F477169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 293 | 718 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300025898|Ga0207692_10699898|Ga0207692_106998981 |
| Length | 97 |
| Sequence | LSQGGYSRAARWRANIKSQKKRILRAERERLENRRYTSKIKTYFRRLERAVADGDGGAADTEHRELVQTIDKAVKRGALHRNAGARKKSRASRLRQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 106 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 178 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 195 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 204 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 291 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 293 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.25 |
| Nodule | 0 |
| Rhizoplane | 10.72 |
| Rhizosphere | 82.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1003721 | 3300000549 | Bacteria | 2027 |
| 2 | JGI25407J50210_10012297 | 3300003373 | Bacteria | 2193 |
| 3 | Ga0070658_10993827 | 3300005327 | Bacteria | 730 |
| 4 | Ga0070683_100079293 | 3300005329 | Bacteria | 3073 |
| 5 | Ga0070683_100234465 | 3300005329 | Bacteria | 1745 |
| 6 | Ga0070683_100268237 | 3300005329 | Bacteria | 1624 |
| 7 | Ga0070683_101102070 | 3300005329 | Bacteria | 763 |
| 8 | Ga0070690_101156523 | 3300005330 | Bacteria | 616 |
| 9 | Ga0070670_100399115 | 3300005331 | Bacteria | 1214 |
| 10 | Ga0068869_100091774 | 3300005334 | Bacteria | 2285 |
| 11 | Ga0068869_102157506 | 3300005334 | Unclassified | 501 |
| 12 | Ga0070666_10211469 | 3300005335 | Bacteria | 1366 |
| 13 | Ga0070666_10256104 | 3300005335 | Bacteria | 1240 |
| 14 | Ga0070680_100238447 | 3300005336 | Bacteria | 1537 |
| 15 | Ga0070680_101108248 | 3300005336 | Bacteria | 684 |
| 16 | Ga0070680_101179354 | 3300005336 | Bacteria | 662 |
| 17 | Ga0070682_100007138 | 3300005337 | Bacteria | 6292 |
| 18 | Ga0070682_100047721 | 3300005337 | Bacteria | 2664 |
| 19 | Ga0070682_100077275 | 3300005337 | Bacteria | 2144 |
| 20 | Ga0070682_102035353 | 3300005337 | Bacteria | 506 |
| 21 | Ga0068868_100010050 | 3300005338 | Bacteria | 6837 |
| 22 | Ga0068868_100648830 | 3300005338 | Bacteria | 940 |
| 23 | Ga0068868_100851474 | 3300005338 | Bacteria | 826 |
| 24 | Ga0070660_100031927 | 3300005339 | Bacteria | 3960 |
| 25 | Ga0070689_100246910 | 3300005340 | Bacteria | 1472 |
| 26 | Ga0070689_101107390 | 3300005340 | Unclassified | 708 |
| 27 | Ga0070691_10000036 | 3300005341 | Bacteria | 38327 |
| 28 | Ga0070691_10011903 | 3300005341 | Bacteria | 3982 |
| 29 | Ga0070691_10168754 | 3300005341 | Bacteria | 1133 |
| 30 | Ga0070691_10321939 | 3300005341 | Bacteria | 851 |
| 31 | Ga0070687_100451609 | 3300005343 | Bacteria | 855 |
| 32 | Ga0070687_100991779 | 3300005343 | Bacteria | 608 |
| 33 | Ga0070661_100000121 | 3300005344 | Bacteria | 65344 |
| 34 | Ga0070661_100399284 | 3300005344 | Bacteria | 1087 |
| 35 | Ga0070692_10045198 | 3300005345 | Bacteria | 2270 |
| 36 | Ga0070668_100145669 | 3300005347 | Bacteria | 1912 |
| 37 | Ga0070668_100658453 | 3300005347 | Bacteria | 921 |
| 38 | Ga0070668_101112767 | 3300005347 | Bacteria | 713 |
| 39 | Ga0070669_100169177 | 3300005353 | Bacteria | 1703 |
| 40 | Ga0070669_100259329 | 3300005353 | Bacteria | 1387 |
| 41 | Ga0070669_100653961 | 3300005353 | Unclassified | 884 |
| 42 | Ga0070675_100099857 | 3300005354 | Bacteria | 2444 |
| 43 | Ga0070675_101571817 | 3300005354 | Bacteria | 607 |
| 44 | Ga0070675_101591945 | 3300005354 | Bacteria | 603 |
| 45 | Ga0070671_100270008 | 3300005355 | Bacteria | 1446 |
| 46 | Ga0070671_100519028 | 3300005355 | Bacteria | 1026 |
| 47 | Ga0070671_100716991 | 3300005355 | Bacteria | 868 |
| 48 | Ga0070671_100729946 | 3300005355 | Unclassified | 860 |
| 49 | Ga0070671_101216978 | 3300005355 | Bacteria | 663 |
| 50 | Ga0070674_100108308 | 3300005356 | Bacteria | 2036 |
| 51 | Ga0070674_100452724 | 3300005356 | Unclassified | 1060 |
| 52 | Ga0070674_100738979 | 3300005356 | Bacteria | 845 |
| 53 | Ga0070673_100087760 | 3300005364 | Bacteria | 2536 |
| 54 | Ga0070673_100315934 | 3300005364 | Bacteria | 1379 |
| 55 | Ga0070688_100024878 | 3300005365 | Bacteria | 3539 |
| 56 | Ga0070688_100074839 | 3300005365 | Bacteria | 2176 |
| 57 | Ga0070659_100195893 | 3300005366 | Bacteria | 1662 |
| 58 | Ga0070659_100268641 | 3300005366 | Bacteria | 1416 |
| 59 | Ga0070659_100876186 | 3300005366 | Bacteria | 784 |
| 60 | Ga0070714_100040485 | 3300005435 | Bacteria | 3928 |
| 61 | Ga0070714_100295345 | 3300005435 | Unclassified | 1509 |
| 62 | Ga0070714_100318676 | 3300005435 | Bacteria | 1453 |
| 63 | Ga0070714_101252318 | 3300005435 | Bacteria | 724 |
| 64 | Ga0070714_101686631 | 3300005435 | Bacteria | 619 |
| 65 | Ga0070713_100135837 | 3300005436 | Bacteria | 2173 |
| 66 | Ga0070713_100340851 | 3300005436 | Bacteria | 1389 |
| 67 | Ga0070701_10883995 | 3300005438 | Bacteria | 616 |
| 68 | Ga0070701_11040855 | 3300005438 | Bacteria | 573 |
| 69 | Ga0070711_100001758 | 3300005439 | Bacteria | 12021 |
| 70 | Ga0070711_100197261 | 3300005439 | Bacteria | 1551 |
| 71 | Ga0070711_101403151 | 3300005439 | Unclassified | 608 |
| 72 | Ga0070705_101128450 | 3300005440 | Bacteria | 643 |
| 73 | Ga0070700_100047320 | 3300005441 | Bacteria | 2661 |
| 74 | Ga0070700_100094863 | 3300005441 | Bacteria | 1954 |
| 75 | Ga0070700_100127834 | 3300005441 | Bacteria | 1711 |
| 76 | Ga0070700_101012078 | 3300005441 | Bacteria | 684 |
| 77 | Ga0070694_100951667 | 3300005444 | Bacteria | 711 |
| 78 | Ga0070663_100054355 | 3300005455 | Bacteria | 2862 |
| 79 | Ga0070663_100262763 | 3300005455 | Bacteria | 1370 |
| 80 | Ga0070663_100628260 | 3300005455 | Bacteria | 906 |
| 81 | Ga0070678_100024888 | 3300005456 | Bacteria | 4016 |
| 82 | Ga0070678_100157828 | 3300005456 | Bacteria | 1834 |
| 83 | Ga0070678_101368757 | 3300005456 | Bacteria | 660 |
| 84 | Ga0070662_100285357 | 3300005457 | Bacteria | 1337 |
| 85 | Ga0070662_101661841 | 3300005457 | Bacteria | 551 |
| 86 | Ga0068867_100123876 | 3300005459 | Bacteria | 2001 |
| 87 | Ga0068867_100455530 | 3300005459 | Bacteria | 1091 |
| 88 | Ga0070685_10063306 | 3300005466 | Bacteria | 2171 |
| 89 | Ga0070685_11168132 | 3300005466 | Bacteria | 584 |
| 90 | Ga0070679_100659778 | 3300005530 | Bacteria | 989 |
| 91 | Ga0070679_100949116 | 3300005530 | Bacteria | 804 |
| 92 | Ga0070679_101992604 | 3300005530 | Unclassified | 530 |
| 93 | Ga0070684_100064281 | 3300005535 | Bacteria | 3218 |
| 94 | Ga0070684_100071876 | 3300005535 | Bacteria | 3044 |
| 95 | Ga0070684_100294417 | 3300005535 | Bacteria | 1489 |
| 96 | Ga0070684_100465129 | 3300005535 | Bacteria | 1170 |
| 97 | Ga0070684_101106408 | 3300005535 | Bacteria | 745 |
| 98 | Ga0070684_101594684 | 3300005535 | Bacteria | 616 |
| 99 | Ga0068853_100069447 | 3300005539 | Bacteria | 3065 |
| 100 | Ga0068853_100150063 | 3300005539 | Bacteria | 2098 |
| 101 | Ga0068853_102223912 | 3300005539 | Bacteria | 532 |
| 102 | Ga0070686_100216560 | 3300005544 | Bacteria | 1382 |
| 103 | Ga0070695_100237756 | 3300005545 | Bacteria | 1320 |
| 104 | Ga0070695_100588833 | 3300005545 | Bacteria | 872 |
| 105 | Ga0070696_100694554 | 3300005546 | Bacteria | 829 |
| 106 | Ga0070696_100833335 | 3300005546 | Bacteria | 761 |
| 107 | Ga0070696_101009077 | 3300005546 | Bacteria | 696 |
| 108 | Ga0070693_100128480 | 3300005547 | Bacteria | 1581 |
| 109 | Ga0070693_100471892 | 3300005547 | Unclassified | 885 |
| 110 | Ga0070665_100137122 | 3300005548 | Bacteria | 2450 |
| 111 | Ga0070665_100695140 | 3300005548 | Bacteria | 1030 |
| 112 | Ga0070704_100471076 | 3300005549 | Bacteria | 1085 |
| 113 | Ga0070704_101277544 | 3300005549 | Bacteria | 671 |
| 114 | Ga0070664_100067895 | 3300005564 | Bacteria | 3048 |
| 115 | Ga0070664_100347297 | 3300005564 | Bacteria | 1349 |
| 116 | Ga0068857_100422012 | 3300005577 | Bacteria | 1244 |
| 117 | Ga0068857_100943566 | 3300005577 | Bacteria | 829 |
| 118 | Ga0068857_101159052 | 3300005577 | Bacteria | 748 |
| 119 | Ga0068854_100072013 | 3300005578 | Bacteria | 2530 |
| 120 | Ga0068854_100164987 | 3300005578 | Bacteria | 1719 |
| 121 | Ga0068854_100259550 | 3300005578 | Bacteria | 1391 |
| 122 | Ga0068854_100349091 | 3300005578 | Bacteria | 1210 |
| 123 | Ga0068854_101746285 | 3300005578 | Bacteria | 570 |
| 124 | Ga0068856_100154621 | 3300005614 | Bacteria | 2304 |
| 125 | Ga0068856_100332574 | 3300005614 | Bacteria | 1537 |
| 126 | Ga0068856_100766437 | 3300005614 | Bacteria | 985 |
| 127 | Ga0068856_101029126 | 3300005614 | Bacteria | 842 |
| 128 | Ga0068856_101274202 | 3300005614 | Bacteria | 751 |
| 129 | Ga0070702_100007435 | 3300005615 | Bacteria | 5245 |
| 130 | Ga0070702_100039462 | 3300005615 | Bacteria | 2635 |
| 131 | Ga0070702_100209512 | 3300005615 | Bacteria | 1296 |
| 132 | Ga0070702_100634301 | 3300005615 | Bacteria | 806 |
| 133 | Ga0070702_100800954 | 3300005615 | Bacteria | 729 |
| 134 | Ga0068852_100026617 | 3300005616 | Bacteria | 4705 |
| 135 | Ga0068852_100582542 | 3300005616 | Bacteria | 1122 |
| 136 | Ga0068852_100926321 | 3300005616 | Bacteria | 889 |
| 137 | Ga0068859_100205668 | 3300005617 | Bacteria | 2054 |
| 138 | Ga0068864_100013404 | 3300005618 | Bacteria | 6794 |
| 139 | Ga0068864_100151603 | 3300005618 | Bacteria | 2100 |
| 140 | Ga0068866_10347831 | 3300005718 | Bacteria | 941 |
| 141 | Ga0068866_10419279 | 3300005718 | Bacteria | 868 |
| 142 | Ga0068861_100052918 | 3300005719 | Bacteria | 3087 |
| 143 | Ga0068861_100265344 | 3300005719 | Bacteria | 1472 |
| 144 | Ga0068861_101600187 | 3300005719 | Bacteria | 642 |
| 145 | Ga0068861_101953409 | 3300005719 | Bacteria | 584 |
| 146 | Ga0068870_11328003 | 3300005840 | Bacteria | 525 |
| 147 | Ga0068863_101290701 | 3300005841 | Unclassified | 737 |
| 148 | Ga0068858_100810577 | 3300005842 | Bacteria | 913 |
| 149 | Ga0068860_100527756 | 3300005843 | Bacteria | 1181 |
| 150 | Ga0068862_100131450 | 3300005844 | Bacteria | 2214 |
| 151 | Ga0068862_101935617 | 3300005844 | Unclassified | 600 |
| 152 | Ga0081455_10006687 | 3300005937 | Bacteria | 12319 |
| 153 | Ga0081455_10053856 | 3300005937 | Bacteria | 3434 |
| 154 | Ga0081455_10220487 | 3300005937 | Unclassified | 1406 |
| 155 | Ga0081455_10260881 | 3300005937 | Bacteria | 1262 |
| 156 | Ga0081538_10000010 | 3300005981 | Bacteria | 164857 |
| 157 | Ga0081538_10004233 | 3300005981 | Bacteria | 13311 |
| 158 | Ga0081540_1058138 | 3300005983 | Bacteria | 1865 |
| 159 | Ga0081539_10014299 | 3300005985 | Bacteria | 5884 |
| 160 | Ga0070717_10021464 | 3300006028 | Bacteria | 5088 |
| 161 | Ga0070717_10382118 | 3300006028 | Bacteria | 1263 |
| 162 | Ga0070717_11094272 | 3300006028 | Bacteria | 726 |
| 163 | Ga0075365_10142667 | 3300006038 | Unclassified | 1663 |
| 164 | Ga0075363_100425443 | 3300006048 | Bacteria | 782 |
| 165 | Ga0070716_100129954 | 3300006173 | Bacteria | 1591 |
| 166 | Ga0070716_101092590 | 3300006173 | Unclassified | 636 |
| 167 | Ga0070712_100076020 | 3300006175 | Bacteria | 2417 |
| 168 | Ga0075367_10164043 | 3300006178 | Bacteria | 1382 |
| 169 | Ga0075367_10592735 | 3300006178 | Unclassified | 704 |
| 170 | Ga0075428_100102641 | 3300006844 | Bacteria | 3118 |
| 171 | Ga0075428_100727192 | 3300006844 | Unclassified | 1057 |
| 172 | Ga0075431_101074529 | 3300006847 | Bacteria | 770 |
| 173 | Ga0075434_100850577 | 3300006871 | Bacteria | 928 |
| 174 | Ga0075434_102368070 | 3300006871 | Unclassified | 533 |
| 175 | Ga0075429_100549721 | 3300006880 | Bacteria | 1012 |
| 176 | Ga0068865_100083165 | 3300006881 | Bacteria | 2303 |
| 177 | Ga0068865_100318638 | 3300006881 | Bacteria | 1250 |
| 178 | Ga0068865_100653734 | 3300006881 | Bacteria | 894 |
| 179 | Ga0097620_100205671 | 3300006931 | Bacteria | 2054 |
| 180 | Ga0075435_100871773 | 3300007076 | Bacteria | 785 |
| 181 | Ga0075435_101289371 | 3300007076 | Bacteria | 640 |
| 182 | Ga0105240_10843774 | 3300009093 | Bacteria | 989 |
| 183 | Ga0111539_10089788 | 3300009094 | Bacteria | 3611 |
| 184 | Ga0111539_10118853 | 3300009094 | Bacteria | 3097 |
| 185 | Ga0111539_10136307 | 3300009094 | Bacteria | 2875 |
| 186 | Ga0111539_10138008 | 3300009094 | Bacteria | 2856 |
| 187 | Ga0111539_10235088 | 3300009094 | Bacteria | 2134 |
| 188 | Ga0111539_10409133 | 3300009094 | Bacteria | 1580 |
