga0157376_10075334
946 Ga0157376_10239113
947 Ga0163161_10156576
948 Ga0206356_10677277
949 Ga0206353_11075556
950 Ga0206353_11699056
951 Ga0213874_10002096
952 Ga0213876_10001851
953 Ga0213876_10023734
954 Ga0213876_10094544
955 Ga0213875_10002672
956 Ga0213875_10005317
957 Ga0213875_10019475
958 Ga0213875_10021077
959 Ga0213875_10035551
960 Ga0213871_10056297
961 Ga0207656_10019720
962 Ga0207642_10113528
963 Ga0207688_10008723
964 Ga0207688_10037291
965 Ga0207680_10019198
966 Ga0207680_10080523
967 Ga0207699_10009235
968 Ga0207699_10149045
969 Ga0207645_10013105
970 Ga0207643_10243201
971 Ga0207705_10073837
972 Ga0207705_10134656
973 Ga0207705_10309246
974 Ga0207705_10406882
975 Ga0207707_10005672
976 Ga0207707_10009377
977 Ga0207707_10303622
978 Ga0207695_10023782
979 Ga0207695_10107862
980 Ga0207693_10002610
981 Ga0207693_10046013
982 Ga0207663_10030416
983 Ga0207663_10266690
984 Ga0207660_10008195
985 Ga0207660_10009982
986 Ga0207660_10137775
987 Ga0207662_10126660
988 Ga0207657_10085357
989 Ga0207657_10129502
990 Ga0207649_10125567
991 Ga0207649_10297379
992 Ga0207652_10030121
993 Ga0207652_10042894
994 Ga0207652_10140571
995 Ga0207646_10105289
996 Ga0207646_10475211
997 Ga0207694_10029100
998 Ga0207694_10125340
999 Ga0207694_10302017
1000 Ga0207694_10409246
1001 Ga0207659_10000032
1002 Ga0207659_10119193
1003 Ga0207687_10224371
1004 Ga0207687_10262570
1005 Ga0207700_10000009
1006 Ga0207700_10022389
1007 Ga0207700_10028661
1008 Ga0207700_10368996
1009 Ga0207700_10692898
1010 Ga0207664_10000011
1011 Ga0207664_10001728
1012 Ga0207664_10012314
1013 Ga0207664_10189621
1014 Ga0207664_10203403
1015 Ga0207664_10212655
1016 Ga0207664_10629117
1017 Ga0207690_10022667
1018 Ga0207690_10159493
1019 Ga0207706_10007843
1020 Ga0207706_10029980
1021 Ga0207686_10193311
1022 Ga0207709_10012974
1023 Ga0207709_10024288
1024 Ga0207704_10030754
1025 Ga0207704_10326017
1026 Ga0207665_10047767
1027 Ga0207711_10121037
1028 Ga0207689_10064137
1029 Ga0207661_10000064
1030 Ga0207661_10000086
1031 Ga0207661_10003251
1032 Ga0207661_10013386
1033 Ga0207661_10051168
1034 Ga0207661_10063534
1035 Ga0207661_10137192
1036 Ga0207661_10328711
1037 Ga0207661_10668114
1038 Ga0207679_10225652
1039 Ga0207667_10060553
1040 Ga0207667_10075074
1041 Ga0207712_10011344
1042 Ga0207712_10039599
1043 Ga0207668_10006598
1044 Ga0207668_10007542
1045 Ga0207668_10030520
1046 Ga0207668_10055938
1047 Ga0207640_10114263
1048 Ga0207640_10175496
1049 Ga0207658_10014110
1050 Ga0207658_10016206
1051 Ga0207658_10128229
1052 Ga0207658_10436162
1053 Ga0207677_10009475
1054 Ga0207677_10139040
1055 Ga0207677_10611217
1056 Ga0207703_10523483
1057 Ga0207639_10610483
1058 Ga0207708_10197021
1059 Ga0207702_10006670
1060 Ga0207702_10138042
1061 Ga0207702_10201009
1062 Ga0207702_10435187
1063 Ga0207641_10272348
1064 Ga0207648_10021579
1065 Ga0207648_10150740
1066 Ga0207676_10102480
1067 Ga0207676_10167321
1068 Ga0207674_10029276
1069 Ga0207674_10042636
1070 Ga0207674_10249528
1071 Ga0207674_10435215
1072 Ga0207675_100005861
1073 Ga0207675_100048365
1074 Ga0207675_100309908
1075 Ga0207683_10070474
1076 Ga0207698_10014460
1077 Ga0207698_10023094
1078 Ga0207698_10449722
1079 Ga0207698_10781668
1080 Ga0207428_10192690
1081 Ga0268266_10000368
1082 Ga0268266_10000985