| 189 | Ga0111539_11247245 | 3300009094 | Bacteria | 863 |
| 190 | Ga0111539_13526584 | 3300009094 | Bacteria | 502 |
| 191 | Ga0105245_10108713 | 3300009098 | Bacteria | 2576 |
| 192 | Ga0105245_10398686 | 3300009098 | Bacteria | 1374 |
| 193 | Ga0105245_10422968 | 3300009098 | Bacteria | 1336 |
| 194 | Ga0105245_10664010 | 3300009098 | Bacteria | 1073 |
| 195 | Ga0105245_10919179 | 3300009098 | Bacteria | 917 |
| 196 | Ga0105245_11775631 | 3300009098 | Bacteria | 669 |
| 197 | Ga0105247_10026037 | 3300009101 | Bacteria | 3531 |
| 198 | Ga0105247_10494181 | 3300009101 | Bacteria | 890 |
| 199 | Ga0105247_11074637 | 3300009101 | Bacteria | 633 |
| 200 | Ga0114129_10110299 | 3300009147 | Bacteria | 3798 |
| 201 | Ga0105243_10019896 | 3300009148 | Bacteria | 5090 |
| 202 | Ga0105243_10023843 | 3300009148 | Bacteria | 4663 |
| 203 | Ga0105243_10054657 | 3300009148 | Bacteria | 3171 |
| 204 | Ga0105243_10308697 | 3300009148 | Bacteria | 1436 |
| 205 | Ga0105243_10378264 | 3300009148 | Bacteria | 1309 |
| 206 | Ga0105243_10812840 | 3300009148 | Bacteria | 922 |
| 207 | Ga0105243_10848690 | 3300009148 | Bacteria | 904 |
| 208 | Ga0105242_10236711 | 3300009176 | Bacteria | 1639 |
| 209 | Ga0105242_10694396 | 3300009176 | Bacteria | 995 |
| 210 | Ga0105242_11887535 | 3300009176 | Bacteria | 638 |
| 211 | Ga0105242_11900143 | 3300009176 | Bacteria | 636 |
| 212 | Ga0105242_12855253 | 3300009176 | Bacteria | 533 |
| 213 | Ga0105248_10299404 | 3300009177 | Bacteria | 1811 |
| 214 | Ga0105248_11696473 | 3300009177 | Bacteria | 716 |
| 215 | Ga0105248_12991718 | 3300009177 | Bacteria | 538 |
| 216 | Ga0105237_10255961 | 3300009545 | Bacteria | 1753 |
| 217 | Ga0105237_10534083 | 3300009545 | Bacteria | 1179 |
| 218 | Ga0105238_10573913 | 3300009551 | Bacteria | 1134 |
| 219 | Ga0105249_10066786 | 3300009553 | Bacteria | 3312 |
| 220 | Ga0105249_10270563 | 3300009553 | Bacteria | 1692 |
| 221 | Ga0105249_12057678 | 3300009553 | Bacteria | 644 |
| 222 | Ga0105239_10044868 | 3300010375 | Bacteria | 4845 |
| 223 | Ga0105239_10229283 | 3300010375 | Bacteria | 2084 |
| 224 | Ga0105239_10245576 | 3300010375 | Bacteria | 2010 |
| 225 | Ga0105239_10300271 | 3300010375 | Bacteria | 1808 |
| 226 | Ga0105246_10356798 | 3300011119 | Bacteria | 1200 |
| 227 | Ga0105246_11458175 | 3300011119 | Bacteria | 641 |
| 228 | Ga0105246_12058640 | 3300011119 | Bacteria | 552 |
| 229 | Ga0157369_10228435 | 3300013105 | Bacteria | 1946 |
| 230 | Ga0157369_11178130 | 3300013105 | Bacteria | 782 |
| 231 | Ga0157374_10042730 | 3300013296 | Bacteria | 4182 |
| 232 | Ga0157374_10429397 | 3300013296 | Bacteria | 1321 |
| 233 | Ga0157374_10687606 | 3300013296 | Bacteria | 1036 |
| 234 | Ga0157374_11849776 | 3300013296 | Bacteria | 629 |
| 235 | Ga0157378_10242718 | 3300013297 | Bacteria | 1721 |
| 236 | Ga0163162_10245249 | 3300013306 | Bacteria | 1923 |
| 237 | Ga0163162_11614008 | 3300013306 | Bacteria | 740 |
| 238 | Ga0157372_10012848 | 3300013307 | Bacteria | 8924 |
| 239 | Ga0157372_10176165 | 3300013307 | Bacteria | 2475 |
| 240 | Ga0157372_10746142 | 3300013307 | Bacteria | 1138 |
| 241 | Ga0157372_10977835 | 3300013307 | Bacteria | 981 |
| 242 | Ga0157372_12025757 | 3300013307 | Bacteria | 662 |
| 243 | Ga0157372_13082470 | 3300013307 | Bacteria | 532 |
| 244 | Ga0157375_10041901 | 3300013308 | Bacteria | 4426 |
| 245 | Ga0157375_10066165 | 3300013308 | Bacteria | 3606 |
| 246 | Ga0157375_10572357 | 3300013308 | Bacteria | 1290 |
| 247 | Ga0157375_10779208 | 3300013308 | Bacteria | 1106 |
| 248 | Ga0157375_10941341 | 3300013308 | Bacteria | 1006 |
| 249 | Ga0163163_10046029 | 3300014325 | Bacteria | 4284 |
| 250 | Ga0163163_10182441 | 3300014325 | Bacteria | 2146 |
| 251 | Ga0163163_10524071 | 3300014325 | Bacteria | 1247 |
| 252 | Ga0157380_10209386 | 3300014326 | Bacteria | 1736 |
| 253 | Ga0157380_10238081 | 3300014326 | Bacteria | 1639 |
| 254 | Ga0157380_11028025 | 3300014326 | Bacteria | 859 |
| 255 | Ga0157380_12939863 | 3300014326 | Bacteria | 542 |
| 256 | Ga0157380_13543780 | 3300014326 | Bacteria | 500 |
| 257 | Ga0157377_10134527 | 3300014745 | Bacteria | 1513 |
| 258 | Ga0157377_10420860 | 3300014745 | Bacteria | 915 |
| 259 | Ga0157377_10559778 | 3300014745 | Bacteria | 809 |
| 260 | Ga0157379_10201032 | 3300014968 | Bacteria | 1802 |
| 261 | Ga0157379_10545873 | 3300014968 | Bacteria | 1078 |
| 262 | Ga0157376_10229611 | 3300014969 | Bacteria | 1723 |
| 263 | Ga0206354_10694457 | 3300020081 | Bacteria | 1088 |
| 264 | Ga0154015_1575334 | 3300020610 | Unclassified | 688 |
| 265 | Ga0213873_10007528 | 3300021358 | Bacteria | 2186 |
| 266 | Ga0213872_10287730 | 3300021361 | Bacteria | 685 |
| 267 | Ga0213874_10033143 | 3300021377 | Bacteria | 1504 |
| 268 | Ga0213874_10054906 | 3300021377 | Bacteria | 1233 |
| 269 | Ga0213876_10003076 | 3300021384 | Bacteria | 9657 |
| 270 | Ga0213876_10016056 | 3300021384 | Bacteria | 3960 |
| 271 | Ga0213876_10020659 | 3300021384 | Bacteria | 3481 |
| 272 | Ga0213876_10062355 | 3300021384 | Bacteria | 1968 |
| 273 | Ga0213876_10543979 | 3300021384 | Bacteria | 618 |
| 274 | Ga0213875_10000351 | 3300021388 | Bacteria | 43186 |
| 275 | Ga0213875_10029581 | 3300021388 | Bacteria | 2597 |
| 276 | Ga0213875_10044831 | 3300021388 | Bacteria | 2076 |
| 277 | Ga0213875_10118675 | 3300021388 | Unclassified | 1236 |
| 278 | Ga0207692_10699898 | 3300025898 | Unclassified | 658 |
| 279 | Ga0207642_10068187 | 3300025899 | Bacteria | 1682 |
| 280 | Ga0207642_10069521 | 3300025899 | Bacteria | 1670 |
| 281 | Ga0207642_10270648 | 3300025899 | Bacteria | 973 |
| 282 | Ga0207710_10372713 | 3300025900 | Bacteria | 730 |
| 283 | Ga0207688_10011962 | 3300025901 | Bacteria | 4723 |
| 284 | Ga0207688_10016243 | 3300025901 | Bacteria | 4036 |
| 285 | Ga0207680_10267734 | 3300025903 | Bacteria | 1184 |
| 286 | Ga0207680_10851897 | 3300025903 | Bacteria | 653 |
| 287 | Ga0207647_10169641 | 3300025904 | Bacteria | 1271 |
| 288 | Ga0207645_10561847 | 3300025907 | Bacteria | 774 |
| 289 | Ga0207645_10631613 | 3300025907 | Bacteria | 727 |
| 290 | Ga0207643_10054459 | 3300025908 | Bacteria | 2274 |
| 291 | Ga0207643_10675600 | 3300025908 | Bacteria | 667 |
| 292 | Ga0207684_11309512 | 3300025910 | Bacteria | 596 |
| 293 | Ga0207671_10622282 | 3300025914 | Bacteria | 860 |
| 294 | Ga0207671_11508595 | 3300025914 | Bacteria | 519 |
| 295 | Ga0207693_10108283 | 3300025915 | Bacteria | 2180 |
| 296 | Ga0207663_10001192 | 3300025916 | Bacteria | 12004 |
| 297 | Ga0207663_10014473 | 3300025916 | Bacteria | 4320 |
| 298 | Ga0207663_11559156 | 3300025916 | Unclassified | 532 |
| 299 | Ga0207660_10545687 | 3300025917 | Bacteria | 943 |
| 300 | Ga0207660_11181358 | 3300025917 | Bacteria | 623 |
| 301 | Ga0207662_10007363 | 3300025918 | Bacteria | 5989 |
| 302 | Ga0207657_10129056 | 3300025919 | Bacteria | 2074 |
| 303 | Ga0207657_11140985 | 3300025919 | Unclassified | 594 |
| 304 | Ga0207652_10766905 | 3300025921 | Bacteria | 858 |
| 305 | Ga0207652_11841609 | 3300025921 | Unclassified | 510 |
| 306 | Ga0207681_10154159 | 3300025923 | Bacteria | 1725 |
| 307 | Ga0207681_10195611 | 3300025923 | Bacteria | 1550 |
| 308 | Ga0207694_10606835 | 3300025924 | Bacteria | 920 |
| 309 | Ga0207659_10141939 | 3300025926 | Bacteria | 1865 |
| 310 | Ga0207659_10811102 | 3300025926 | Bacteria | 804 |
| 311 | Ga0207687_10248118 | 3300025927 | Bacteria | 1414 |
| 312 | Ga0207687_10876091 | 3300025927 | Bacteria | 768 |
| 313 | Ga0207687_11302126 | 3300025927 | Bacteria | 625 |
| 314 | Ga0207687_11341742 | 3300025927 | Bacteria | 615 |
| 315 | Ga0207664_10416035 | 3300025929 | Unclassified | 1197 |
| 316 | Ga0207664_12006259 | 3300025929 | Bacteria | 502 |
| 317 | Ga0207644_10176874 | 3300025931 | Bacteria | 1670 |
| 318 | Ga0207644_10605621 | 3300025931 | Bacteria | 910 |
| 319 | Ga0207644_10653344 | 3300025931 | Unclassified | 875 |
| 320 | Ga0207644_11082504 | 3300025931 | Bacteria | 673 |
| 321 | Ga0207690_10033481 | 3300025932 | Bacteria | 3304 |
| 322 | Ga0207690_10080597 | 3300025932 | Bacteria | 2272 |
| 323 | Ga0207690_10295168 | 3300025932 | Bacteria | 1266 |
| 324 | Ga0207706_10037623 | 3300025933 | Bacteria | 4296 |
| 325 | Ga0207706_10508765 | 3300025933 | Bacteria | 1039 |
| 326 | Ga0207706_11145076 | 3300025933 | Bacteria | 648 |
| 327 | Ga0207686_10081376 | 3300025934 | Bacteria | 2114 |
| 328 | Ga0207686_10500230 | 3300025934 | Bacteria | 943 |
| 329 | Ga0207709_10236491 | 3300025935 | Bacteria | 1326 |
| 330 | Ga0207709_10260175 | 3300025935 | Bacteria | 1272 |
| 331 | Ga0207709_11364356 | 3300025935 | Bacteria | 587 |
| 332 | Ga0207709_11549829 | 3300025935 | Bacteria | 550 |
| 333 | Ga0207670_10442135 | 3300025936 | Bacteria | 1047 |
| 334 | Ga0207669_10171797 | 3300025937 | Bacteria | 1544 |
| 335 | Ga0207669_10382777 | 3300025937 | Bacteria | 1097 |
| 336 | Ga0207704_10240663 | 3300025938 | Bacteria | 1352 |
| 337 | Ga0207704_10611099 | 3300025938 | Bacteria | 894 |
| 338 | Ga0207691_10150056 | 3300025940 | Bacteria | 2050 |
| 339 | Ga0207711_10146540 | 3300025941 | Bacteria | 2128 |
| 340 | Ga0207711_10809786 | 3300025941 | Bacteria | 872 |
| 341 | Ga0207689_10185474 | 3300025942 | Bacteria | 1716 |
| 342 | Ga0207689_11148336 | 3300025942 | Bacteria | 654 |
| 343 | Ga0207661_10111673 | 3300025944 | Bacteria | 2313 |
| 344 | Ga0207661_10443598 | 3300025944 | Bacteria | 1181 |
| 345 | Ga0207661_10790253 | 3300025944 | Bacteria | 874 |
| 346 | Ga0207661_11614958 | 3300025944 | Bacteria | 593 |
| 347 | Ga0207661_11843451 | 3300025944 | Bacteria | 550 |
| 348 | Ga0207679_10026630 | 3300025945 | Bacteria | 3989 |
| 349 | Ga0207679_10497923 | 3300025945 | Bacteria | 1087 |
| 350 | Ga0207679_10729739 | 3300025945 | Bacteria | 900 |
| 351 | Ga0207651_10236092 | 3300025960 | Bacteria | 1488 |
| 352 | Ga0207651_10618004 | 3300025960 | Bacteria | 949 |
| 353 | Ga0207712_10249645 | 3300025961 | Bacteria | 1433 |
| 354 | Ga0207712_11432158 | 3300025961 | Bacteria | 618 |
| 355 | Ga0207668_10583935 | 3300025972 | Bacteria | 972 |
| 356 | Ga0207640_10163885 | 3300025981 | Bacteria | 1648 |
| 357 | Ga0207640_10453591 | 3300025981 | Bacteria | 1057 |
| 358 | Ga0207640_10504307 | 3300025981 | Bacteria | 1008 |
| 359 | Ga0207640_11369478 | 3300025981 | Bacteria | 633 |
| 360 | Ga0207658_10508830 | 3300025986 | Bacteria | 1074 |
| 361 | Ga0207658_10745226 | 3300025986 | Bacteria | 887 |
| 362 | Ga0207677_10036819 | 3300026023 | Bacteria | 3193 |
| 363 | Ga0207677_10200393 | 3300026023 | Bacteria | 1586 |
| 364 | Ga0207703_10340132 | 3300026035 | Bacteria | 1379 |
| 365 | Ga0207639_10073428 | 3300026041 | Bacteria | 2682 |
| 366 | Ga0207678_10075798 | 3300026067 | Bacteria | 2881 |
| 367 | Ga0207678_10145172 | 3300026067 | Bacteria | 2025 |
| 368 | Ga0207678_10283955 | 3300026067 | Bacteria | 1421 |
| 369 | Ga0207678_10387771 | 3300026067 | Bacteria | 1208 |
| 370 | Ga0207708_10002745 | 3300026075 | Bacteria | 12930 |
| 371 | Ga0207708_10051464 | 3300026075 | Bacteria | 3135 |
| 372 | Ga0207708_10087035 | 3300026075 | Bacteria | 2405 |
| 373 | Ga0207708_10102782 | 3300026075 | Bacteria | 2213 |
| 374 | Ga0207708_10234988 | 3300026075 | Bacteria | 1473 |
| 375 | Ga0207702_10060445 | 3300026078 | Bacteria | 3230 |
| 376 | Ga0207702_10092548 | 3300026078 | Bacteria | 2650 |
| 377 | Ga0207702_10135259 | 3300026078 | Bacteria | 2223 |
| 378 | Ga0207702_10226691 | 3300026078 | Bacteria | 1744 |
| 379 | Ga0207702_10445767 | 3300026078 | Bacteria | 1255 |
| 380 | Ga0207702_11078001 | 3300026078 | Bacteria | 797 |
| 381 | Ga0207641_10665825 | 3300026088 | Bacteria | 1023 |
| 382 | Ga0207648_10157348 | 3300026089 | Bacteria | 2006 |
| 383 | Ga0207648_10482810 | 3300026089 | Bacteria | 1132 |
| 384 | Ga0207648_11823395 | 3300026089 | Bacteria | 570 |
| 385 | Ga0207676_10087867 | 3300026095 | Bacteria | 2543 |
| 386 | Ga0207676_12324781 | 3300026095 | Unclassified | 533 |
| 387 | Ga0207674_10075148 | 3300026116 | Bacteria | 3389 |
| 388 | Ga0207674_10093531 | 3300026116 | Bacteria | 2994 |
| 389 | Ga0207674_10198366 | 3300026116 | Bacteria | 1956 |
| 390 | Ga0207674_10657683 | 3300026116 | Bacteria | 1012 |
| 391 | Ga0207675_100120105 | 3300026118 | Bacteria | 2486 |
| 392 | Ga0207675_100241932 | 3300026118 | Bacteria | 1744 |
| 393 | Ga0207675_100262083 | 3300026118 | Bacteria | 1675 |
| 394 | Ga0207675_100273619 | 3300026118 | Bacteria | 1639 |
| 395 | Ga0207675_100700872 | 3300026118 | Bacteria | 1021 |
| 396 | Ga0207675_100814168 | 3300026118 | Bacteria | 948 |
| 397 | Ga0207675_101954770 | 3300026118 | Unclassified | 604 |
| 398 | Ga0207675_102741615 | 3300026118 | Bacteria | 501 |
| 399 | Ga0207683_10097704 | 3300026121 | Bacteria | 2619 |
| 400 | Ga0207683_10160787 | 3300026121 | Bacteria | 2030 |
| 401 | Ga0207683_10819425 | 3300026121 | Bacteria | 864 |
| 402 | Ga0207683_11703051 | 3300026121 | Bacteria | 580 |
| 403 | Ga0207698_10287982 | 3300026142 | Bacteria | 1523 |
| 404 | Ga0207698_10404552 | 3300026142 | Bacteria | 1305 |
| 405 | Ga0207698_10691324 | 3300026142 | Bacteria | 1014 |
| 406 | Ga0207698_11207210 | 3300026142 | Bacteria | 770 |
| 407 | Ga0207698_11632326 | 3300026142 | Bacteria | 660 |
| 408 | Ga0207428_10078696 | 3300027907 | Bacteria | 2579 |
| 409 | Ga0207428_10108025 | 3300027907 | Bacteria | 2143 |
| 410 | Ga0207428_10121916 | 3300027907 | Bacteria | 1999 |
| 411 | Ga0207428_10164016 | 3300027907 | Bacteria | 1686 |
| 412 | Ga0268266_10364087 | 3300028379 | Bacteria | 1361 |
| 413 | Ga0268266_11888167 | 3300028379 | Unclassified | 571 |
| 414 | Ga0268265_10923226 | 3300028380 | Bacteria | 858 |
| 415 | Ga0307408_100395495 | 3300031548 | Bacteria | 1185 |
| 416 | Ga0307408_100781814 | 3300031548 | Bacteria | 865 |
| 417 | Ga0307408_101593908 | 3300031548 | Bacteria | 620 |
| 418 | Ga0307405_11020078 | 3300031731 | Bacteria | 707 |
| 419 | Ga0307413_10251431 | 3300031824 | Bacteria | 1311 |
| 420 | Ga0307413_10641453 | 3300031824 | Unclassified | 875 |
| 421 | Ga0307413_11714469 | 3300031824 | Bacteria | 560 |
| 422 | Ga0307410_10075623 | 3300031852 | Bacteria | 2348 |
| 423 | Ga0307410_10118200 | 3300031852 | Bacteria | 1929 |
| 424 | Ga0307410_10330229 | 3300031852 | Bacteria | 1212 |
| 425 | Ga0307410_10351504 | 3300031852 | Bacteria | 1178 |
| 426 | Ga0307410_10981868 | 3300031852 | Bacteria | 727 |
| 427 | Ga0307406_10155606 | 3300031901 | Bacteria | 1637 |
| 428 | Ga0307406_10246390 | 3300031901 | Bacteria | 1343 |
| 429 | Ga0307406_10361063 | 3300031901 | Bacteria | 1138 |
| 430 | Ga0307406_10515088 | 3300031901 | Bacteria | 972 |
| 431 | Ga0307406_10671684 | 3300031901 | Bacteria | 862 |
| 432 | Ga0307406_11130422 | 3300031901 | Bacteria | 677 |
| 433 | Ga0307407_10181597 | 3300031903 | Bacteria | 1395 |
| 434 | Ga0307407_10305571 | 3300031903 | Bacteria | 1111 |
| 435 | Ga0307407_10369759 | 3300031903 | Bacteria | 1020 |
| 436 | Ga0307407_10555491 | 3300031903 | Bacteria | 849 |
| 437 | Ga0307407_11100321 | 3300031903 | Bacteria | 618 |
| 438 | Ga0307412_10316882 | 3300031911 | Bacteria | 1239 |
| 439 | Ga0307409_100031646 | 3300031995 | Bacteria | 3822 |
| 440 | Ga0307409_100077950 | 3300031995 | Bacteria | 2664 |
| 441 | Ga0307409_100186251 | 3300031995 | Bacteria | 1843 |
| 442 | Ga0307409_100392834 | 3300031995 | Bacteria | 1322 |
| 443 | Ga0307409_100528124 | 3300031995 | Bacteria | 1154 |
| 444 | Ga0307409_101144535 | 3300031995 | Bacteria | 800 |
| 445 | Ga0307409_101511624 | 3300031995 | Bacteria | 699 |
| 446 | Ga0307409_101915349 | 3300031995 | Bacteria | 622 |
| 447 | Ga0307416_100199592 | 3300032002 | Bacteria | 1896 |
| 448 | Ga0307416_100261872 | 3300032002 | Bacteria | 1691 |
| 449 | Ga0307416_100569789 | 3300032002 | Bacteria | 1208 |
| 450 | Ga0307416_102460723 | 3300032002 | Bacteria | 620 |
| 451 | Ga0307414_10757133 | 3300032004 | Bacteria | 883 |
| 452 | Ga0307414_11147212 | 3300032004 | Bacteria | 719 |
| 453 | Ga0307411_10412570 | 3300032005 | Bacteria | 1119 |
| 454 | Ga0307411_10581759 | 3300032005 | Bacteria | 960 |
| 455 | Ga0307411_10951267 | 3300032005 | Bacteria | 766 |
| 456 | Ga0307411_11395829 | 3300032005 | Bacteria | 641 |
| 457 | Ga0307415_100155138 | 3300032126 | Bacteria | 1767 |
| 458 | Ga0307415_100296308 | 3300032126 | Bacteria | 1338 |
| 459 | Ga0307415_100319177 | 3300032126 | Bacteria | 1294 |
| 460 | Ga0307415_100618262 | 3300032126 | Bacteria | 967 |
| 461 | Ga0307415_100778849 | 3300032126 | Bacteria | 871 |
| 462 | Ga0307415_101895232 | 3300032126 | Bacteria | 579 |
| 463 | Ga0307415_102594727 | 3300032126 | Unclassified | 500 |
| 464 | Ga0373929_0229435 | 3300035085 | Unclassified | 531 |
| 465 | Ga0373932_0118756 | 3300035112 | Bacteria | 880 |
| 466 | Ga0373960_0150023 | 3300035121 | Bacteria | 796 |
| 467 | Ga0373960_0356485 | 3300035121 | Bacteria | 556 |
| 468 | Ga0373962_0195440 | 3300035242 | Bacteria | 683 |
| 469 | Ga0373931_0539495 | 3300035691 | Bacteria | 757 |
| 470 | Ga0373935_1394676 | 3300035692 | Bacteria | 524 |
| 471 | Ga0373937_1379376 | 3300036401 | Bacteria | 653 |
| 472 | Ga0395899_0226452 | 3300037312 | Bacteria | 1293 |
| 473 | Ga0395899_0396017 | 3300037312 | Bacteria | 915 |
| 474 | Ga0395898_0069273 | 3300037466 | Bacteria | 3413 |
| 475 | Ga0395905_0086086 | 3300037471 | Bacteria | 2945 |
| 476 | Ga0395905_1540166 | 3300037471 | Bacteria | 569 |
| 477 | Ga0436364_0344394 | 3300037853 | Bacteria | 19362 |
| 478 | Ga0436364_0834563 | 3300037853 | Bacteria | 763 |
| 479 | Ga0436364_0840900 | 3300037853 | Bacteria | 42362 |
| 480 | Ga0436364_0986790 | 3300037853 | Bacteria | 1527 |
| 481 | Ga0436364_1059222 | 3300037853 | Bacteria | 525 |
| 482 | Ga0436364_1245384 | 3300037853 | Unclassified | 1693 |
| 483 | Ga0436364_1426665 | 3300037853 | Bacteria | 33049 |
| 484 | Ga0395901_0009876 | 3300038443 | Bacteria | 9673 |
| 485 | Ga0395901_0261307 | 3300038443 | Bacteria | 1802 |
| 486 | Ga0395901_2139192 | 3300038443 | Bacteria | 504 |
| 487 | Ga0436365_0025272 | 3300039437 | Bacteria | 37971 |
| 488 | Ga0436365_0062040 | 3300039437 | Bacteria | 25145 |
| 489 | Ga0436365_0975923 | 3300039437 | Bacteria | 5533 |
| 490 | Ga0436365_1207297 | 3300039437 | Bacteria | 676 |
| 491 | Ga0436365_1685258 | 3300039437 | Bacteria | 2639 |
| 492 | Ga0436365_1687595 | 3300039437 | Bacteria | 5516 |
| 493 | Ga0436365_1743192 | 3300039437 | Bacteria | 618 |
| 494 | Ga0436361_0425082 | 3300039447 | Bacteria | 1128 |
| 495 | Ga0436363_0041489 | 3300039450 | Bacteria | 540 |
| 496 | Ga0436363_0329309 | 3300039450 | Bacteria | 2260 |
| 497 | Ga0436363_0352791 | 3300039450 | Unclassified | 908 |
| 498 | Ga0436363_0543039 | 3300039450 | Bacteria | 810 |
| 499 | Ga0436363_1045732 | 3300039450 | Bacteria | 679 |
| 500 | Ga0436363_1227036 | 3300039450 | Unclassified | 2453 |
| 501 | Ga0436363_1398997 | 3300039450 | Bacteria | 1163 |
| 502 | Ga0436363_1578987 | 3300039450 | Bacteria | 8985 |
| 503 | Ga0436362_0024438 | 3300039453 | Bacteria | 1443 |
| 504 | Ga0436362_0271598 | 3300039453 | Bacteria | 576 |
| 505 | Ga0436362_0342263 | 3300039453 | Bacteria | 663 |
| 506 | Ga0436362_0346808 | 3300039453 | Unclassified | 588 |
| 507 | Ga0436362_0562392 | 3300039453 | Bacteria | 1205 |
| 508 | Ga0436362_0563165 | 3300039453 | Bacteria | 848 |
| 509 | Ga0436362_0859181 | 3300039453 | Bacteria | 1815 |
| 510 | Ga0436362_1088596 | 3300039453 | Bacteria | 2608 |
| 511 | Ga0451793_0007379 | 3300041452 | Bacteria | 655 |
| 512 | Ga0451835_0486417 | 3300041492 | Bacteria | 751 |
| 513 | Ga0439463_095779 | 3300042016 | Bacteria | 765 |
| 514 | Ga0466969_0195809 | 3300044656 | Unclassified | 923 |
| 515 | Ga0466969_0398035 | 3300044656 | Unclassified | 625 |
| 516 | Ga0466972_0099975 | 3300044658 | Bacteria | 1373 |
| 517 | Ga0466965_0191470 | 3300044683 | Unclassified | 1082 |
| 518 | Ga0466966_0014187 | 3300044684 | Bacteria | 5275 |
| 519 | Ga0466961_0291646 | 3300044693 | Bacteria | 998 |
| 520 | Ga0466961_0469489 | 3300044693 | Bacteria | 761 |
| 521 | Ga0466961_0470518 | 3300044693 | Bacteria | 760 |
| 522 | Ga0466961_0588653 | 3300044693 | Bacteria | 669 |
| 523 | Ga0466963_0321432 | 3300044694 | Unclassified | 1089 |
| 524 | Ga0466964_0165556 | 3300044706 | Bacteria | 1037 |
| 525 | Ga0466971_0441171 | 3300044719 | Bacteria | 638 |
| 526 | Ga0466968_0094150 | 3300044735 | Bacteria | 1331 |
| 527 | Ga0466957_1288271 | 3300044842 | Bacteria | 530 |
| 528 | Ga0466960_0235906 | 3300044901 | Bacteria | 1011 |
| 529 | Ga0466960_0540832 | 3300044901 | Bacteria | 686 |
| 530 | Ga0466959_0239149 | 3300045049 | Bacteria | 1255 |
| 531 | Ga0466959_0269631 | 3300045049 | Bacteria | 1170 |
| 532 | Ga0466959_0550424 | 3300045049 | Bacteria | 778 |
| 533 | Ga0466959_0845714 | 3300045049 | Bacteria | 611 |
| 534 | Ga0466958_0374301 | 3300045836 | Bacteria | 918 |
| 535 | Ga0466958_0781596 | 3300045836 | Bacteria | 622 |
| 536 | Ga0466967_0019891 | 3300045976 | Bacteria | 5412 |
| 537 | Ga0466967_0129094 | 3300045976 | Bacteria | 2345 |
| 538 | Ga0466967_0262366 | 3300045976 | Bacteria | 1653 |
| 539 | Ga0466967_0569223 | 3300045976 | Unclassified | 1116 |
| 540 | Ga0466967_0899445 | 3300045976 | Viruses | 880 |
| 541 | Ga0466967_1061872 | 3300045976 | Bacteria | 807 |
| 542 | Ga0466967_1141195 | 3300045976 | Bacteria | 776 |
| 543 | Ga0466967_2046651 | 3300045976 | Bacteria | 569 |
| 544 | Ga0466967_2348888 | 3300045976 | Bacteria | 529 |
| 545 | Ga0495592_0002781 | 3300046454 | Bacteria | 12400 |
| 546 | Ga0495651_0171278 | 3300046462 | Bacteria | 1546 |
| 547 | Ga0495651_0227545 | 3300046462 | Bacteria | 1286 |
| 548 | Ga0495653_0108873 | 3300046463 | Bacteria | 1995 |
| 549 | Ga0495662_0000043 | 3300046476 | Bacteria | 42697 |
| 550 | Ga0495596_0077922 | 3300046500 | Bacteria | 1287 |
| 551 | Ga0495616_0456542 | 3300046513 | Bacteria | 517 |
| 552 | Ga0495620_0238799 | 3300046515 | Bacteria | 694 |
| 553 | Ga0495628_0070126 | 3300046516 | Bacteria | 2733 |
| 554 | Ga0495628_0910425 | 3300046516 | Bacteria | 610 |
| 555 | Ga0495630_0142150 | 3300046517 | Bacteria | 1825 |
| 556 | Ga0495631_0299858 | 3300046518 | Bacteria | 684 |
| 557 | Ga0495643_0175240 | 3300046522 | Bacteria | 1046 |
| 558 | Ga0495644_0215377 | 3300046523 | Bacteria | 742 |
| 559 | Ga0495586_0178459 | 3300046535 | Bacteria | 1201 |
| 560 | Ga0495598_0361552 | 3300046537 | Bacteria | 561 |
| 561 | Ga0495598_0444267 | 3300046537 | Bacteria | 513 |
| 562 | Ga0495597_0138600 | 3300046542 | Unclassified | 1005 |
| 563 | Ga0495656_0404321 | 3300046615 | Bacteria | 715 |
| 564 | Ga0495668_0078847 | 3300046616 | Bacteria | 1808 |
| 565 | Ga0495657_0004457 | 3300046675 | Bacteria | 11190 |
| 566 | Ga0495671_0170901 | 3300046692 | Unclassified | 1057 |
| 567 | Ga0495581_0072208 | 3300047315 | Bacteria | 1997 |
| 568 | Ga0495674_0724573 | 3300047319 | Bacteria | 779 |
| 569 | Ga0495674_1497480 | 3300047319 | Bacteria | 500 |
| 570 | Ga0495680_0000312 | 3300047322 | Bacteria | 54495 |
| 571 | Ga0495686_0338213 | 3300047472 | Unclassified | 821 |
| 572 | Ga0495602_0387187 | 3300048088 | Unclassified | 1000 |
| 573 | Ga0495615_0202096 | 3300048090 | Bacteria | 614 |
| 574 | Ga0495626_0395658 | 3300048091 | Bacteria | 535 |
| 575 | Ga0496100_0000263 | 3300048903 | Bacteria | 26697 |
| 576 | Ga0496100_0010838 | 3300048903 | Bacteria | 5172 |
| 577 | Ga0496100_0293352 | 3300048903 | Bacteria | 1215 |
| 578 | Ga0496100_0363971 | 3300048903 | Bacteria | 1095 |
| 579 | Ga0496100_1002266 | 3300048903 | Unclassified | 657 |
| 580 | Ga0496101_0000448 | 3300048904 | Bacteria | 26182 |
| 581 | Ga0496101_0001748 | 3300048904 | Bacteria | 13013 |
| 582 | Ga0496101_0084092 | 3300048904 | Bacteria | 2356 |
| 583 | Ga0496101_0147858 | 3300048904 | Bacteria | 1795 |
| 584 | Ga0496101_0472217 | 3300048904 | Bacteria | 990 |
| 585 | Ga0496101_0924330 | 3300048904 | Bacteria | 687 |
| 586 | Ga0496102_0014074 | 3300048905 | Bacteria | 6950 |
| 587 | Ga0496102_0141956 | 3300048905 | Bacteria | 2252 |
| 588 | Ga0496102_0194499 | 3300048905 | Bacteria | 1911 |
| 589 | Ga0496102_0823487 | 3300048905 | Unclassified | 850 |
| 590 | Ga0496103_0134998 | 3300048906 | Bacteria | 1577 |
| 591 | Ga0496103_0570594 | 3300048906 | Bacteria | 722 |
| 592 | Ga0496104_0000213 | 3300048907 | Bacteria | 51219 |
| 593 | Ga0496104_0013833 | 3300048907 | Bacteria | 7280 |
| 594 | Ga0496104_0047043 | 3300048907 | Bacteria | 4065 |
| 595 | Ga0496104_0302639 | 3300048907 | Bacteria | 1511 |
| 596 | Ga0496104_0373008 | 3300048907 | Bacteria | 1339 |