1083 Ga0268266_10010943
1084 Ga0268266_10020084
1085 Ga0268266_10041449
1086 Ga0268266_10052232
1087 Ga0268266_10093982
1088 Ga0268266_10111342
1089 Ga0268266_10729345
1090 Ga0268265_10017910
1091 Ga0268264_10000916
1092 Ga0268264_10336881
1093 Ga0265338_10131796
1094 Ga0265338_10291262
1095 Ga0265332_10031059
1096 Ga0265340_10000328
1097 Ga0265339_10011053
1098 Ga0265327_10000252
1099 Ga0265327_10004436
1100 Ga0265327_10036388
1101 Ga0265316_10001032
1102 Ga0307513_10330381
1103 Ga0307509_10159735
1104 Ga0307508_10003287
1105 Ga0265314_10000001
1106 Ga0307405_10077793
1107 Ga0307405_10145182
1108 Ga0307410_10079628
1109 Ga0307407_10074387
1110 Ga0307409_100028650
1111 Ga0307416_100083149
1112 Ga0307415_100005899
1113 Ga0373940_0001638
1114 Ga0373945_0092688
1115 Ga0373954_0084089
1116 Ga0373954_0195018
1117 Ga0373956_0007854
1118 Ga0373957_0135980
1119 Ga0373955_0017112
1120 Ga0373942_0000541
1121 Ga0373942_0003741
1122 Ga0373924_0084056
1123 Ga0373931_0110559
1124 Ga0373947_0145248
1125 Ga0373947_0196530
1126 Ga0373937_0154224
1127 Ga0373937_0252733
1128 Ga0373937_0712381
1129 Ga0373925_0006714
1130 Ga0373925_0007085
1131 Ga0395899_0045547
1132 Ga0395900_0024454
1133 Ga0395900_0025180
1134 Ga0395900_0216644
1135 Ga0395898_0481792
1136 Ga0395905_0084530
1137 Ga0436364_0095359
1138 Ga0436364_0303129
1139 Ga0436364_0627035
1140 Ga0436364_0681665
1141 Ga0436364_0705168
1142 Ga0436364_1352270
1143 Ga0436364_1478496
1144 Ga0436364_1551375
1145 Ga0395901_0015372
1146 Ga0395901_0062499
1147 Ga0436365_0312781
1148 Ga0436365_0726926
1149 Ga0436365_1877254
1150 Ga0436360_0038032
1151 Ga0436363_0550832
1152 Ga0436363_0867277
1153 Ga0436363_1521228
1154 Ga0436362_0543332
1155 Ga0436362_0703833
1156 Ga0451793_0771591
1157 Ga0451795_1511199
1158 Ga0451833_1264443
1159 Ga0451851_0254194
1160 Ga0451577_0071618
1161 Ga0466965_0317878
1162 Ga0466965_0321290
1163 Ga0466966_0020510
1164 Ga0466966_0187418
1165 Ga0466961_0012011
1166 Ga0466963_0018311
1167 Ga0466963_0049487
1168 Ga0466963_0135138
1169 Ga0466963_0135694
1170 Ga0466963_0304134
1171 Ga0466963_0376159
1172 Ga0466968_0112207
1173 Ga0466968_0230818
1174 Ga0466970_0017202
1175 Ga0466970_0028646
1176 Ga0466970_0075208
1177 Ga0466957_0139875
1178 Ga0466957_0176159
1179 Ga0466957_0195240
1180 Ga0466959_0050866
1181 Ga0466959_0164657
1182 Ga0466958_0000570
1183 Ga0466958_0052723
1184 Ga0466958_0413678
1185 Ga0466967_0001282
1186 Ga0466967_0084224
1187 Ga0495603_0154658
1188 Ga0495629_0000014
1189 Ga0495629_0056886
1190 Ga0495629_0173589
1191 Ga0495629_0203112
1192 Ga0495638_0057959
1193 Ga0495641_0000458
1194 Ga0495641_0050716
1195 Ga0495651_0002025
1196 Ga0495651_0010822
1197 Ga0495651_0052298
1198 Ga0495653_0022066
1199 Ga0495653_0047472
1200 Ga0495580_0092034
1201 Ga0495664_0020943
1202 Ga0495664_0029309
1203 Ga0495664_0089166
1204 Ga0495664_0126130
1205 Ga0495664_0467589
1206 Ga0495594_0004665
1207 Ga0495594_0070001
1208 Ga0495594_0203254
1209 Ga0495594_0351041
1210 Ga0495596_0026131
1211 Ga0495606_0000045
1212 Ga0495608_0000001
1213 Ga0495608_0019178
1214 Ga0495608_0119271
1215 Ga0495608_0154441
1216 Ga0495618_0114763
1217 Ga0495618_0295936
1218 Ga0495628_0016675
1219 Ga0495628_0018592
1220 Ga0495628_0059027
1221 Ga0495628_0407157
1222 Ga0495628_0474543
1223 Ga0495630_0000007