| 597 | Ga0496105_0000059 | 3300048908 | Bacteria | 86884 |
| 598 | Ga0496105_0052609 | 3300048908 | Bacteria | 3364 |
| 599 | Ga0496105_0101009 | 3300048908 | Bacteria | 2382 |
| 600 | Ga0496105_0153433 | 3300048908 | Bacteria | 1892 |
| 601 | Ga0496106_0001051 | 3300048909 | Bacteria | 20321 |
| 602 | Ga0496106_0022916 | 3300048909 | Bacteria | 4638 |
| 603 | Ga0496106_0035341 | 3300048909 | Bacteria | 3737 |
| 604 | Ga0496106_0114966 | 3300048909 | Bacteria | 2098 |
| 605 | Ga0496106_0631517 | 3300048909 | Unclassified | 857 |
| 606 | Ga0496106_0815803 | 3300048909 | Bacteria | 740 |
| 607 | Ga0496107_0014668 | 3300048910 | Bacteria | 5486 |
| 608 | Ga0496107_0042725 | 3300048910 | Bacteria | 3256 |
| 609 | Ga0496107_0538666 | 3300048910 | Bacteria | 865 |
| 610 | Ga0496107_1067017 | 3300048910 | Unclassified | 584 |
| 611 | Ga0496107_1375522 | 3300048910 | Bacteria | 503 |
| 612 | Ga0496108_0000407 | 3300048911 | Bacteria | 35282 |
| 613 | Ga0496108_0016583 | 3300048911 | Bacteria | 6014 |
| 614 | Ga0496108_0020700 | 3300048911 | Bacteria | 5406 |
| 615 | Ga0496108_0089832 | 3300048911 | Bacteria | 2611 |
| 616 | Ga0496108_0095802 | 3300048911 | Bacteria | 2527 |
| 617 | Ga0496109_0001222 | 3300048912 | Bacteria | 21334 |
| 618 | Ga0496109_0009025 | 3300048912 | Bacteria | 8493 |
| 619 | Ga0496109_0020559 | 3300048912 | Bacteria | 5830 |
| 620 | Ga0496109_0036056 | 3300048912 | Bacteria | 4464 |
| 621 | Ga0496109_0046855 | 3300048912 | Bacteria | 3928 |
| 622 | Ga0496109_1078144 | 3300048912 | Bacteria | 740 |
| 623 | Ga0496109_1202683 | 3300048912 | Bacteria | 694 |
| 624 | Ga0496109_1955386 | 3300048912 | Unclassified | 519 |
| 625 | Ga0496110_0000936 | 3300048913 | Bacteria | 20525 |
| 626 | Ga0496110_0056261 | 3300048913 | Bacteria | 3461 |
| 627 | Ga0496110_0094583 | 3300048913 | Bacteria | 2675 |
| 628 | Ga0496110_0128658 | 3300048913 | Bacteria | 2286 |
| 629 | Ga0496110_1079854 | 3300048913 | Bacteria | 711 |
| 630 | Ga0496111_0002445 | 3300048914 | Bacteria | 11224 |
| 631 | Ga0496111_0004786 | 3300048914 | Bacteria | 8590 |
| 632 | Ga0496111_0137186 | 3300048914 | Bacteria | 1812 |
| 633 | Ga0496111_0313838 | 3300048914 | Bacteria | 1161 |
| 634 | Ga0496111_0742604 | 3300048914 | Bacteria | 712 |
| 635 | Ga0496112_0016036 | 3300048915 | Bacteria | 7006 |
| 636 | Ga0496112_0163971 | 3300048915 | Bacteria | 2188 |
| 637 | Ga0496112_0295083 | 3300048915 | Bacteria | 1567 |
| 638 | Ga0496112_1093709 | 3300048915 | Bacteria | 715 |
| 639 | Ga0496112_1245764 | 3300048915 | Bacteria | 660 |
| 640 | Ga0496113_0017167 | 3300048916 | Bacteria | 5018 |
| 641 | Ga0496113_0104350 | 3300048916 | Bacteria | 2199 |
| 642 | Ga0496113_0108943 | 3300048916 | Bacteria | 2153 |
| 643 | Ga0496113_0193871 | 3300048916 | Bacteria | 1613 |
| 644 | Ga0496114_0106479 | 3300048917 | Bacteria | 2399 |
| 645 | Ga0496114_0260733 | 3300048917 | Bacteria | 1526 |
| 646 | Ga0496114_0415799 | 3300048917 | Bacteria | 1191 |
| 647 | Ga0496114_0462243 | 3300048917 | Bacteria | 1123 |
| 648 | Ga0496114_0719143 | 3300048917 | Bacteria | 875 |
| 649 | Ga0496114_0953703 | 3300048917 | Bacteria | 740 |
| 650 | Ga0496115_0181037 | 3300048918 | Bacteria | 1742 |
| 651 | Ga0496116_0000257 | 3300048919 | Bacteria | 93214 |
| 652 | Ga0496118_0063278 | 3300048921 | Bacteria | 2723 |
| 653 | Ga0496119_0002850 | 3300048922 | Bacteria | 18467 |
| 654 | Ga0501031_0070716 | 3300049568 | Bacteria | 2273 |
| 655 | Ga0501031_0151144 | 3300049568 | Bacteria | 1517 |
| 656 | Ga0501032_0871633 | 3300049569 | Bacteria | 567 |
| 657 | Ga0501033_0258586 | 3300049570 | Bacteria | 1233 |
| 658 | Ga0501034_0574623 | 3300049571 | Bacteria | 1035 |
| 659 | Ga0501036_0332474 | 3300049572 | Bacteria | 1269 |
| 660 | Ga0501036_0799737 | 3300049572 | Bacteria | 776 |
| 661 | Ga0501036_1168771 | 3300049572 | Bacteria | 628 |
| 662 | Ga0501039_0300789 | 3300049575 | Bacteria | 1261 |
| 663 | Ga0501040_0364783 | 3300049576 | Bacteria | 1035 |
| 664 | Ga0501040_1010016 | 3300049576 | Bacteria | 603 |
| 665 | Ga0501041_0036888 | 3300049577 | Bacteria | 2961 |
| 666 | Ga0501041_0228155 | 3300049577 | Bacteria | 1169 |
| 667 | Ga0501043_0161822 | 3300049579 | Bacteria | 1749 |
| 668 | Ga0501046_0234060 | 3300049580 | Bacteria | 1356 |
| 669 | Ga0501068_0972326 | 3300049584 | Bacteria | 560 |
| 670 | Ga0501068_1136662 | 3300049584 | Bacteria | 517 |
| 671 | Ga0501071_0075022 | 3300049587 | Bacteria | 2468 |
| 672 | Ga0501071_0102029 | 3300049587 | Bacteria | 2115 |
| 673 | Ga0501072_0085266 | 3300049588 | Bacteria | 2505 |
| 674 | Ga0501072_0359680 | 3300049588 | Bacteria | 1155 |
| 675 | Ga0501073_1069127 | 3300049589 | Unclassified | 555 |
| 676 | Ga0501074_0848081 | 3300049590 | Bacteria | 643 |
| 677 | Ga0501075_0320065 | 3300049591 | Bacteria | 1182 |
| 678 | Ga0501075_0349920 | 3300049591 | Bacteria | 1126 |
| 679 | Ga0501075_0565796 | 3300049591 | Bacteria | 867 |
| 680 | Ga0501076_0046382 | 3300049592 | Bacteria | 3434 |
| 681 | Ga0501077_0071913 | 3300049593 | Bacteria | 2192 |
| 682 | Ga0501077_0985438 | 3300049593 | Unclassified | 542 |
| 683 | Ga0501208_167332 | 3300049655 | Bacteria | 502 |
| 684 | Ga0501079_0261116 | 3300049741 | Bacteria | 1354 |
| 685 | Ga0501080_0894693 | 3300049742 | Bacteria | 774 |
| 686 | Ga0501081_0060315 | 3300049743 | Bacteria | 2628 |
| 687 | Ga0501081_0096258 | 3300049743 | Unclassified | 2088 |
| 688 | Ga0501081_0639575 | 3300049743 | Unclassified | 797 |
| 689 | Ga0501083_0155000 | 3300049744 | Bacteria | 1500 |
| 690 | Ga0501044_0758553 | 3300049823 | Bacteria | 852 |
| 691 | Ga0501044_1228111 | 3300049823 | Bacteria | 617 |
| 692 | nmdc:mga03n38_111491_c1 | 3300050490 | Bacteria | 1333 |
| 693 | nmdc:mga03n38_424662_c1 | 3300050490 | Bacteria | 735 |
| 694 | nmdc:mga0yw44_118022_c1 | 3300050492 | Unclassified | 1706 |
| 695 | nmdc:mga06z11_496383_c1 | 3300050494 | Unclassified | 739 |
| 696 | nmdc:mga05p37_388128_c1 | 3300050507 | Bacteria | 1634 |
| 697 | nmdc:mga09592_1184421_c1 | 3300050508 | Bacteria | 632 |
| 698 | nmdc:mga09592_1349565_c1 | 3300050508 | Bacteria | 584 |
| 699 | nmdc:mga09592_934768_c1 | 3300050508 | Bacteria | 727 |
| 700 | nmdc:mga08y16_115058_c1 | 3300050511 | Bacteria | 2800 |
| 701 | nmdc:mga08y16_115445_c1 | 3300050511 | Bacteria | 2795 |
| 702 | nmdc:mga08y16_157338_c1 | 3300050511 | Bacteria | 2361 |
| 703 | nmdc:mga08y16_158476_c1 | 3300050511 | Bacteria | 2352 |
| 704 | nmdc:mga08y16_217935_c1 | 3300050511 | Bacteria | 1976 |
| 705 | nmdc:mga08y16_269180_c1 | 3300050511 | Bacteria | 1759 |
| 706 | nmdc:mga0n895_1000967_c1 | 3300050512 | Unclassified | 817 |
| 707 | nmdc:mga0n895_488661_c1 | 3300050512 | Bacteria | 1241 |
| 708 | nmdc:mga0a205_891176_c1 | 3300050515 | Bacteria | 736 |
| 709 | Ga0495601_0003646 | 3300053077 | Bacteria | 8854 |
| 710 | Ga0495601_0295440 | 3300053077 | Bacteria | 1056 |
| 711 | Ga0495612_0604346 | 3300053078 | Unclassified | 507 |
| 712 | Ga0495655_0000521 | 3300053083 | Bacteria | 6331 |
| 713 | Ga0495655_0227688 | 3300053083 | Bacteria | 619 |
| 714 | Ga0500595_014869 | 3300053119 | Bacteria | 2941 |
| 715 | Ga0501084_0060451 | 3300054114 | Bacteria | 3172 |
| 716 | Ga0466962_0645669 | 3300061719 | Bacteria | 541 |
| 717 | Ga0530510_0248891 | 3300061734 | Bacteria | 1324 |
| 718 | Ga0530510_1035927 | 3300061734 | Bacteria | 628 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_101107390 | Ga0070689_1011073902 | 78 |
| 2 | 3300005355 | Ga0070671_100729946 | Ga0070671_1007299461 | 78 |
| 3 | 3300005356 | Ga0070674_100452724 | Ga0070674_1004527242 | 78 |
| 4 | 3300009148 | Ga0105243_10812840 | Ga0105243_108128402 | 78 |
| 5 | 3300025931 | Ga0207644_10653344 | Ga0207644_106533442 | 79 |
| 6 | 3300048903 | Ga0496100_0010838 | Ga0496100_0010838_3042_3311 | 79 |
| 7 | 3300048904 | Ga0496101_0001748 | Ga0496101_0001748_11680_11949 | 79 |
| 8 | 3300048905 | Ga0496102_0823487 | Ga0496102_0823487_497_766 | 79 |
| 9 | 3300048909 | Ga0496106_0114966 | Ga0496106_0114966_651_920 | 79 |
| 10 | 3300048917 | Ga0496114_0462243 | Ga0496114_0462243_807_1076 | 79 |
| 11 | 3300041492 | Ga0451835_0486417 | Ga0451835_0486417_183_440 | 84 |
| 12 | 3300005341 | Ga0070691_10000036 | Ga0070691_100000367 | 85 |
| 13 | 3300005435 | Ga0070714_100295345 | Ga0070714_1002953452 | 85 |
| 14 | 3300005436 | Ga0070713_100340851 | Ga0070713_1003408512 | 85 |
| 15 | 3300005545 | Ga0070695_100237756 | Ga0070695_1002377562 | 85 |
| 16 | 3300006028 | Ga0070717_11094272 | Ga0070717_110942722 | 85 |
| 17 | 3300006178 | Ga0075367_10164043 | Ga0075367_101640432 | 85 |
| 18 | 3300009098 | Ga0105245_11775631 | Ga0105245_117756311 | 85 |
| 19 | 3300020081 | Ga0206354_10694457 | Ga0206354_106944572 | 85 |
| 20 | 3300021377 | Ga0213874_10033143 | Ga0213874_100331432 | 85 |
| 21 | 3300021384 | Ga0213876_10016056 | Ga0213876_100160562 | 85 |
| 22 | 3300021384 | Ga0213876_10020659 | Ga0213876_100206594 | 85 |
| 23 | 3300021384 | Ga0213876_10062355 | Ga0213876_100623552 | 85 |
| 24 | 3300021388 | Ga0213875_10029581 | Ga0213875_100295813 | 85 |
| 25 | 3300025898 | Ga0207692_10699898 | Ga0207692_106998981 | 85 |
| 26 | 3300025929 | Ga0207664_10416035 | Ga0207664_104160352 | 85 |
| 27 | 3300031903 | Ga0307407_10181597 | Ga0307407_101815972 | 85 |
| 28 | 3300031995 | Ga0307409_100528124 | Ga0307409_1005281242 | 85 |
| 29 | 3300032126 | Ga0307415_102594727 | Ga0307415_1025947272 | 85 |
| 30 | 3300037853 | Ga0436364_0840900 | Ga0436364_0840900_19720_19977 | 85 |
| 31 | 3300037853 | Ga0436364_0986790 | Ga0436364_0986790_66_323 | 85 |
| 32 | 3300039437 | Ga0436365_0025272 | Ga0436365_0025272_16137_16394 | 85 |
| 33 | 3300039437 | Ga0436365_0062040 | Ga0436365_0062040_18781_19038 | 85 |
| 34 | 3300039437 | Ga0436365_1685258 | Ga0436365_1685258_233_490 | 85 |
| 35 | 3300039450 | Ga0436363_1045732 | Ga0436363_1045732_62_319 | 85 |
| 36 | 3300039450 | Ga0436363_1227036 | Ga0436363_1227036_1781_2038 | 85 |
| 37 | 3300039450 | Ga0436363_1398997 | Ga0436363_1398997_702_959 | 85 |
| 38 | 3300039450 | Ga0436363_1578987 | Ga0436363_1578987_3627_3884 | 85 |
| 39 | 3300039453 | Ga0436362_0024438 | Ga0436362_0024438_954_1301 | 85 |
| 40 | 3300039453 | Ga0436362_0346808 | Ga0436362_0346808_230_520 | 85 |
| 41 | 3300039453 | Ga0436362_1088596 | Ga0436362_1088596_612_869 | 85 |
| 42 | 3300044683 | Ga0466965_0191470 | Ga0466965_0191470_415_672 | 85 |
| 43 | 3300045976 | Ga0466967_0019891 | Ga0466967_0019891_2939_3196 | 85 |
| 44 | 3300045976 | Ga0466967_0569223 | Ga0466967_0569223_439_696 | 85 |
| 45 | 3300045976 | Ga0466967_2348888 | Ga0466967_2348888_46_303 | 85 |
| 46 | 3300048088 | Ga0495602_0387187 | Ga0495602_0387187_693_950 | 85 |
| 47 | 3300048911 | Ga0496108_0089832 | Ga0496108_0089832_876_1139 | 85 |
| 48 | 3300048912 | Ga0496109_0001222 | Ga0496109_0001222_17916_18179 | 85 |
| 49 | 3300048914 | Ga0496111_0137186 | Ga0496111_0137186_348_611 | 85 |
| 50 | 3300050490 | nmdc:mga03n38_111491_c1 | nmdc:mga03n38_111491_c1_733_1017 | 85 |
| 51 | 3300005329 | Ga0070683_100234465 | Ga0070683_1002344651 | 86 |
| 52 | 3300005334 | Ga0068869_102157506 | Ga0068869_1021575061 | 86 |
| 53 | 3300005335 | Ga0070666_10211469 | Ga0070666_102114692 | 86 |
| 54 | 3300005337 | Ga0070682_100007138 | Ga0070682_1000071387 | 86 |
| 55 | 3300005338 | Ga0068868_100010050 | Ga0068868_1000100502 | 86 |
| 56 | 3300005338 | Ga0068868_100648830 | Ga0068868_1006488302 | 86 |
| 57 | 3300005339 | Ga0070660_100031927 | Ga0070660_1000319272 | 86 |
| 58 | 3300005341 | Ga0070691_10011903 | Ga0070691_100119032 | 86 |
| 59 | 3300005341 | Ga0070691_10321939 | Ga0070691_103219392 | 86 |
| 60 | 3300005347 | Ga0070668_100145669 | Ga0070668_1001456692 | 86 |
| 61 | 3300005347 | Ga0070668_101112767 | Ga0070668_1011127671 | 86 |
| 62 | 3300005353 | Ga0070669_100169177 | Ga0070669_1001691772 | 86 |
| 63 | 3300005354 | Ga0070675_100099857 | Ga0070675_1000998571 | 86 |
| 64 | 3300005354 | Ga0070675_101591945 | Ga0070675_1015919452 | 86 |
| 65 | 3300005355 | Ga0070671_100519028 | Ga0070671_1005190282 | 86 |
| 66 | 3300005356 | Ga0070674_100108308 | Ga0070674_1001083082 | 86 |
| 67 | 3300005356 | Ga0070674_100738979 | Ga0070674_1007389791 | 86 |
| 68 | 3300005364 | Ga0070673_100315934 | Ga0070673_1003159342 | 86 |
| 69 | 3300005365 | Ga0070688_100074839 | Ga0070688_1000748393 | 86 |
| 70 | 3300005366 | Ga0070659_100195893 | Ga0070659_1001958931 | 86 |
| 71 | 3300005435 | Ga0070714_100040485 | Ga0070714_1000404852 | 86 |
| 72 | 3300005435 | Ga0070714_101252318 | Ga0070714_1012523181 | 86 |
| 73 | 3300005436 | Ga0070713_100135837 | Ga0070713_1001358372 | 86 |
| 74 | 3300005438 | Ga0070701_11040855 | Ga0070701_110408552 | 86 |
| 75 | 3300005439 | Ga0070711_101403151 | Ga0070711_1014031511 | 86 |
| 76 | 3300005441 | Ga0070700_100047320 | Ga0070700_1000473203 | 86 |
| 77 | 3300005455 | Ga0070663_100054355 | Ga0070663_1000543553 | 86 |
| 78 | 3300005456 | Ga0070678_100024888 | Ga0070678_1000248883 | 86 |
| 79 | 3300005457 | Ga0070662_100285357 | Ga0070662_1002853572 | 86 |
| 80 | 3300005530 | Ga0070679_101992604 | Ga0070679_1019926041 | 86 |
| 81 | 3300005535 | Ga0070684_100465129 | Ga0070684_1004651291 | 86 |
| 82 | 3300005535 | Ga0070684_101594684 | Ga0070684_1015946841 | 86 |
| 83 | 3300005539 | Ga0068853_100069447 | Ga0068853_1000694473 | 86 |
| 84 | 3300005546 | Ga0070696_100694554 | Ga0070696_1006945542 | 86 |
| 85 | 3300005547 | Ga0070693_100471892 | Ga0070693_1004718922 | 86 |
| 86 | 3300005548 | Ga0070665_100137122 | Ga0070665_1001371223 | 86 |
| 87 | 3300005548 | Ga0070665_100695140 | Ga0070665_1006951402 | 86 |
| 88 | 3300005564 | Ga0070664_100347297 | Ga0070664_1003472972 | 86 |
| 89 | 3300005577 | Ga0068857_101159052 | Ga0068857_1011590522 | 86 |
| 90 | 3300005578 | Ga0068854_100072013 | Ga0068854_1000720134 | 86 |
| 91 | 3300005615 | Ga0070702_100039462 | Ga0070702_1000394623 | 86 |
| 92 | 3300005615 | Ga0070702_100800954 | Ga0070702_1008009542 | 86 |
| 93 | 3300005616 | Ga0068852_100026617 | Ga0068852_1000266173 | 86 |
| 94 | 3300005616 | Ga0068852_100926321 | Ga0068852_1009263211 | 86 |
| 95 | 3300005618 | Ga0068864_100013404 | Ga0068864_1000134042 | 86 |
| 96 | 3300005718 | Ga0068866_10419279 | Ga0068866_104192792 | 86 |
| 97 | 3300005719 | Ga0068861_100265344 | Ga0068861_1002653443 | 86 |
| 98 | 3300005841 | Ga0068863_101290701 | Ga0068863_1012907012 | 86 |
| 99 | 3300005843 | Ga0068860_100527756 | Ga0068860_1005277563 | 86 |
| 100 | 3300006028 | Ga0070717_10021464 | Ga0070717_100214645 | 86 |
| 101 | 3300006028 | Ga0070717_10382118 | Ga0070717_103821182 | 86 |
| 102 | 3300006173 | Ga0070716_101092590 | Ga0070716_1010925902 | 86 |
| 103 | 3300006175 | Ga0070712_100076020 | Ga0070712_1000760202 | 86 |
| 104 | 3300006871 | Ga0075434_100850577 | Ga0075434_1008505771 | 86 |
| 105 | 3300006871 | Ga0075434_102368070 | Ga0075434_1023680702 | 86 |
| 106 | 3300006881 | Ga0068865_100318638 | Ga0068865_1003186382 | 86 |
| 107 | 3300007076 | Ga0075435_100871773 | Ga0075435_1008717732 | 86 |
| 108 | 3300009094 | Ga0111539_10138008 | Ga0111539_101380082 | 86 |
| 109 | 3300009094 | Ga0111539_10235088 | Ga0111539_102350883 | 86 |
| 110 | 3300009098 | Ga0105245_10108713 | Ga0105245_101087133 | 86 |
| 111 | 3300009098 | Ga0105245_10664010 | Ga0105245_106640102 | 86 |
| 112 | 3300009148 | Ga0105243_10054657 | Ga0105243_100546574 | 86 |
| 113 | 3300009177 | Ga0105248_10299404 | Ga0105248_102994042 | 86 |
| 114 | 3300009545 | Ga0105237_10534083 | Ga0105237_105340832 | 86 |
| 115 | 3300010375 | Ga0105239_10300271 | Ga0105239_103002712 | 86 |
| 116 | 3300011119 | Ga0105246_10356798 | Ga0105246_103567981 | 86 |
| 117 | 3300011119 | Ga0105246_12058640 | Ga0105246_120586401 | 86 |
| 118 | 3300013105 | Ga0157369_11178130 | Ga0157369_111781302 | 86 |
| 119 | 3300013296 | Ga0157374_10042730 | Ga0157374_100427303 | 86 |
| 120 | 3300013297 | Ga0157378_10242718 | Ga0157378_102427182 | 86 |
| 121 | 3300013307 | Ga0157372_10012848 | Ga0157372_100128485 | 86 |
| 122 | 3300013308 | Ga0157375_10066165 | Ga0157375_100661652 | 86 |
| 123 | 3300014325 | Ga0163163_10046029 | Ga0163163_100460293 | 86 |
| 124 | 3300014326 | Ga0157380_10209386 | Ga0157380_102093862 | 86 |
| 125 | 3300014326 | Ga0157380_10238081 | Ga0157380_102380812 | 86 |
| 126 | 3300014745 | Ga0157377_10134527 | Ga0157377_101345271 | 86 |
| 127 | 3300021361 | Ga0213872_10287730 | Ga0213872_102877302 | 86 |
| 128 | 3300021388 | Ga0213875_10000351 | Ga0213875_100003512 | 86 |
| 129 | 3300021388 | Ga0213875_10118675 | Ga0213875_101186752 | 86 |
| 130 | 3300025901 | Ga0207688_10016243 | Ga0207688_100162433 | 86 |
| 131 | 3300025903 | Ga0207680_10267734 | Ga0207680_102677342 | 86 |
| 132 | 3300025907 | Ga0207645_10631613 | Ga0207645_106316131 | 86 |
| 133 | 3300025914 | Ga0207671_10622282 | Ga0207671_106222822 | 86 |
| 134 | 3300025915 | Ga0207693_10108283 | Ga0207693_101082831 | 86 |
| 135 | 3300025916 | Ga0207663_11559156 | Ga0207663_115591562 | 86 |
| 136 | 3300025917 | Ga0207660_10545687 | Ga0207660_105456871 | 86 |
| 137 | 3300025919 | Ga0207657_11140985 | Ga0207657_111409852 | 86 |
| 138 | 3300025921 | Ga0207652_11841609 | Ga0207652_118416092 | 86 |
| 139 | 3300025923 | Ga0207681_10154159 | Ga0207681_101541592 | 86 |
| 140 | 3300025926 | Ga0207659_10141939 | Ga0207659_101419392 | 86 |
| 141 | 3300025926 | Ga0207659_10811102 | Ga0207659_108111022 | 86 |
| 142 | 3300025927 | Ga0207687_10248118 | Ga0207687_102481182 | 86 |
| 143 | 3300025927 | Ga0207687_11302126 | Ga0207687_113021262 | 86 |
| 144 | 3300025927 | Ga0207687_11341742 | Ga0207687_113417422 | 86 |
| 145 | 3300025929 | Ga0207664_12006259 | Ga0207664_120062592 | 86 |
| 146 | 3300025931 | Ga0207644_11082504 | Ga0207644_110825041 | 86 |
| 147 | 3300025932 | Ga0207690_10295168 | Ga0207690_102951681 | 86 |
| 148 | 3300025933 | Ga0207706_10037623 | Ga0207706_100376234 | 86 |
| 149 | 3300025935 | Ga0207709_10260175 | Ga0207709_102601751 | 86 |
| 150 | 3300025936 | Ga0207670_10442135 | Ga0207670_104421351 | 86 |
| 151 | 3300025937 | Ga0207669_10171797 | Ga0207669_101717971 | 86 |
| 152 | 3300025938 | Ga0207704_10611099 | Ga0207704_106110992 | 86 |
| 153 | 3300025941 | Ga0207711_10146540 | Ga0207711_101465402 | 86 |
| 154 | 3300025942 | Ga0207689_10185474 | Ga0207689_101854741 | 86 |
| 155 | 3300025942 | Ga0207689_11148336 | Ga0207689_111483362 | 86 |
| 156 | 3300025944 | Ga0207661_10443598 | Ga0207661_104435981 | 86 |
| 157 | 3300025945 | Ga0207679_10497923 | Ga0207679_104979232 | 86 |
| 158 | 3300025960 | Ga0207651_10618004 | Ga0207651_106180042 | 86 |
| 159 | 3300025981 | Ga0207640_10453591 | Ga0207640_104535912 | 86 |
| 160 | 3300026023 | Ga0207677_10200393 | Ga0207677_102003932 | 86 |
| 161 | 3300026041 | Ga0207639_10073428 | Ga0207639_100734282 | 86 |
| 162 | 3300026067 | Ga0207678_10075798 | Ga0207678_100757983 | 86 |
| 163 | 3300026075 | Ga0207708_10002745 | Ga0207708_1000274511 | 86 |
| 164 | 3300026078 | Ga0207702_10092548 | Ga0207702_100925481 | 86 |
| 165 | 3300026078 | Ga0207702_10445767 | Ga0207702_104457671 | 86 |
| 166 | 3300026088 | Ga0207641_10665825 | Ga0207641_106658252 | 86 |
| 167 | 3300026095 | Ga0207676_12324781 | Ga0207676_123247812 | 86 |
| 168 | 3300026116 | Ga0207674_10198366 | Ga0207674_101983661 | 86 |
| 169 | 3300026118 | Ga0207675_100241932 | Ga0207675_1002419322 | 86 |
| 170 | 3300026118 | Ga0207675_100700872 | Ga0207675_1007008722 | 86 |
| 171 | 3300026121 | Ga0207683_10097704 | Ga0207683_100977041 | 86 |
| 172 | 3300026121 | Ga0207683_11703051 | Ga0207683_117030511 | 86 |
| 173 | 3300026142 | Ga0207698_11632326 | Ga0207698_116323261 | 86 |
| 174 | 3300027907 | Ga0207428_10108025 | Ga0207428_101080252 | 86 |
| 175 | 3300027907 | Ga0207428_10164016 | Ga0207428_101640163 | 86 |
| 176 | 3300028379 | Ga0268266_10364087 | Ga0268266_103640872 | 86 |
| 177 | 3300031548 | Ga0307408_101593908 | Ga0307408_1015939082 | 86 |
| 178 | 3300031852 | Ga0307410_10981868 | Ga0307410_109818681 | 86 |
| 179 | 3300031901 | Ga0307406_10361063 | Ga0307406_103610632 | 86 |
| 180 | 3300032002 | Ga0307416_100569789 | Ga0307416_1005697891 | 86 |
| 181 | 3300032005 | Ga0307411_10951267 | Ga0307411_109512672 | 86 |
| 182 | 3300035692 | Ga0373935_1394676 | Ga0373935_1394676_20_280 | 86 |
| 183 | 3300036401 | Ga0373937_1379376 | Ga0373937_1379376_169_429 | 86 |
| 184 | 3300037853 | Ga0436364_1245384 | Ga0436364_1245384_1259_1519 | 86 |
| 185 | 3300037853 | Ga0436364_1426665 | Ga0436364_1426665_1358_1618 | 86 |
| 186 | 3300039447 | Ga0436361_0425082 | Ga0436361_0425082_340_600 | 86 |
| 187 | 3300039450 | Ga0436363_0041489 | Ga0436363_0041489_62_322 | 86 |
| 188 | 3300039453 | Ga0436362_0563165 | Ga0436362_0563165_516_776 | 86 |
| 189 | 3300044735 | Ga0466968_0094150 | Ga0466968_0094150_727_987 | 86 |
| 190 | 3300045976 | Ga0466967_0262366 | Ga0466967_0262366_770_1030 | 86 |
| 191 | 3300046500 | Ga0495596_0077922 | Ga0495596_0077922_886_1146 | 86 |
| 192 | 3300046523 | Ga0495644_0215377 | Ga0495644_0215377_151_411 | 86 |
| 193 | 3300046542 | Ga0495597_0138600 | Ga0495597_0138600_190_450 | 86 |
| 194 | 3300046692 | Ga0495671_0170901 | Ga0495671_0170901_757_1017 | 86 |
| 195 | 3300047319 | Ga0495674_1497480 | Ga0495674_1497480_198_458 | 86 |
| 196 | 3300048903 | Ga0496100_0000263 | Ga0496100_0000263_8297_8563 | 86 |
| 197 | 3300048903 | Ga0496100_1002266 | Ga0496100_1002266_185_445 | 86 |
| 198 | 3300048904 | Ga0496101_0000448 | Ga0496101_0000448_8853_9119 | 86 |
| 199 | 3300048904 | Ga0496101_0147858 | Ga0496101_0147858_596_856 | 86 |
| 200 | 3300048905 | Ga0496102_0141956 | Ga0496102_0141956_946_1206 | 86 |
| 201 | 3300048906 | Ga0496103_0134998 | Ga0496103_0134998_143_403 | 86 |
| 202 | 3300048907 | Ga0496104_0047043 | Ga0496104_0047043_3163_3423 | 86 |
| 203 | 3300048908 | Ga0496105_0153433 | Ga0496105_0153433_210_470 | 86 |
| 204 | 3300048909 | Ga0496106_0035341 | Ga0496106_0035341_1961_2221 | 86 |
| 205 | 3300048910 | Ga0496107_1067017 | Ga0496107_1067017_228_488 | 86 |
| 206 | 3300048911 | Ga0496108_0095802 | Ga0496108_0095802_166_426 | 86 |
| 207 | 3300048912 | Ga0496109_0020559 | Ga0496109_0020559_1970_2230 | 86 |
| 208 | 3300048912 | Ga0496109_1955386 | Ga0496109_1955386_35_295 | 86 |
| 209 | 3300048913 | Ga0496110_0056261 | Ga0496110_0056261_2514_2774 | 86 |
| 210 | 3300048913 | Ga0496110_1079854 | Ga0496110_1079854_334_594 | 86 |
| 211 | 3300048914 | Ga0496111_0002445 | Ga0496111_0002445_6045_6305 | 86 |
| 212 | 3300048915 | Ga0496112_0163971 | Ga0496112_0163971_1844_2104 | 86 |
| 213 | 3300048915 | Ga0496112_1245764 | Ga0496112_1245764_270_530 | 86 |
| 214 | 3300048916 | Ga0496113_0017167 | Ga0496113_0017167_3538_3798 | 86 |
| 215 | 3300048917 | Ga0496114_0260733 | Ga0496114_0260733_1145_1405 | 86 |
| 216 | 3300049572 | Ga0501036_1168771 | Ga0501036_1168771_252_512 | 86 |
| 217 | 3300049584 | Ga0501068_0972326 | Ga0501068_0972326_85_345 | 86 |
| 218 | 3300049584 | Ga0501068_1136662 | Ga0501068_1136662_171_431 | 86 |
| 219 | 3300049589 | Ga0501073_1069127 | Ga0501073_1069127_64_324 | 86 |
| 220 | 3300049591 | Ga0501075_0565796 | Ga0501075_0565796_256_516 | 86 |
| 221 | 3300049741 | Ga0501079_0261116 | Ga0501079_0261116_906_1166 | 86 |
| 222 | 3300050508 | nmdc:mga09592_1349565_c1 | nmdc:mga09592_1349565_c1_76_336 | 86 |
| 223 | 3300050511 | nmdc:mga08y16_158476_c1 | nmdc:mga08y16_158476_c1_1128_1388 | 86 |
| 224 | 3300050511 | nmdc:mga08y16_269180_c1 | nmdc:mga08y16_269180_c1_830_1090 | 86 |
| 225 | 3300050512 | nmdc:mga0n895_488661_c1 | nmdc:mga0n895_488661_c1_718_978 | 86 |
| 226 | 3300053083 | Ga0495655_0227688 | Ga0495655_0227688_53_313 | 86 |
| 227 | 3300061719 | Ga0466962_0645669 | Ga0466962_0645669_95_355 | 86 |
| 228 | 3300061734 | Ga0530510_1035927 | Ga0530510_1035927_269_529 | 86 |
| 229 | 3300003373 | JGI25407J50210_10012297 | JGI25407J50210_100122972 | 87 |
| 230 | 3300005719 | Ga0068861_101600187 | Ga0068861_1016001871 | 87 |
| 231 | 3300005937 | Ga0081455_10053856 | Ga0081455_100538562 | 87 |
| 232 | 3300005937 | Ga0081455_10220487 | Ga0081455_102204872 | 87 |
| 233 | 3300005981 | Ga0081538_10000010 | Ga0081538_10000010109 | 87 |
| 234 | 3300009094 | Ga0111539_11247245 | Ga0111539_112472452 | 87 |
| 235 | 3300009098 | Ga0105245_10919179 | Ga0105245_109191792 | 87 |
| 236 | 3300025908 | Ga0207643_10675600 | Ga0207643_106756001 | 87 |
| 237 | 3300025935 | Ga0207709_11549829 | Ga0207709_115498291 | 87 |
| 238 | 3300026118 | Ga0207675_100273619 | Ga0207675_1002736192 | 87 |