1224 Ga0495630_0015895
1225 Ga0495630_0081573
1226 Ga0495630_0129783
1227 Ga0495630_0254185
1228 Ga0495630_0374791
1229 Ga0495630_0440142
1230 Ga0495644_0004379
1231 Ga0495666_0018463
1232 Ga0495666_0125372
1233 Ga0495652_0001417
1234 Ga0495652_0018674
1235 Ga0495652_0105079
1236 Ga0495652_0116019
1237 Ga0495652_0351063
1238 Ga0495640_0012581
1239 Ga0495640_0081433
1240 Ga0495640_0274284
1241 Ga0495586_0106389
1242 Ga0495587_0005401
1243 Ga0495587_0020628
1244 Ga0495587_0037897
1245 Ga0495645_0009153
1246 Ga0495645_0030110
1247 Ga0495622_0000016
1248 Ga0495667_0000482
1249 Ga0495667_0054392
1250 Ga0495656_0002127
1251 Ga0495634_0037433
1252 Ga0495625_0000020
1253 Ga0495635_0017531
1254 Ga0495635_0434093
1255 Ga0495657_0000002
1256 Ga0495657_0002263
1257 Ga0495657_0057287
1258 Ga0495657_0164326
1259 Ga0495599_0006654
1260 Ga0495599_0023127
1261 Ga0495599_0140377
1262 Ga0495623_0018709
1263 Ga0495623_0274341
1264 Ga0495646_0010411
1265 Ga0495647_0007312
1266 Ga0495647_0063149
1267 Ga0495647_0194570
1268 Ga0495658_0200589
1269 Ga0495613_0000040
1270 Ga0495624_0000140
1271 Ga0495624_0082521
1272 Ga0495600_0000589
1273 Ga0495600_0015133
1274 Ga0495600_0036003
1275 Ga0495600_0078692
1276 Ga0495581_0053767
1277 Ga0495581_0070790
1278 Ga0495604_0001037
1279 Ga0495604_0002241
1280 Ga0495604_0019729
1281 Ga0495604_0020654
1282 Ga0495604_0167948
1283 Ga0495674_0006097
1284 Ga0495674_0013967
1285 Ga0495674_0016817
1286 Ga0495674_0020302
1287 Ga0495674_0193404
1288 Ga0495674_0208976
1289 Ga0495676_0028659
1290 Ga0495676_0204710
1291 Ga0495676_0389778
1292 Ga0495680_0000725
1293 Ga0495680_0025767
1294 Ga0495680_0026857
1295 Ga0495680_0108621
1296 Ga0495675_0000019
1297 Ga0495675_0006443
1298 Ga0495675_0168827
1299 Ga0495679_059463
1300 Ga0495684_0012578
1301 Ga0495684_0051187
1302 Ga0495684_0085359
1303 Ga0495684_0254196
1304 Ga0495686_0000011
1305 Ga0495686_0019502
1306 Ga0495686_0033951
1307 Ga0495686_0083162
1308 Ga0495686_0141520
1309 Ga0495593_0010078
1310 Ga0495602_0000010
1311 Ga0495602_0048860
1312 Ga0495602_0056686
1313 Ga0495602_0065465
1314 Ga0496100_0082798
1315 Ga0496100_0228874
1316 Ga0496101_0090252
1317 Ga0496101_0564439
1318 Ga0496102_0246154
1319 Ga0496103_0162019
1320 Ga0496104_0042652
1321 Ga0496104_0055663
1322 Ga0496104_0061720
1323 Ga0496104_0149827
1324 Ga0496105_0036671
1325 Ga0496106_0525605
1326 Ga0496108_0010390
1327 Ga0496108_0010761
1328 Ga0496108_0057522
1329 Ga0496108_0388960
1330 Ga0496108_0436266
1331 Ga0496109_0000146
1332 Ga0496109_0033803
1333 Ga0496109_0134526
1334 Ga0496109_0302115
1335 Ga0496109_0425053
1336 Ga0496109_0903004
1337 Ga0496110_0038646
1338 Ga0496110_0082055
1339 Ga0496110_0103090
1340 Ga0496111_0059243
1341 Ga0496112_0266045
1342 Ga0496112_0332440
1343 Ga0496112_0432121
1344 Ga0496113_0022574
1345 Ga0496114_0019897
1346 Ga0496114_0028906
1347 Ga0496114_0066182
1348 Ga0496115_0208356
1349 Ga0496116_0000974
1350 Ga0496117_0001121
1351 Ga0496117_0066766
1352 Ga0496118_0001722
1353 Ga0496119_0001485
1354 Ga0496119_0002117
1355 Ga0496119_0047161
1356 Ga0496120_0010049
1357 Ga0496121_0036996
1358 Ga0496121_0143341
1359 Ga0496124_0049683
1360 Ga0496124_0076314
1361 Ga0496124_0110889
1362 Ga0496124_0378910
1363 Ga0496125_0054704
1364 Ga0496126_0055845
1365 Ga0496126_0156024