| 239 | 3300032002 | Ga0307416_100261872 | Ga0307416_1002618722 | 87 |
| 240 | 3300032126 | Ga0307415_100778849 | Ga0307415_1007788492 | 87 |
| 241 | 3300035085 | Ga0373929_0229435 | Ga0373929_0229435_121_384 | 87 |
| 242 | 3300044693 | Ga0466961_0470518 | Ga0466961_0470518_454_717 | 87 |
| 243 | 3300044694 | Ga0466963_0321432 | Ga0466963_0321432_565_828 | 87 |
| 244 | 3300044901 | Ga0466960_0540832 | Ga0466960_0540832_62_325 | 87 |
| 245 | 3300045049 | Ga0466959_0550424 | Ga0466959_0550424_168_431 | 87 |
| 246 | 3300045836 | Ga0466958_0781596 | Ga0466958_0781596_28_291 | 87 |
| 247 | 3300045976 | Ga0466967_0129094 | Ga0466967_0129094_930_1193 | 87 |
| 248 | 3300045976 | Ga0466967_2046651 | Ga0466967_2046651_263_526 | 87 |
| 249 | 3300046462 | Ga0495651_0171278 | Ga0495651_0171278_177_440 | 87 |
| 250 | 3300046463 | Ga0495653_0108873 | Ga0495653_0108873_26_289 | 87 |
| 251 | 3300046516 | Ga0495628_0910425 | Ga0495628_0910425_208_471 | 87 |
| 252 | 3300047319 | Ga0495674_0724573 | Ga0495674_0724573_153_416 | 87 |
| 253 | 3300047472 | Ga0495686_0338213 | Ga0495686_0338213_374_637 | 87 |
| 254 | 3300048916 | Ga0496113_0193871 | Ga0496113_0193871_948_1223 | 87 |
| 255 | 3300049743 | Ga0501081_0060315 | Ga0501081_0060315_606_869 | 87 |
| 256 | 3300053077 | Ga0495601_0295440 | Ga0495601_0295440_358_621 | 87 |
| 257 | 3300053078 | Ga0495612_0604346 | Ga0495612_0604346_152_415 | 87 |
| 258 | 3300000549 | LJQas_1003721 | LJQas_10037212 | 88 |
| 259 | 3300005327 | Ga0070658_10993827 | Ga0070658_109938271 | 88 |
| 260 | 3300005329 | Ga0070683_100079293 | Ga0070683_1000792933 | 88 |
| 261 | 3300005329 | Ga0070683_100268237 | Ga0070683_1002682372 | 88 |
| 262 | 3300005329 | Ga0070683_101102070 | Ga0070683_1011020702 | 88 |
| 263 | 3300005330 | Ga0070690_101156523 | Ga0070690_1011565232 | 88 |
| 264 | 3300005331 | Ga0070670_100399115 | Ga0070670_1003991152 | 88 |
| 265 | 3300005334 | Ga0068869_100091774 | Ga0068869_1000917742 | 88 |
| 266 | 3300005335 | Ga0070666_10256104 | Ga0070666_102561042 | 88 |
| 267 | 3300005336 | Ga0070680_100238447 | Ga0070680_1002384472 | 88 |
| 268 | 3300005336 | Ga0070680_101108248 | Ga0070680_1011082482 | 88 |
| 269 | 3300005336 | Ga0070680_101179354 | Ga0070680_1011793542 | 88 |
| 270 | 3300005337 | Ga0070682_100047721 | Ga0070682_1000477213 | 88 |
| 271 | 3300005337 | Ga0070682_100077275 | Ga0070682_1000772752 | 88 |
| 272 | 3300005337 | Ga0070682_102035353 | Ga0070682_1020353531 | 88 |
| 273 | 3300005338 | Ga0068868_100851474 | Ga0068868_1008514741 | 88 |
| 274 | 3300005340 | Ga0070689_100246910 | Ga0070689_1002469101 | 88 |
| 275 | 3300005341 | Ga0070691_10168754 | Ga0070691_101687542 | 88 |
| 276 | 3300005343 | Ga0070687_100451609 | Ga0070687_1004516091 | 88 |
| 277 | 3300005343 | Ga0070687_100991779 | Ga0070687_1009917791 | 88 |
| 278 | 3300005344 | Ga0070661_100000121 | Ga0070661_1000001217 | 88 |
| 279 | 3300005344 | Ga0070661_100399284 | Ga0070661_1003992842 | 88 |
| 280 | 3300005345 | Ga0070692_10045198 | Ga0070692_100451982 | 88 |
| 281 | 3300005347 | Ga0070668_100658453 | Ga0070668_1006584532 | 88 |
| 282 | 3300005353 | Ga0070669_100259329 | Ga0070669_1002593292 | 88 |
| 283 | 3300005353 | Ga0070669_100653961 | Ga0070669_1006539612 | 88 |
| 284 | 3300005354 | Ga0070675_101571817 | Ga0070675_1015718171 | 88 |
| 285 | 3300005355 | Ga0070671_100270008 | Ga0070671_1002700082 | 88 |
| 286 | 3300005355 | Ga0070671_100716991 | Ga0070671_1007169912 | 88 |
| 287 | 3300005355 | Ga0070671_101216978 | Ga0070671_1012169781 | 88 |
| 288 | 3300005364 | Ga0070673_100087760 | Ga0070673_1000877603 | 88 |
| 289 | 3300005365 | Ga0070688_100024878 | Ga0070688_1000248783 | 88 |
| 290 | 3300005366 | Ga0070659_100268641 | Ga0070659_1002686412 | 88 |
| 291 | 3300005366 | Ga0070659_100876186 | Ga0070659_1008761862 | 88 |
| 292 | 3300005435 | Ga0070714_100318676 | Ga0070714_1003186762 | 88 |
| 293 | 3300005435 | Ga0070714_101686631 | Ga0070714_1016866311 | 88 |
| 294 | 3300005438 | Ga0070701_10883995 | Ga0070701_108839951 | 88 |
| 295 | 3300005439 | Ga0070711_100001758 | Ga0070711_10000175811 | 88 |
| 296 | 3300005439 | Ga0070711_100197261 | Ga0070711_1001972611 | 88 |
| 297 | 3300005440 | Ga0070705_101128450 | Ga0070705_1011284501 | 88 |
| 298 | 3300005441 | Ga0070700_100094863 | Ga0070700_1000948632 | 88 |
| 299 | 3300005441 | Ga0070700_100127834 | Ga0070700_1001278342 | 88 |
| 300 | 3300005441 | Ga0070700_101012078 | Ga0070700_1010120782 | 88 |
| 301 | 3300005444 | Ga0070694_100951667 | Ga0070694_1009516671 | 88 |
| 302 | 3300005455 | Ga0070663_100262763 | Ga0070663_1002627632 | 88 |
| 303 | 3300005455 | Ga0070663_100628260 | Ga0070663_1006282602 | 88 |
| 304 | 3300005456 | Ga0070678_100157828 | Ga0070678_1001578283 | 88 |
| 305 | 3300005456 | Ga0070678_101368757 | Ga0070678_1013687572 | 88 |
| 306 | 3300005457 | Ga0070662_101661841 | Ga0070662_1016618411 | 88 |
| 307 | 3300005459 | Ga0068867_100123876 | Ga0068867_1001238762 | 88 |
| 308 | 3300005459 | Ga0068867_100455530 | Ga0068867_1004555302 | 88 |
| 309 | 3300005466 | Ga0070685_10063306 | Ga0070685_100633062 | 88 |
| 310 | 3300005466 | Ga0070685_11168132 | Ga0070685_111681321 | 88 |
| 311 | 3300005530 | Ga0070679_100659778 | Ga0070679_1006597781 | 88 |
| 312 | 3300005530 | Ga0070679_100949116 | Ga0070679_1009491161 | 88 |
| 313 | 3300005535 | Ga0070684_100064281 | Ga0070684_1000642811 | 88 |
| 314 | 3300005535 | Ga0070684_100071876 | Ga0070684_1000718762 | 88 |
| 315 | 3300005535 | Ga0070684_100294417 | Ga0070684_1002944172 | 88 |
| 316 | 3300005535 | Ga0070684_101106408 | Ga0070684_1011064081 | 88 |
| 317 | 3300005539 | Ga0068853_100150063 | Ga0068853_1001500632 | 88 |
| 318 | 3300005539 | Ga0068853_102223912 | Ga0068853_1022239122 | 88 |
| 319 | 3300005544 | Ga0070686_100216560 | Ga0070686_1002165601 | 88 |
| 320 | 3300005545 | Ga0070695_100588833 | Ga0070695_1005888331 | 88 |
| 321 | 3300005546 | Ga0070696_100833335 | Ga0070696_1008333352 | 88 |
| 322 | 3300005546 | Ga0070696_101009077 | Ga0070696_1010090772 | 88 |
| 323 | 3300005547 | Ga0070693_100128480 | Ga0070693_1001284802 | 88 |
| 324 | 3300005549 | Ga0070704_100471076 | Ga0070704_1004710762 | 88 |
| 325 | 3300005549 | Ga0070704_101277544 | Ga0070704_1012775442 | 88 |
| 326 | 3300005564 | Ga0070664_100067895 | Ga0070664_1000678951 | 88 |
| 327 | 3300005577 | Ga0068857_100422012 | Ga0068857_1004220122 | 88 |
| 328 | 3300005577 | Ga0068857_100943566 | Ga0068857_1009435661 | 88 |
| 329 | 3300005578 | Ga0068854_100164987 | Ga0068854_1001649872 | 88 |
| 330 | 3300005578 | Ga0068854_100259550 | Ga0068854_1002595502 | 88 |
| 331 | 3300005578 | Ga0068854_100349091 | Ga0068854_1003490912 | 88 |
| 332 | 3300005578 | Ga0068854_101746285 | Ga0068854_1017462851 | 88 |
| 333 | 3300005614 | Ga0068856_100154621 | Ga0068856_1001546212 | 88 |
| 334 | 3300005614 | Ga0068856_100332574 | Ga0068856_1003325742 | 88 |
| 335 | 3300005614 | Ga0068856_100766437 | Ga0068856_1007664372 | 88 |
| 336 | 3300005614 | Ga0068856_101029126 | Ga0068856_1010291262 | 88 |
| 337 | 3300005614 | Ga0068856_101274202 | Ga0068856_1012742021 | 88 |
| 338 | 3300005615 | Ga0070702_100007435 | Ga0070702_1000074352 | 88 |
| 339 | 3300005615 | Ga0070702_100209512 | Ga0070702_1002095121 | 88 |
| 340 | 3300005615 | Ga0070702_100634301 | Ga0070702_1006343012 | 88 |
| 341 | 3300005616 | Ga0068852_100582542 | Ga0068852_1005825422 | 88 |
| 342 | 3300005617 | Ga0068859_100205668 | Ga0068859_1002056682 | 88 |
| 343 | 3300005618 | Ga0068864_100151603 | Ga0068864_1001516032 | 88 |
| 344 | 3300005718 | Ga0068866_10347831 | Ga0068866_103478312 | 88 |
| 345 | 3300005719 | Ga0068861_100052918 | Ga0068861_1000529182 | 88 |
| 346 | 3300005719 | Ga0068861_101953409 | Ga0068861_1019534092 | 88 |
| 347 | 3300005840 | Ga0068870_11328003 | Ga0068870_113280032 | 88 |
| 348 | 3300005842 | Ga0068858_100810577 | Ga0068858_1008105772 | 88 |
| 349 | 3300005844 | Ga0068862_100131450 | Ga0068862_1001314502 | 88 |
| 350 | 3300005844 | Ga0068862_101935617 | Ga0068862_1019356172 | 88 |
| 351 | 3300005937 | Ga0081455_10006687 | Ga0081455_100066873 | 88 |
| 352 | 3300005937 | Ga0081455_10260881 | Ga0081455_102608812 | 88 |
| 353 | 3300005981 | Ga0081538_10004233 | Ga0081538_1000423310 | 88 |
| 354 | 3300005983 | Ga0081540_1058138 | Ga0081540_10581382 | 88 |
| 355 | 3300005985 | Ga0081539_10014299 | Ga0081539_100142994 | 88 |
| 356 | 3300006038 | Ga0075365_10142667 | Ga0075365_101426672 | 88 |
| 357 | 3300006048 | Ga0075363_100425443 | Ga0075363_1004254432 | 88 |
| 358 | 3300006173 | Ga0070716_100129954 | Ga0070716_1001299542 | 88 |
| 359 | 3300006178 | Ga0075367_10592735 | Ga0075367_105927352 | 88 |
| 360 | 3300006844 | Ga0075428_100102641 | Ga0075428_1001026413 | 88 |
| 361 | 3300006844 | Ga0075428_100727192 | Ga0075428_1007271922 | 88 |
| 362 | 3300006847 | Ga0075431_101074529 | Ga0075431_1010745292 | 88 |
| 363 | 3300006880 | Ga0075429_100549721 | Ga0075429_1005497212 | 88 |
| 364 | 3300006881 | Ga0068865_100083165 | Ga0068865_1000831652 | 88 |
| 365 | 3300006881 | Ga0068865_100653734 | Ga0068865_1006537342 | 88 |
| 366 | 3300006931 | Ga0097620_100205671 | Ga0097620_1002056712 | 88 |
| 367 | 3300007076 | Ga0075435_101289371 | Ga0075435_1012893712 | 88 |
| 368 | 3300009093 | Ga0105240_10843774 | Ga0105240_108437742 | 88 |
| 369 | 3300009094 | Ga0111539_10089788 | Ga0111539_100897882 | 88 |
| 370 | 3300009094 | Ga0111539_10118853 | Ga0111539_101188532 | 88 |
| 371 | 3300009094 | Ga0111539_10136307 | Ga0111539_101363072 | 88 |
| 372 | 3300009094 | Ga0111539_10409133 | Ga0111539_104091332 | 88 |
| 373 | 3300009094 | Ga0111539_13526584 | Ga0111539_135265841 | 88 |
| 374 | 3300009098 | Ga0105245_10398686 | Ga0105245_103986862 | 88 |
| 375 | 3300009098 | Ga0105245_10422968 | Ga0105245_104229682 | 88 |
| 376 | 3300009101 | Ga0105247_10026037 | Ga0105247_100260372 | 88 |
| 377 | 3300009101 | Ga0105247_10494181 | Ga0105247_104941811 | 88 |
| 378 | 3300009101 | Ga0105247_11074637 | Ga0105247_110746372 | 88 |
| 379 | 3300009147 | Ga0114129_10110299 | Ga0114129_101102992 | 88 |
| 380 | 3300009148 | Ga0105243_10019896 | Ga0105243_100198962 | 88 |
| 381 | 3300009148 | Ga0105243_10023843 | Ga0105243_100238435 | 88 |
| 382 | 3300009148 | Ga0105243_10308697 | Ga0105243_103086972 | 88 |
| 383 | 3300009148 | Ga0105243_10378264 | Ga0105243_103782642 | 88 |
| 384 | 3300009148 | Ga0105243_10848690 | Ga0105243_108486901 | 88 |
| 385 | 3300009176 | Ga0105242_10236711 | Ga0105242_102367112 | 88 |
| 386 | 3300009176 | Ga0105242_10694396 | Ga0105242_106943961 | 88 |
| 387 | 3300009176 | Ga0105242_11887535 | Ga0105242_118875351 | 88 |
| 388 | 3300009176 | Ga0105242_11900143 | Ga0105242_119001432 | 88 |
| 389 | 3300009176 | Ga0105242_12855253 | Ga0105242_128552531 | 88 |
| 390 | 3300009177 | Ga0105248_11696473 | Ga0105248_116964731 | 88 |
| 391 | 3300009177 | Ga0105248_12991718 | Ga0105248_129917181 | 88 |
| 392 | 3300009545 | Ga0105237_10255961 | Ga0105237_102559612 | 88 |
| 393 | 3300009551 | Ga0105238_10573913 | Ga0105238_105739132 | 88 |
| 394 | 3300009553 | Ga0105249_10066786 | Ga0105249_100667862 | 88 |
| 395 | 3300009553 | Ga0105249_10270563 | Ga0105249_102705632 | 88 |
| 396 | 3300009553 | Ga0105249_12057678 | Ga0105249_120576782 | 88 |
| 397 | 3300010375 | Ga0105239_10044868 | Ga0105239_100448684 | 88 |
| 398 | 3300010375 | Ga0105239_10229283 | Ga0105239_102292832 | 88 |
| 399 | 3300010375 | Ga0105239_10245576 | Ga0105239_102455762 | 88 |
| 400 | 3300011119 | Ga0105246_11458175 | Ga0105246_114581751 | 88 |
| 401 | 3300013105 | Ga0157369_10228435 | Ga0157369_102284353 | 88 |
| 402 | 3300013296 | Ga0157374_10429397 | Ga0157374_104293972 | 88 |
| 403 | 3300013296 | Ga0157374_10687606 | Ga0157374_106876062 | 88 |
| 404 | 3300013296 | Ga0157374_11849776 | Ga0157374_118497762 | 88 |
| 405 | 3300013306 | Ga0163162_10245249 | Ga0163162_102452492 | 88 |
| 406 | 3300013306 | Ga0163162_11614008 | Ga0163162_116140082 | 88 |
| 407 | 3300013307 | Ga0157372_10176165 | Ga0157372_101761652 | 88 |
| 408 | 3300013307 | Ga0157372_10746142 | Ga0157372_107461422 | 88 |
| 409 | 3300013307 | Ga0157372_10977835 | Ga0157372_109778352 | 88 |
| 410 | 3300013307 | Ga0157372_12025757 | Ga0157372_120257572 | 88 |
| 411 | 3300013307 | Ga0157372_13082470 | Ga0157372_130824701 | 88 |
| 412 | 3300013308 | Ga0157375_10041901 | Ga0157375_100419013 | 88 |
| 413 | 3300013308 | Ga0157375_10572357 | Ga0157375_105723572 | 88 |
| 414 | 3300013308 | Ga0157375_10779208 | Ga0157375_107792082 | 88 |
| 415 | 3300013308 | Ga0157375_10941341 | Ga0157375_109413411 | 88 |
| 416 | 3300014325 | Ga0163163_10182441 | Ga0163163_101824412 | 88 |
| 417 | 3300014325 | Ga0163163_10524071 | Ga0163163_105240711 | 88 |
| 418 | 3300014326 | Ga0157380_11028025 | Ga0157380_110280252 | 88 |
| 419 | 3300014326 | Ga0157380_12939863 | Ga0157380_129398631 | 88 |
| 420 | 3300014326 | Ga0157380_13543780 | Ga0157380_135437802 | 88 |
| 421 | 3300014745 | Ga0157377_10420860 | Ga0157377_104208602 | 88 |
| 422 | 3300014745 | Ga0157377_10559778 | Ga0157377_105597782 | 88 |
| 423 | 3300014968 | Ga0157379_10201032 | Ga0157379_102010321 | 88 |
| 424 | 3300014968 | Ga0157379_10545873 | Ga0157379_105458732 | 88 |
| 425 | 3300014969 | Ga0157376_10229611 | Ga0157376_102296112 | 88 |
| 426 | 3300020610 | Ga0154015_1575334 | Ga0154015_15753342 | 88 |
| 427 | 3300021358 | Ga0213873_10007528 | Ga0213873_100075283 | 88 |
| 428 | 3300021377 | Ga0213874_10054906 | Ga0213874_100549062 | 88 |
| 429 | 3300021384 | Ga0213876_10003076 | Ga0213876_100030767 | 88 |
| 430 | 3300021384 | Ga0213876_10543979 | Ga0213876_105439792 | 88 |
| 431 | 3300021388 | Ga0213875_10044831 | Ga0213875_100448312 | 88 |
| 432 | 3300025899 | Ga0207642_10068187 | Ga0207642_100681872 | 88 |
| 433 | 3300025899 | Ga0207642_10069521 | Ga0207642_100695212 | 88 |
| 434 | 3300025899 | Ga0207642_10270648 | Ga0207642_102706482 | 88 |
| 435 | 3300025900 | Ga0207710_10372713 | Ga0207710_103727132 | 88 |
| 436 | 3300025901 | Ga0207688_10011962 | Ga0207688_100119621 | 88 |
| 437 | 3300025903 | Ga0207680_10851897 | Ga0207680_108518972 | 88 |
| 438 | 3300025904 | Ga0207647_10169641 | Ga0207647_101696412 | 88 |
| 439 | 3300025907 | Ga0207645_10561847 | Ga0207645_105618471 | 88 |
| 440 | 3300025908 | Ga0207643_10054459 | Ga0207643_100544592 | 88 |
| 441 | 3300025910 | Ga0207684_11309512 | Ga0207684_113095122 | 88 |
| 442 | 3300025914 | Ga0207671_11508595 | Ga0207671_115085951 | 88 |
| 443 | 3300025916 | Ga0207663_10001192 | Ga0207663_1000119212 | 88 |
| 444 | 3300025916 | Ga0207663_10014473 | Ga0207663_100144732 | 88 |
| 445 | 3300025917 | Ga0207660_11181358 | Ga0207660_111813581 | 88 |
| 446 | 3300025918 | Ga0207662_10007363 | Ga0207662_100073633 | 88 |
| 447 | 3300025919 | Ga0207657_10129056 | Ga0207657_101290562 | 88 |
| 448 | 3300025921 | Ga0207652_10766905 | Ga0207652_107669052 | 88 |
| 449 | 3300025923 | Ga0207681_10195611 | Ga0207681_101956112 | 88 |
| 450 | 3300025924 | Ga0207694_10606835 | Ga0207694_106068352 | 88 |
| 451 | 3300025927 | Ga0207687_10876091 | Ga0207687_108760912 | 88 |
| 452 | 3300025931 | Ga0207644_10176874 | Ga0207644_101768742 | 88 |
| 453 | 3300025931 | Ga0207644_10605621 | Ga0207644_106056212 | 88 |
| 454 | 3300025932 | Ga0207690_10033481 | Ga0207690_100334812 | 88 |
| 455 | 3300025932 | Ga0207690_10080597 | Ga0207690_100805972 | 88 |
| 456 | 3300025933 | Ga0207706_10508765 | Ga0207706_105087652 | 88 |
| 457 | 3300025933 | Ga0207706_11145076 | Ga0207706_111450762 | 88 |
| 458 | 3300025934 | Ga0207686_10081376 | Ga0207686_100813762 | 88 |
| 459 | 3300025934 | Ga0207686_10500230 | Ga0207686_105002302 | 88 |
| 460 | 3300025935 | Ga0207709_10236491 | Ga0207709_102364912 | 88 |
| 461 | 3300025935 | Ga0207709_11364356 | Ga0207709_113643561 | 88 |
| 462 | 3300025937 | Ga0207669_10382777 | Ga0207669_103827772 | 88 |
| 463 | 3300025938 | Ga0207704_10240663 | Ga0207704_102406632 | 88 |
| 464 | 3300025940 | Ga0207691_10150056 | Ga0207691_101500561 | 88 |
| 465 | 3300025941 | Ga0207711_10809786 | Ga0207711_108097862 | 88 |
| 466 | 3300025944 | Ga0207661_10111673 | Ga0207661_101116732 | 88 |
| 467 | 3300025944 | Ga0207661_10790253 | Ga0207661_107902531 | 88 |
| 468 | 3300025944 | Ga0207661_11614958 | Ga0207661_116149581 | 88 |
| 469 | 3300025944 | Ga0207661_11843451 | Ga0207661_118434511 | 88 |
| 470 | 3300025945 | Ga0207679_10026630 | Ga0207679_100266303 | 88 |
| 471 | 3300025945 | Ga0207679_10729739 | Ga0207679_107297391 | 88 |
| 472 | 3300025960 | Ga0207651_10236092 | Ga0207651_102360922 | 88 |
| 473 | 3300025961 | Ga0207712_10249645 | Ga0207712_102496452 | 88 |
| 474 | 3300025961 | Ga0207712_11432158 | Ga0207712_114321581 | 88 |
| 475 | 3300025972 | Ga0207668_10583935 | Ga0207668_105839352 | 88 |
| 476 | 3300025981 | Ga0207640_10163885 | Ga0207640_101638852 | 88 |
| 477 | 3300025981 | Ga0207640_10504307 | Ga0207640_105043072 | 88 |
| 478 | 3300025981 | Ga0207640_11369478 | Ga0207640_113694781 | 88 |
| 479 | 3300025986 | Ga0207658_10508830 | Ga0207658_105088302 | 88 |
| 480 | 3300025986 | Ga0207658_10745226 | Ga0207658_107452262 | 88 |
| 481 | 3300026023 | Ga0207677_10036819 | Ga0207677_100368193 | 88 |
| 482 | 3300026035 | Ga0207703_10340132 | Ga0207703_103401321 | 88 |
| 483 | 3300026067 | Ga0207678_10145172 | Ga0207678_101451722 | 88 |
| 484 | 3300026067 | Ga0207678_10283955 | Ga0207678_102839552 | 88 |
| 485 | 3300026067 | Ga0207678_10387771 | Ga0207678_103877712 | 88 |
| 486 | 3300026075 | Ga0207708_10051464 | Ga0207708_100514642 | 88 |
| 487 | 3300026075 | Ga0207708_10087035 | Ga0207708_100870352 | 88 |
| 488 | 3300026075 | Ga0207708_10102782 | Ga0207708_101027823 | 88 |
| 489 | 3300026075 | Ga0207708_10234988 | Ga0207708_102349881 | 88 |
| 490 | 3300026078 | Ga0207702_10060445 | Ga0207702_100604453 | 88 |
| 491 | 3300026078 | Ga0207702_10135259 | Ga0207702_101352591 | 88 |
| 492 | 3300026078 | Ga0207702_10226691 | Ga0207702_102266912 | 88 |
| 493 | 3300026078 | Ga0207702_11078001 | Ga0207702_110780012 | 88 |
| 494 | 3300026089 | Ga0207648_10157348 | Ga0207648_101573482 | 88 |
| 495 | 3300026089 | Ga0207648_10482810 | Ga0207648_104828102 | 88 |
| 496 | 3300026089 | Ga0207648_11823395 | Ga0207648_118233952 | 88 |
| 497 | 3300026095 | Ga0207676_10087867 | Ga0207676_100878672 | 88 |
| 498 | 3300026116 | Ga0207674_10075148 | Ga0207674_100751482 | 88 |
| 499 | 3300026116 | Ga0207674_10093531 | Ga0207674_100935312 | 88 |
| 500 | 3300026116 | Ga0207674_10657683 | Ga0207674_106576832 | 88 |
| 501 | 3300026118 | Ga0207675_100120105 | Ga0207675_1001201053 | 88 |
| 502 | 3300026118 | Ga0207675_100262083 | Ga0207675_1002620832 | 88 |
| 503 | 3300026118 | Ga0207675_100814168 | Ga0207675_1008141682 | 88 |
| 504 | 3300026118 | Ga0207675_101954770 | Ga0207675_1019547702 | 88 |
| 505 | 3300026118 | Ga0207675_102741615 | Ga0207675_1027416151 | 88 |
| 506 | 3300026121 | Ga0207683_10160787 | Ga0207683_101607872 | 88 |
| 507 | 3300026121 | Ga0207683_10819425 | Ga0207683_108194252 | 88 |
| 508 | 3300026142 | Ga0207698_10287982 | Ga0207698_102879821 | 88 |
| 509 | 3300026142 | Ga0207698_10404552 | Ga0207698_104045522 | 88 |
| 510 | 3300026142 | Ga0207698_10691324 | Ga0207698_106913242 | 88 |
| 511 | 3300026142 | Ga0207698_11207210 | Ga0207698_112072102 | 88 |
| 512 | 3300027907 | Ga0207428_10078696 | Ga0207428_100786962 | 88 |
| 513 | 3300027907 | Ga0207428_10121916 | Ga0207428_101219163 | 88 |
| 514 | 3300028379 | Ga0268266_11888167 | Ga0268266_118881672 | 88 |
| 515 | 3300028380 | Ga0268265_10923226 | Ga0268265_109232262 | 88 |
| 516 | 3300031548 | Ga0307408_100395495 | Ga0307408_1003954952 | 88 |
| 517 | 3300031548 | Ga0307408_100781814 | Ga0307408_1007818142 | 88 |
| 518 | 3300031731 | Ga0307405_11020078 | Ga0307405_110200782 | 88 |
| 519 | 3300031824 | Ga0307413_10251431 | Ga0307413_102514312 | 88 |
| 520 | 3300031824 | Ga0307413_10641453 | Ga0307413_106414532 | 88 |
| 521 | 3300031824 | Ga0307413_11714469 | Ga0307413_117144691 | 88 |
| 522 | 3300031852 | Ga0307410_10075623 | Ga0307410_100756232 | 88 |
| 523 | 3300031852 | Ga0307410_10118200 | Ga0307410_101182002 | 88 |
| 524 | 3300031852 | Ga0307410_10330229 | Ga0307410_103302292 | 88 |
| 525 | 3300031852 | Ga0307410_10351504 | Ga0307410_103515042 | 88 |
| 526 | 3300031901 | Ga0307406_10155606 | Ga0307406_101556062 | 88 |
| 527 | 3300031901 | Ga0307406_10246390 | Ga0307406_102463902 | 88 |
| 528 | 3300031901 | Ga0307406_10515088 | Ga0307406_105150882 | 88 |
| 529 | 3300031901 | Ga0307406_10671684 | Ga0307406_106716842 | 88 |
| 530 | 3300031901 | Ga0307406_11130422 | Ga0307406_111304221 | 88 |
| 531 | 3300031903 | Ga0307407_10305571 | Ga0307407_103055711 | 88 |
| 532 | 3300031903 | Ga0307407_10369759 | Ga0307407_103697592 | 88 |
| 533 | 3300031903 | Ga0307407_10555491 | Ga0307407_105554912 | 88 |
| 534 | 3300031903 | Ga0307407_11100321 | Ga0307407_111003211 | 88 |
| 535 | 3300031911 | Ga0307412_10316882 | Ga0307412_103168822 | 88 |
| 536 | 3300031995 | Ga0307409_100031646 | Ga0307409_1000316463 | 88 |
| 537 | 3300031995 | Ga0307409_100077950 | Ga0307409_1000779502 | 88 |
| 538 | 3300031995 | Ga0307409_100186251 | Ga0307409_1001862513 | 88 |
| 539 | 3300031995 | Ga0307409_100392834 | Ga0307409_1003928342 | 88 |
| 540 | 3300031995 | Ga0307409_101144535 | Ga0307409_1011445351 | 88 |
| 541 | 3300031995 | Ga0307409_101511624 | Ga0307409_1015116242 | 88 |
| 542 | 3300031995 | Ga0307409_101915349 | Ga0307409_1019153492 | 88 |
| 543 | 3300032002 | Ga0307416_100199592 | Ga0307416_1001995922 | 88 |
| 544 | 3300032002 | Ga0307416_102460723 | Ga0307416_1024607231 | 88 |
| 545 | 3300032004 | Ga0307414_10757133 | Ga0307414_107571331 | 88 |
| 546 | 3300032004 | Ga0307414_11147212 | Ga0307414_111472122 | 88 |
| 547 | 3300032005 | Ga0307411_10412570 | Ga0307411_104125702 | 88 |
| 548 | 3300032005 | Ga0307411_10581759 | Ga0307411_105817592 | 88 |
| 549 | 3300032005 | Ga0307411_11395829 | Ga0307411_113958291 | 88 |
| 550 | 3300032126 | Ga0307415_100155138 | Ga0307415_1001551383 | 88 |
| 551 | 3300032126 | Ga0307415_100296308 | Ga0307415_1002963082 | 88 |
| 552 | 3300032126 | Ga0307415_100319177 | Ga0307415_1003191772 | 88 |
| 553 | 3300032126 | Ga0307415_100618262 | Ga0307415_1006182622 | 88 |
| 554 | 3300032126 | Ga0307415_101895232 | Ga0307415_1018952321 | 88 |
| 555 | 3300035112 | Ga0373932_0118756 | Ga0373932_0118756_366_635 | 88 |
| 556 | 3300035121 | Ga0373960_0150023 | Ga0373960_0150023_123_389 | 88 |
| 557 | 3300035121 | Ga0373960_0356485 | Ga0373960_0356485_45_314 | 88 |
| 558 | 3300035242 | Ga0373962_0195440 | Ga0373962_0195440_86_358 | 88 |
| 559 | 3300035691 | Ga0373931_0539495 | Ga0373931_0539495_371_646 | 88 |
| 560 | 3300037312 | Ga0395899_0226452 | Ga0395899_0226452_976_1242 | 88 |
| 561 | 3300037312 | Ga0395899_0396017 | Ga0395899_0396017_99_365 | 88 |
| 562 | 3300037466 | Ga0395898_0069273 | Ga0395898_0069273_367_633 | 88 |
| 563 | 3300037471 | Ga0395905_0086086 | Ga0395905_0086086_967_1233 | 88 |
| 564 | 3300037471 | Ga0395905_1540166 | Ga0395905_1540166_248_517 | 88 |
| 565 | 3300037853 | Ga0436364_0344394 | Ga0436364_0344394_16273_16542 | 88 |
| 566 | 3300037853 | Ga0436364_0834563 | Ga0436364_0834563_258_527 | 88 |
| 567 | 3300037853 | Ga0436364_1059222 | Ga0436364_1059222_69_338 | 88 |
| 568 | 3300038443 | Ga0395901_0009876 | Ga0395901_0009876_6505_6771 | 88 |
| 569 | 3300038443 | Ga0395901_0261307 | Ga0395901_0261307_1140_1406 | 88 |
| 570 | 3300038443 | Ga0395901_2139192 | Ga0395901_2139192_27_296 | 88 |
| 571 | 3300039437 | Ga0436365_0975923 | Ga0436365_0975923_3507_3776 | 88 |
| 572 | 3300039437 | Ga0436365_1207297 | Ga0436365_1207297_390_656 | 88 |
| 573 | 3300039437 | Ga0436365_1687595 | Ga0436365_1687595_4075_4341 | 88 |
| 574 | 3300039437 | Ga0436365_1743192 | Ga0436365_1743192_320_586 | 88 |
| 575 | 3300039450 | Ga0436363_0329309 | Ga0436363_0329309_1185_1451 | 88 |
| 576 | 3300039450 | Ga0436363_0352791 | Ga0436363_0352791_198_467 | 88 |
| 577 | 3300039450 | Ga0436363_0543039 | Ga0436363_0543039_322_591 | 88 |
| 578 | 3300039453 | Ga0436362_0271598 | Ga0436362_0271598_30_296 | 88 |
| 579 | 3300039453 | Ga0436362_0342263 | Ga0436362_0342263_276_545 | 88 |
| 580 | 3300039453 | Ga0436362_0562392 | Ga0436362_0562392_371_640 | 88 |
| 581 | 3300039453 | Ga0436362_0859181 | Ga0436362_0859181_846_1112 | 88 |
| 582 | 3300041452 | Ga0451793_0007379 | Ga0451793_0007379_75_341 | 88 |
| 583 | 3300042016 | Ga0439463_095779 | Ga0439463_095779_291_557 | 88 |
| 584 | 3300044656 | Ga0466969_0195809 | Ga0466969_0195809_349_618 | 88 |