1366 Ga0501031_0003941
1367 Ga0501032_0077586
1368 Ga0501033_0010193
1369 Ga0501036_0057162
1370 Ga0501037_0012053
1371 Ga0501038_0007956
1372 Ga0501039_0014075
1373 Ga0501042_0352806
1374 Ga0501046_0006817
1375 Ga0501047_0024892
1376 Ga0501047_0026419
1377 Ga0501047_0080265
1378 Ga0501048_0054213
1379 Ga0501067_0005800
1380 Ga0501068_0027701
1381 Ga0501069_0013431
1382 Ga0501070_0000793
1383 Ga0501070_0089322
1384 Ga0501073_0031509
1385 Ga0501074_0096490
1386 Ga0501079_0319898
1387 Ga0501080_0040031
1388 Ga0501080_0332760
1389 Ga0501080_0537436
1390 Ga0501083_0150208
1391 Ga0501035_0043244
1392 Ga0501035_0321467
1393 Ga0501044_0368580
1394 Ga0501044_0424541
1395 Ga0501045_0026308
1396 nmdc:mga03n38_47729_c1
1397 nmdc:mga03n38_59040_c1
1398 nmdc:mga00v17_40404_c1
1399 nmdc:mga0yw44_10338_c1
1400 nmdc:mga07m45_92978_c1
1401 nmdc:mga05p37_213786_c1
1402 nmdc:mga05p37_278051_c1
1403 nmdc:mga05p37_429790_c1
1404 nmdc:mga09592_128617_c1
1405 nmdc:mga0qj67_106239_c1
1406 nmdc:mga0qj67_347304_c1
1407 nmdc:mga08y16_20921_c1
1408 nmdc:mga08y16_4896_c1
1409 nmdc:mga0n895_18716_c1
1410 nmdc:mga0rr50_26966_c1
1411 nmdc:mga08x19_482073_c1
1412 Ga0495601_0000012
1413 Ga0495601_0051263
1414 Ga0495601_0088431
1415 Ga0495601_0390629
1416 Ga0495612_0000403
1417 Ga0495612_0023730
1418 Ga0495595_0000001
1419 Ga0495595_0004192
1420 Ga0495619_0000046
1421 Ga0495619_0030330
1422 Ga0495619_0098832
1423 Ga0495619_0107500
1424 Ga0500644_0059663
1425 Ga0500646_0049581
1426 Ga0500566_0143888
1427 Ga0500641_0005990
1428 Ga0500650_0040525
1429 Ga0500654_060384
1430 Ga0500556_0000702
1431 Ga0500595_004709
1432 Ga0500588_0014164
1433 Ga0500599_006533
1434 Ga0501084_0065773
1435 Ga0501082_0023266
1436 Ga0466962_0011727
1437 Ga0466962_0052921
1438 Ga0466962_0094173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

242

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

277

0.9

PF08659

KR

KR domain

40

219

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.9252 1 227
2jap-assembly1.cif.gz_C clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta-lactamase inhibitor clavulanic acid 0.9173 1 227
3p19-assembly1.cif.gz_A improved nadph-dependent blue fluorescent protein 0.903 6 228
3p19-assembly1.cif.gz_A improved nadph-dependent blue fluorescent protein 0.8802 6 228
5jo9-assembly1.cif.gz_A structural characterization of the thermostable bradyrhizobium japonicum d-sorbitol dehydrogenase 0.8762 6 225
ID Description Score Start End Superfamily
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 47 162 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9374 62 174 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9373 72 174 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9327 6 167 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8969 5 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A656JHR8-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9808 74 227 GO:0016491
AF-A0A0Q6Y5K7-F1-model_v4 Oxidoreductase 0.9749 47 227 GO:0016491
AF-A0A6I2ZWV4-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9742 47 228 GO:0016491
AF-A0A6M4X524-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9742 47 226 GO:0016491
AF-A0A535D350-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9646 5 228 GO:0016491

Map