| 585 | 3300044656 | Ga0466969_0398035 | Ga0466969_0398035_50_319 | 88 |
| 586 | 3300044658 | Ga0466972_0099975 | Ga0466972_0099975_201_470 | 88 |
| 587 | 3300044684 | Ga0466966_0014187 | Ga0466966_0014187_3638_3904 | 88 |
| 588 | 3300044693 | Ga0466961_0291646 | Ga0466961_0291646_160_426 | 88 |
| 589 | 3300044693 | Ga0466961_0469489 | Ga0466961_0469489_478_747 | 88 |
| 590 | 3300044693 | Ga0466961_0588653 | Ga0466961_0588653_165_434 | 88 |
| 591 | 3300044706 | Ga0466964_0165556 | Ga0466964_0165556_207_473 | 88 |
| 592 | 3300044719 | Ga0466971_0441171 | Ga0466971_0441171_22_291 | 88 |
| 593 | 3300044842 | Ga0466957_1288271 | Ga0466957_1288271_144_497 | 88 |
| 594 | 3300044901 | Ga0466960_0235906 | Ga0466960_0235906_22_291 | 88 |
| 595 | 3300045049 | Ga0466959_0239149 | Ga0466959_0239149_339_608 | 88 |
| 596 | 3300045049 | Ga0466959_0269631 | Ga0466959_0269631_40_309 | 88 |
| 597 | 3300045049 | Ga0466959_0845714 | Ga0466959_0845714_136_405 | 88 |
| 598 | 3300045836 | Ga0466958_0374301 | Ga0466958_0374301_49_318 | 88 |
| 599 | 3300045976 | Ga0466967_0899445 | Ga0466967_0899445_73_342 | 88 |
| 600 | 3300045976 | Ga0466967_1061872 | Ga0466967_1061872_362_634 | 88 |
| 601 | 3300045976 | Ga0466967_1141195 | Ga0466967_1141195_366_632 | 88 |
| 602 | 3300046454 | Ga0495592_0002781 | Ga0495592_0002781_9351_9620 | 88 |
| 603 | 3300046462 | Ga0495651_0227545 | Ga0495651_0227545_220_489 | 88 |
| 604 | 3300046476 | Ga0495662_0000043 | Ga0495662_0000043_41289_41558 | 88 |
| 605 | 3300046513 | Ga0495616_0456542 | Ga0495616_0456542_110_382 | 88 |
| 606 | 3300046515 | Ga0495620_0238799 | Ga0495620_0238799_146_412 | 88 |
| 607 | 3300046516 | Ga0495628_0070126 | Ga0495628_0070126_349_618 | 88 |
| 608 | 3300046517 | Ga0495630_0142150 | Ga0495630_0142150_1138_1407 | 88 |
| 609 | 3300046518 | Ga0495631_0299858 | Ga0495631_0299858_163_429 | 88 |
| 610 | 3300046522 | Ga0495643_0175240 | Ga0495643_0175240_401_667 | 88 |
| 611 | 3300046535 | Ga0495586_0178459 | Ga0495586_0178459_85_354 | 88 |
| 612 | 3300046537 | Ga0495598_0361552 | Ga0495598_0361552_113_394 | 88 |
| 613 | 3300046537 | Ga0495598_0444267 | Ga0495598_0444267_58_324 | 88 |
| 614 | 3300046615 | Ga0495656_0404321 | Ga0495656_0404321_41_307 | 88 |
| 615 | 3300046616 | Ga0495668_0078847 | Ga0495668_0078847_1164_1433 | 88 |
| 616 | 3300046675 | Ga0495657_0004457 | Ga0495657_0004457_7565_7834 | 88 |
| 617 | 3300047315 | Ga0495581_0072208 | Ga0495581_0072208_83_352 | 88 |
| 618 | 3300047322 | Ga0495680_0000312 | Ga0495680_0000312_31785_32054 | 88 |
| 619 | 3300048090 | Ga0495615_0202096 | Ga0495615_0202096_98_370 | 88 |
| 620 | 3300048091 | Ga0495626_0395658 | Ga0495626_0395658_49_315 | 88 |
| 621 | 3300048903 | Ga0496100_0293352 | Ga0496100_0293352_522_791 | 88 |
| 622 | 3300048903 | Ga0496100_0363971 | Ga0496100_0363971_23_292 | 88 |
| 623 | 3300048904 | Ga0496101_0084092 | Ga0496101_0084092_402_677 | 88 |
| 624 | 3300048904 | Ga0496101_0472217 | Ga0496101_0472217_292_561 | 88 |
| 625 | 3300048904 | Ga0496101_0924330 | Ga0496101_0924330_390_665 | 88 |
| 626 | 3300048905 | Ga0496102_0014074 | Ga0496102_0014074_307_576 | 88 |
| 627 | 3300048905 | Ga0496102_0194499 | Ga0496102_0194499_639_914 | 88 |
| 628 | 3300048906 | Ga0496103_0570594 | Ga0496103_0570594_384_653 | 88 |
| 629 | 3300048907 | Ga0496104_0000213 | Ga0496104_0000213_30890_31156 | 88 |
| 630 | 3300048907 | Ga0496104_0013833 | Ga0496104_0013833_5999_6268 | 88 |
| 631 | 3300048907 | Ga0496104_0302639 | Ga0496104_0302639_780_1049 | 88 |
| 632 | 3300048907 | Ga0496104_0373008 | Ga0496104_0373008_878_1153 | 88 |
| 633 | 3300048908 | Ga0496105_0000059 | Ga0496105_0000059_84294_84560 | 88 |
| 634 | 3300048908 | Ga0496105_0052609 | Ga0496105_0052609_2311_2586 | 88 |
| 635 | 3300048908 | Ga0496105_0101009 | Ga0496105_0101009_1234_1503 | 88 |
| 636 | 3300048909 | Ga0496106_0001051 | Ga0496106_0001051_10717_10986 | 88 |
| 637 | 3300048909 | Ga0496106_0022916 | Ga0496106_0022916_1735_2004 | 88 |
| 638 | 3300048909 | Ga0496106_0631517 | Ga0496106_0631517_11_286 | 88 |
| 639 | 3300048909 | Ga0496106_0815803 | Ga0496106_0815803_112_387 | 88 |
| 640 | 3300048910 | Ga0496107_0014668 | Ga0496107_0014668_5109_5378 | 88 |
| 641 | 3300048910 | Ga0496107_0042725 | Ga0496107_0042725_1685_1954 | 88 |
| 642 | 3300048910 | Ga0496107_0538666 | Ga0496107_0538666_137_412 | 88 |
| 643 | 3300048910 | Ga0496107_1375522 | Ga0496107_1375522_74_340 | 88 |
| 644 | 3300048911 | Ga0496108_0000407 | Ga0496108_0000407_27429_27698 | 88 |
| 645 | 3300048911 | Ga0496108_0016583 | Ga0496108_0016583_3817_4086 | 88 |
| 646 | 3300048911 | Ga0496108_0020700 | Ga0496108_0020700_3465_3740 | 88 |
| 647 | 3300048912 | Ga0496109_0009025 | Ga0496109_0009025_3014_3283 | 88 |
| 648 | 3300048912 | Ga0496109_0036056 | Ga0496109_0036056_919_1194 | 88 |
| 649 | 3300048912 | Ga0496109_0046855 | Ga0496109_0046855_1439_1705 | 88 |
| 650 | 3300048912 | Ga0496109_1078144 | Ga0496109_1078144_457_723 | 88 |
| 651 | 3300048912 | Ga0496109_1202683 | Ga0496109_1202683_54_323 | 88 |
| 652 | 3300048913 | Ga0496110_0000936 | Ga0496110_0000936_2519_2788 | 88 |
| 653 | 3300048913 | Ga0496110_0094583 | Ga0496110_0094583_251_526 | 88 |
| 654 | 3300048913 | Ga0496110_0128658 | Ga0496110_0128658_993_1259 | 88 |
| 655 | 3300048914 | Ga0496111_0004786 | Ga0496111_0004786_6301_6570 | 88 |
| 656 | 3300048914 | Ga0496111_0313838 | Ga0496111_0313838_552_827 | 88 |
| 657 | 3300048914 | Ga0496111_0742604 | Ga0496111_0742604_187_453 | 88 |
| 658 | 3300048915 | Ga0496112_0016036 | Ga0496112_0016036_407_676 | 88 |
| 659 | 3300048915 | Ga0496112_0295083 | Ga0496112_0295083_884_1153 | 88 |
| 660 | 3300048915 | Ga0496112_1093709 | Ga0496112_1093709_294_569 | 88 |
| 661 | 3300048916 | Ga0496113_0104350 | Ga0496113_0104350_1600_1875 | 88 |
| 662 | 3300048916 | Ga0496113_0108943 | Ga0496113_0108943_1754_2023 | 88 |
| 663 | 3300048917 | Ga0496114_0106479 | Ga0496114_0106479_1516_1791 | 88 |
| 664 | 3300048917 | Ga0496114_0415799 | Ga0496114_0415799_413_679 | 88 |
| 665 | 3300048917 | Ga0496114_0719143 | Ga0496114_0719143_541_816 | 88 |
| 666 | 3300048917 | Ga0496114_0953703 | Ga0496114_0953703_422_691 | 88 |
| 667 | 3300048918 | Ga0496115_0181037 | Ga0496115_0181037_1012_1287 | 88 |
| 668 | 3300048919 | Ga0496116_0000257 | Ga0496116_0000257_49056_49328 | 88 |
| 669 | 3300048921 | Ga0496118_0063278 | Ga0496118_0063278_186_458 | 88 |
| 670 | 3300048922 | Ga0496119_0002850 | Ga0496119_0002850_4174_4446 | 88 |
| 671 | 3300049568 | Ga0501031_0070716 | Ga0501031_0070716_57_323 | 88 |
| 672 | 3300049568 | Ga0501031_0151144 | Ga0501031_0151144_498_764 | 88 |
| 673 | 3300049569 | Ga0501032_0871633 | Ga0501032_0871633_291_557 | 88 |
| 674 | 3300049570 | Ga0501033_0258586 | Ga0501033_0258586_263_529 | 88 |
| 675 | 3300049571 | Ga0501034_0574623 | Ga0501034_0574623_144_410 | 88 |
| 676 | 3300049572 | Ga0501036_0332474 | Ga0501036_0332474_552_818 | 88 |
| 677 | 3300049572 | Ga0501036_0799737 | Ga0501036_0799737_12_278 | 88 |
| 678 | 3300049575 | Ga0501039_0300789 | Ga0501039_0300789_921_1187 | 88 |
| 679 | 3300049576 | Ga0501040_0364783 | Ga0501040_0364783_443_709 | 88 |
| 680 | 3300049576 | Ga0501040_1010016 | Ga0501040_1010016_72_338 | 88 |
| 681 | 3300049577 | Ga0501041_0036888 | Ga0501041_0036888_857_1123 | 88 |
| 682 | 3300049577 | Ga0501041_0228155 | Ga0501041_0228155_762_1028 | 88 |
| 683 | 3300049579 | Ga0501043_0161822 | Ga0501043_0161822_14_280 | 88 |
| 684 | 3300049580 | Ga0501046_0234060 | Ga0501046_0234060_499_765 | 88 |
| 685 | 3300049587 | Ga0501071_0075022 | Ga0501071_0075022_178_444 | 88 |
| 686 | 3300049587 | Ga0501071_0102029 | Ga0501071_0102029_368_634 | 88 |
| 687 | 3300049588 | Ga0501072_0085266 | Ga0501072_0085266_1716_1982 | 88 |
| 688 | 3300049588 | Ga0501072_0359680 | Ga0501072_0359680_636_902 | 88 |
| 689 | 3300049590 | Ga0501074_0848081 | Ga0501074_0848081_344_610 | 88 |
| 690 | 3300049591 | Ga0501075_0320065 | Ga0501075_0320065_155_421 | 88 |
| 691 | 3300049591 | Ga0501075_0349920 | Ga0501075_0349920_315_581 | 88 |
| 692 | 3300049592 | Ga0501076_0046382 | Ga0501076_0046382_1915_2181 | 88 |
| 693 | 3300049593 | Ga0501077_0071913 | Ga0501077_0071913_1873_2139 | 88 |
| 694 | 3300049593 | Ga0501077_0985438 | Ga0501077_0985438_89_355 | 88 |
| 695 | 3300049655 | Ga0501208_167332 | Ga0501208_167332_170_436 | 88 |
| 696 | 3300049742 | Ga0501080_0894693 | Ga0501080_0894693_86_352 | 88 |
| 697 | 3300049743 | Ga0501081_0096258 | Ga0501081_0096258_1024_1290 | 88 |
| 698 | 3300049743 | Ga0501081_0639575 | Ga0501081_0639575_322_588 | 88 |
| 699 | 3300049744 | Ga0501083_0155000 | Ga0501083_0155000_546_812 | 88 |
| 700 | 3300049823 | Ga0501044_0758553 | Ga0501044_0758553_221_487 | 88 |
| 701 | 3300049823 | Ga0501044_1228111 | Ga0501044_1228111_289_567 | 88 |
| 702 | 3300050490 | nmdc:mga03n38_424662_c1 | nmdc:mga03n38_424662_c1_322_588 | 88 |
| 703 | 3300050492 | nmdc:mga0yw44_118022_c1 | nmdc:mga0yw44_118022_c1_733_999 | 88 |
| 704 | 3300050494 | nmdc:mga06z11_496383_c1 | nmdc:mga06z11_496383_c1_53_319 | 88 |
| 705 | 3300050507 | nmdc:mga05p37_388128_c1 | nmdc:mga05p37_388128_c1_1114_1380 | 88 |
| 706 | 3300050508 | nmdc:mga09592_1184421_c1 | nmdc:mga09592_1184421_c1_179_445 | 88 |
| 707 | 3300050508 | nmdc:mga09592_934768_c1 | nmdc:mga09592_934768_c1_431_700 | 88 |
| 708 | 3300050511 | nmdc:mga08y16_115058_c1 | nmdc:mga08y16_115058_c1_968_1243 | 88 |
| 709 | 3300050511 | nmdc:mga08y16_115445_c1 | nmdc:mga08y16_115445_c1_1802_2068 | 88 |
| 710 | 3300050511 | nmdc:mga08y16_157338_c1 | nmdc:mga08y16_157338_c1_1556_1822 | 88 |
| 711 | 3300050511 | nmdc:mga08y16_217935_c1 | nmdc:mga08y16_217935_c1_1010_1276 | 88 |
| 712 | 3300050512 | nmdc:mga0n895_1000967_c1 | nmdc:mga0n895_1000967_c1_513_782 | 88 |
| 713 | 3300050515 | nmdc:mga0a205_891176_c1 | nmdc:mga0a205_891176_c1_24_290 | 88 |
| 714 | 3300053077 | Ga0495601_0003646 | Ga0495601_0003646_2382_2648 | 88 |
| 715 | 3300053083 | Ga0495655_0000521 | Ga0495655_0000521_4899_5165 | 88 |
| 716 | 3300053119 | Ga0500595_014869 | Ga0500595_014869_229_507 | 88 |
| 717 | 3300054114 | Ga0501084_0060451 | Ga0501084_0060451_294_560 | 88 |
| 718 | 3300061734 | Ga0530510_0248891 | Ga0530510_0248891_319_585 | 88 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4a4a-assembly1.cif.gz_A | cpgh89 (e483q, e601q), from clostridium perfringens, in complex with its substrate glcnac-alpha-1,4-galactose | 0.9669 | 24 | 59 |
| 4b6x-assembly2.cif.gz_B | crystal structure of in planta processed avrrps4 | 0.9656 | 17 | 65 |
| 7mfk-assembly1.cif.gz_A | structure of the clostridium perfringens gh89 in complex with alpha-hnjnac | 0.9633 | 24 | 59 |
| 7qnl-assembly1.cif.gz_AAA | lov2-darpin fusion - d4_deltalov | 0.9598 | 17 | 65 |
| 3jza-assembly1.cif.gz_B | crystal structure of human rab1b in complex with the gef domain of drra/sidm from legionella pneumophila | 0.9592 | 23 | 60 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b6xB00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9656 | 17 | 65 | 1.20.58.90 |
| 5o74A00 | Mainly Alpha;Up-down Bundle;Ferritin; | 0.9537 | 23 | 60 | 1.20.1260.70 |
| af_A0A0R0JQH9_25_317_1.20.120.670 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase | 0.9459 | 21 | 59 | 1.20.120.670 |
| 2vc9A04 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase | 0.9451 | 21 | 59 | 1.20.120.670 |
| af_O96151_9_341_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.9426 | 44 | 83 | 2.60.40.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1Q509-F1-model_v4 | 30S ribosomal protein S20 | 0.9781 | 16 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0F2QW75-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9653 | 21 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A419FMU6-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.965 | 20 | 86 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A6L6B8C7-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9645 | 20 | 87 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
| AF-A0A1W1XM27-F1-model_v4 | Small ribosomal subunit protein bS20 (30S ribosomal protein S20) | 0.9552 | 20 | 87 |
GO:0003735
GO:0005829 GO:0006412 GO:0015935 GO:0070181 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar