F477169

General Info

Members Datasets Scaffolds Average Seq Length
718 293 718 88

Family's Representative Sequence

Representative Sequence 3300025898|Ga0207692_10699898|Ga0207692_106998981
Length 97
Sequence LSQGGYSRAARWRANIKSQKKRILRAERERLENRRYTSKIKTYFRRLERAVADGDGGAADTEHRELVQTIDKAVKRGALHRNAGARKKSRASRLRQG

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
194 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
195 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
204 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
221 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
235 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 10.72
Rhizosphere 82.87
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003721 3300000549 Bacteria 2027
2 JGI25407J50210_10012297 3300003373 Bacteria 2193
3 Ga0070658_10993827 3300005327 Bacteria 730
4 Ga0070683_100079293 3300005329 Bacteria 3073
5 Ga0070683_100234465 3300005329 Bacteria 1745
6 Ga0070683_100268237 3300005329 Bacteria 1624
7 Ga0070683_101102070 3300005329 Bacteria 763
8 Ga0070690_101156523 3300005330 Bacteria 616
9 Ga0070670_100399115 3300005331 Bacteria 1214
10 Ga0068869_100091774 3300005334 Bacteria 2285
11 Ga0068869_102157506 3300005334 Unclassified 501
12 Ga0070666_10211469 3300005335 Bacteria 1366
13 Ga0070666_10256104 3300005335 Bacteria 1240
14 Ga0070680_100238447 3300005336 Bacteria 1537
15 Ga0070680_101108248 3300005336 Bacteria 684
16 Ga0070680_101179354 3300005336 Bacteria 662
17 Ga0070682_100007138 3300005337 Bacteria 6292
18 Ga0070682_100047721 3300005337 Bacteria 2664
19 Ga0070682_100077275 3300005337 Bacteria 2144
20 Ga0070682_102035353 3300005337 Bacteria 506
21 Ga0068868_100010050 3300005338 Bacteria 6837
22 Ga0068868_100648830 3300005338 Bacteria 940
23 Ga0068868_100851474 3300005338 Bacteria 826
24 Ga0070660_100031927 3300005339 Bacteria 3960
25 Ga0070689_100246910 3300005340 Bacteria 1472
26 Ga0070689_101107390 3300005340 Unclassified 708
27 Ga0070691_10000036 3300005341 Bacteria 38327
28 Ga0070691_10011903 3300005341 Bacteria 3982
29 Ga0070691_10168754 3300005341 Bacteria 1133
30 Ga0070691_10321939 3300005341 Bacteria 851
31 Ga0070687_100451609 3300005343 Bacteria 855
32 Ga0070687_100991779 3300005343 Bacteria 608
33 Ga0070661_100000121 3300005344 Bacteria 65344
34 Ga0070661_100399284 3300005344 Bacteria 1087
35 Ga0070692_10045198 3300005345 Bacteria 2270
36 Ga0070668_100145669 3300005347 Bacteria 1912
37 Ga0070668_100658453 3300005347 Bacteria 921
38 Ga0070668_101112767 3300005347 Bacteria 713
39 Ga0070669_100169177 3300005353 Bacteria 1703
40 Ga0070669_100259329 3300005353 Bacteria 1387
41 Ga0070669_100653961 3300005353 Unclassified 884
42 Ga0070675_100099857 3300005354 Bacteria 2444
43 Ga0070675_101571817 3300005354 Bacteria 607
44 Ga0070675_101591945 3300005354 Bacteria 603
45 Ga0070671_100270008 3300005355 Bacteria 1446
46 Ga0070671_100519028 3300005355 Bacteria 1026
47 Ga0070671_100716991 3300005355 Bacteria 868
48 Ga0070671_100729946 3300005355 Unclassified 860
49 Ga0070671_101216978 3300005355 Bacteria 663
50 Ga0070674_100108308 3300005356 Bacteria 2036
51 Ga0070674_100452724 3300005356 Unclassified 1060
52 Ga0070674_100738979 3300005356 Bacteria 845
53 Ga0070673_100087760 3300005364 Bacteria 2536
54 Ga0070673_100315934 3300005364 Bacteria 1379
55 Ga0070688_100024878 3300005365 Bacteria 3539
56 Ga0070688_100074839 3300005365 Bacteria 2176
57 Ga0070659_100195893 3300005366 Bacteria 1662
58 Ga0070659_100268641 3300005366 Bacteria 1416
59 Ga0070659_100876186 3300005366 Bacteria 784
60 Ga0070714_100040485 3300005435 Bacteria 3928
61 Ga0070714_100295345 3300005435 Unclassified 1509
62 Ga0070714_100318676 3300005435 Bacteria 1453
63 Ga0070714_101252318 3300005435 Bacteria 724
64 Ga0070714_101686631 3300005435 Bacteria 619
65 Ga0070713_100135837 3300005436 Bacteria 2173
66 Ga0070713_100340851 3300005436 Bacteria 1389
67 Ga0070701_10883995 3300005438 Bacteria 616
68 Ga0070701_11040855 3300005438 Bacteria 573
69 Ga0070711_100001758 3300005439 Bacteria 12021
70 Ga0070711_100197261 3300005439 Bacteria 1551
71 Ga0070711_101403151 3300005439 Unclassified 608
72 Ga0070705_101128450 3300005440 Bacteria 643
73 Ga0070700_100047320 3300005441 Bacteria 2661
74 Ga0070700_100094863 3300005441 Bacteria 1954
75 Ga0070700_100127834 3300005441 Bacteria 1711
76 Ga0070700_101012078 3300005441 Bacteria 684
77 Ga0070694_100951667 3300005444 Bacteria 711
78 Ga0070663_100054355 3300005455 Bacteria 2862
79 Ga0070663_100262763 3300005455 Bacteria 1370
80 Ga0070663_100628260 3300005455 Bacteria 906
81 Ga0070678_100024888 3300005456 Bacteria 4016
82 Ga0070678_100157828 3300005456 Bacteria 1834
83 Ga0070678_101368757 3300005456 Bacteria 660
84 Ga0070662_100285357 3300005457 Bacteria 1337
85 Ga0070662_101661841 3300005457 Bacteria 551
86 Ga0068867_100123876 3300005459 Bacteria 2001
87 Ga0068867_100455530 3300005459 Bacteria 1091
88 Ga0070685_10063306 3300005466 Bacteria 2171
89 Ga0070685_11168132 3300005466 Bacteria 584
90 Ga0070679_100659778 3300005530 Bacteria 989
91 Ga0070679_100949116 3300005530 Bacteria 804
92 Ga0070679_101992604 3300005530 Unclassified 530
93 Ga0070684_100064281 3300005535 Bacteria 3218
94 Ga0070684_100071876 3300005535 Bacteria 3044
95 Ga0070684_100294417 3300005535 Bacteria 1489
96 Ga0070684_100465129 3300005535 Bacteria 1170
97 Ga0070684_101106408 3300005535 Bacteria 745
98 Ga0070684_101594684 3300005535 Bacteria 616
99 Ga0068853_100069447 3300005539 Bacteria 3065
100 Ga0068853_100150063 3300005539 Bacteria 2098
101 Ga0068853_102223912 3300005539 Bacteria 532
102 Ga0070686_100216560 3300005544 Bacteria 1382
103 Ga0070695_100237756 3300005545 Bacteria 1320
104 Ga0070695_100588833 3300005545 Bacteria 872
105 Ga0070696_100694554 3300005546 Bacteria 829
106 Ga0070696_100833335 3300005546 Bacteria 761
107 Ga0070696_101009077 3300005546 Bacteria 696
108 Ga0070693_100128480 3300005547 Bacteria 1581
109 Ga0070693_100471892 3300005547 Unclassified 885
110 Ga0070665_100137122 3300005548 Bacteria 2450
111 Ga0070665_100695140 3300005548 Bacteria 1030
112 Ga0070704_100471076 3300005549 Bacteria 1085
113 Ga0070704_101277544 3300005549 Bacteria 671
114 Ga0070664_100067895 3300005564 Bacteria 3048
115 Ga0070664_100347297 3300005564 Bacteria 1349
116 Ga0068857_100422012 3300005577 Bacteria 1244
117 Ga0068857_100943566 3300005577 Bacteria 829
118 Ga0068857_101159052 3300005577 Bacteria 748
119 Ga0068854_100072013 3300005578 Bacteria 2530
120 Ga0068854_100164987 3300005578 Bacteria 1719
121 Ga0068854_100259550 3300005578 Bacteria 1391
122 Ga0068854_100349091 3300005578 Bacteria 1210
123 Ga0068854_101746285 3300005578 Bacteria 570
124 Ga0068856_100154621 3300005614 Bacteria 2304
125 Ga0068856_100332574 3300005614 Bacteria 1537
126 Ga0068856_100766437 3300005614 Bacteria 985
127 Ga0068856_101029126 3300005614 Bacteria 842
128 Ga0068856_101274202 3300005614 Bacteria 751
129 Ga0070702_100007435 3300005615 Bacteria 5245
130 Ga0070702_100039462 3300005615 Bacteria 2635
131 Ga0070702_100209512 3300005615 Bacteria 1296
132 Ga0070702_100634301 3300005615 Bacteria 806
133 Ga0070702_100800954 3300005615 Bacteria 729
134 Ga0068852_100026617 3300005616 Bacteria 4705
135 Ga0068852_100582542 3300005616 Bacteria 1122
136 Ga0068852_100926321 3300005616 Bacteria 889
137 Ga0068859_100205668 3300005617 Bacteria 2054
138 Ga0068864_100013404 3300005618 Bacteria 6794
139 Ga0068864_100151603 3300005618 Bacteria 2100
140 Ga0068866_10347831 3300005718 Bacteria 941
141 Ga0068866_10419279 3300005718 Bacteria 868
142 Ga0068861_100052918 3300005719 Bacteria 3087
143 Ga0068861_100265344 3300005719 Bacteria 1472
144 Ga0068861_101600187 3300005719 Bacteria 642
145 Ga0068861_101953409 3300005719 Bacteria 584
146 Ga0068870_11328003 3300005840 Bacteria 525
147 Ga0068863_101290701 3300005841 Unclassified 737
148 Ga0068858_100810577 3300005842 Bacteria 913
149 Ga0068860_100527756 3300005843 Bacteria 1181
150 Ga0068862_100131450 3300005844 Bacteria 2214
151 Ga0068862_101935617 3300005844 Unclassified 600
152 Ga0081455_10006687 3300005937 Bacteria 12319
153 Ga0081455_10053856 3300005937 Bacteria 3434
154 Ga0081455_10220487 3300005937 Unclassified 1406
155 Ga0081455_10260881 3300005937 Bacteria 1262
156 Ga0081538_10000010 3300005981 Bacteria 164857
157 Ga0081538_10004233 3300005981 Bacteria 13311
158 Ga0081540_1058138 3300005983 Bacteria 1865
159 Ga0081539_10014299 3300005985 Bacteria 5884
160 Ga0070717_10021464 3300006028 Bacteria 5088
161 Ga0070717_10382118 3300006028 Bacteria 1263
162 Ga0070717_11094272 3300006028 Bacteria 726
163 Ga0075365_10142667 3300006038 Unclassified 1663
164 Ga0075363_100425443 3300006048 Bacteria 782
165 Ga0070716_100129954 3300006173 Bacteria 1591
166 Ga0070716_101092590 3300006173 Unclassified 636
167 Ga0070712_100076020 3300006175 Bacteria 2417
168 Ga0075367_10164043 3300006178 Bacteria 1382
169 Ga0075367_10592735 3300006178 Unclassified 704
170 Ga0075428_100102641 3300006844 Bacteria 3118
171 Ga0075428_100727192 3300006844 Unclassified 1057
172 Ga0075431_101074529 3300006847 Bacteria 770
173 Ga0075434_100850577 3300006871 Bacteria 928
174 Ga0075434_102368070 3300006871 Unclassified 533
175 Ga0075429_100549721 3300006880 Bacteria 1012
176 Ga0068865_100083165 3300006881 Bacteria 2303
177 Ga0068865_100318638 3300006881 Bacteria 1250
178 Ga0068865_100653734 3300006881 Bacteria 894
179 Ga0097620_100205671 3300006931 Bacteria 2054
180 Ga0075435_100871773 3300007076 Bacteria 785
181 Ga0075435_101289371 3300007076 Bacteria 640
182 Ga0105240_10843774 3300009093 Bacteria 989
183 Ga0111539_10089788 3300009094 Bacteria 3611
184 Ga0111539_10118853 3300009094 Bacteria 3097
185 Ga0111539_10136307 3300009094 Bacteria 2875
186 Ga0111539_10138008 3300009094 Bacteria 2856
187 Ga0111539_10235088 3300009094 Bacteria 2134
188 Ga0111539_10409133 3300009094 Bacteria 1580
189 Ga0111539_11247245 3300009094 Bacteria 863
190 Ga0111539_13526584 3300009094 Bacteria 502
191 Ga0105245_10108713 3300009098 Bacteria 2576
192 Ga0105245_10398686 3300009098 Bacteria 1374
193 Ga0105245_10422968 3300009098 Bacteria 1336
194 Ga0105245_10664010 3300009098 Bacteria 1073
195 Ga0105245_10919179 3300009098 Bacteria 917
196 Ga0105245_11775631 3300009098 Bacteria 669
197 Ga0105247_10026037 3300009101 Bacteria 3531
198 Ga0105247_10494181 3300009101 Bacteria 890
199 Ga0105247_11074637 3300009101 Bacteria 633
200 Ga0114129_10110299 3300009147 Bacteria 3798
201 Ga0105243_10019896 3300009148 Bacteria 5090
202 Ga0105243_10023843 3300009148 Bacteria 4663
203 Ga0105243_10054657 3300009148 Bacteria 3171
204 Ga0105243_10308697 3300009148 Bacteria 1436
205 Ga0105243_10378264 3300009148 Bacteria 1309
206 Ga0105243_10812840 3300009148 Bacteria 922
207 Ga0105243_10848690 3300009148 Bacteria 904
208 Ga0105242_10236711 3300009176 Bacteria 1639
209 Ga0105242_10694396 3300009176 Bacteria 995
210 Ga0105242_11887535 3300009176 Bacteria 638
211 Ga0105242_11900143 3300009176 Bacteria 636
212 Ga0105242_12855253 3300009176 Bacteria 533
213 Ga0105248_10299404 3300009177 Bacteria 1811
214 Ga0105248_11696473 3300009177 Bacteria 716
215 Ga0105248_12991718 3300009177 Bacteria 538
216 Ga0105237_10255961 3300009545 Bacteria 1753
217 Ga0105237_10534083 3300009545 Bacteria 1179
218 Ga0105238_10573913 3300009551 Bacteria 1134
219 Ga0105249_10066786 3300009553 Bacteria 3312
220 Ga0105249_10270563 3300009553 Bacteria 1692
221 Ga0105249_12057678 3300009553 Bacteria 644
222 Ga0105239_10044868 3300010375 Bacteria 4845
223 Ga0105239_10229283 3300010375 Bacteria 2084
224 Ga0105239_10245576 3300010375 Bacteria 2010
225 Ga0105239_10300271 3300010375 Bacteria 1808
226 Ga0105246_10356798 3300011119 Bacteria 1200
227 Ga0105246_11458175 3300011119 Bacteria 641
228 Ga0105246_12058640 3300011119 Bacteria 552
229 Ga0157369_10228435 3300013105 Bacteria 1946
230 Ga0157369_11178130 3300013105 Bacteria 782
231 Ga0157374_10042730 3300013296 Bacteria 4182
232 Ga0157374_10429397 3300013296 Bacteria 1321
233 Ga0157374_10687606 3300013296 Bacteria 1036
234 Ga0157374_11849776 3300013296 Bacteria 629
235 Ga0157378_10242718 3300013297 Bacteria 1721
236 Ga0163162_10245249 3300013306 Bacteria 1923
237 Ga0163162_11614008 3300013306 Bacteria 740
238 Ga0157372_10012848 3300013307 Bacteria 8924
239 Ga0157372_10176165 3300013307 Bacteria 2475
240 Ga0157372_10746142 3300013307 Bacteria 1138
241 Ga0157372_10977835 3300013307 Bacteria 981
242 Ga0157372_12025757 3300013307 Bacteria 662
243 Ga0157372_13082470 3300013307 Bacteria 532
244 Ga0157375_10041901 3300013308 Bacteria 4426
245 Ga0157375_10066165 3300013308 Bacteria 3606
246 Ga0157375_10572357 3300013308 Bacteria 1290
247 Ga0157375_10779208 3300013308 Bacteria 1106
248 Ga0157375_10941341 3300013308 Bacteria 1006
249 Ga0163163_10046029 3300014325 Bacteria 4284
250 Ga0163163_10182441 3300014325 Bacteria 2146
251 Ga0163163_10524071 3300014325 Bacteria 1247
252 Ga0157380_10209386 3300014326 Bacteria 1736
253 Ga0157380_10238081 3300014326 Bacteria 1639
254 Ga0157380_11028025 3300014326 Bacteria 859
255 Ga0157380_12939863 3300014326 Bacteria 542
256 Ga0157380_13543780 3300014326 Bacteria 500
257 Ga0157377_10134527 3300014745 Bacteria 1513
258 Ga0157377_10420860 3300014745 Bacteria 915
259 Ga0157377_10559778 3300014745 Bacteria 809
260 Ga0157379_10201032 3300014968 Bacteria 1802
261 Ga0157379_10545873 3300014968 Bacteria 1078
262 Ga0157376_10229611 3300014969 Bacteria 1723
263 Ga0206354_10694457 3300020081 Bacteria 1088
264 Ga0154015_1575334 3300020610 Unclassified 688
265 Ga0213873_10007528 3300021358 Bacteria 2186
266 Ga0213872_10287730 3300021361 Bacteria 685
267 Ga0213874_10033143 3300021377 Bacteria 1504
268 Ga0213874_10054906 3300021377 Bacteria 1233
269 Ga0213876_10003076 3300021384 Bacteria 9657
270 Ga0213876_10016056 3300021384 Bacteria 3960
271 Ga0213876_10020659 3300021384 Bacteria 3481
272 Ga0213876_10062355 3300021384 Bacteria 1968
273 Ga0213876_10543979 3300021384 Bacteria 618
274 Ga0213875_10000351 3300021388 Bacteria 43186
275 Ga0213875_10029581 3300021388 Bacteria 2597
276 Ga0213875_10044831 3300021388 Bacteria 2076
277 Ga0213875_10118675 3300021388 Unclassified 1236
278 Ga0207692_10699898 3300025898 Unclassified 658
279 Ga0207642_10068187 3300025899 Bacteria 1682
280 Ga0207642_10069521 3300025899 Bacteria 1670
281 Ga0207642_10270648 3300025899 Bacteria 973
282 Ga0207710_10372713 3300025900 Bacteria 730
283 Ga0207688_10011962 3300025901 Bacteria 4723
284 Ga0207688_10016243 3300025901 Bacteria 4036
285 Ga0207680_10267734 3300025903 Bacteria 1184
286 Ga0207680_10851897 3300025903 Bacteria 653
287 Ga0207647_10169641 3300025904 Bacteria 1271
288 Ga0207645_10561847 3300025907 Bacteria 774
289 Ga0207645_10631613 3300025907 Bacteria 727
290 Ga0207643_10054459 3300025908 Bacteria 2274
291 Ga0207643_10675600 3300025908 Bacteria 667
292 Ga0207684_11309512 3300025910 Bacteria 596
293 Ga0207671_10622282 3300025914 Bacteria 860
294 Ga0207671_11508595 3300025914 Bacteria 519
295 Ga0207693_10108283 3300025915 Bacteria 2180
296 Ga0207663_10001192 3300025916 Bacteria 12004
297 Ga0207663_10014473 3300025916 Bacteria 4320
298 Ga0207663_11559156 3300025916 Unclassified 532
299 Ga0207660_10545687 3300025917 Bacteria 943
300 Ga0207660_11181358 3300025917 Bacteria 623
301 Ga0207662_10007363 3300025918 Bacteria 5989
302 Ga0207657_10129056 3300025919 Bacteria 2074
303 Ga0207657_11140985 3300025919 Unclassified 594
304 Ga0207652_10766905 3300025921 Bacteria 858
305 Ga0207652_11841609 3300025921 Unclassified 510
306 Ga0207681_10154159 3300025923 Bacteria 1725
307 Ga0207681_10195611 3300025923 Bacteria 1550
308 Ga0207694_10606835 3300025924 Bacteria 920
309 Ga0207659_10141939 3300025926 Bacteria 1865
310 Ga0207659_10811102 3300025926 Bacteria 804
311 Ga0207687_10248118 3300025927 Bacteria 1414
312 Ga0207687_10876091 3300025927 Bacteria 768
313 Ga0207687_11302126 3300025927 Bacteria 625
314 Ga0207687_11341742 3300025927 Bacteria 615
315 Ga0207664_10416035 3300025929 Unclassified 1197
316 Ga0207664_12006259 3300025929 Bacteria 502
317 Ga0207644_10176874 3300025931 Bacteria 1670
318 Ga0207644_10605621 3300025931 Bacteria 910
319 Ga0207644_10653344 3300025931 Unclassified 875
320 Ga0207644_11082504 3300025931 Bacteria 673
321 Ga0207690_10033481 3300025932 Bacteria 3304
322 Ga0207690_10080597 3300025932 Bacteria 2272
323 Ga0207690_10295168 3300025932 Bacteria 1266
324 Ga0207706_10037623 3300025933 Bacteria 4296
325 Ga0207706_10508765 3300025933 Bacteria 1039
326 Ga0207706_11145076 3300025933 Bacteria 648
327 Ga0207686_10081376 3300025934 Bacteria 2114
328 Ga0207686_10500230 3300025934 Bacteria 943
329 Ga0207709_10236491 3300025935 Bacteria 1326
330 Ga0207709_10260175 3300025935 Bacteria 1272
331 Ga0207709_11364356 3300025935 Bacteria 587
332 Ga0207709_11549829 3300025935 Bacteria 550
333 Ga0207670_10442135 3300025936 Bacteria 1047
334 Ga0207669_10171797 3300025937 Bacteria 1544
335 Ga0207669_10382777 3300025937 Bacteria 1097
336 Ga0207704_10240663 3300025938 Bacteria 1352
337 Ga0207704_10611099 3300025938 Bacteria 894
338 Ga0207691_10150056 3300025940 Bacteria 2050
339 Ga0207711_10146540 3300025941 Bacteria 2128
340 Ga0207711_10809786 3300025941 Bacteria 872
341 Ga0207689_10185474 3300025942 Bacteria 1716
342 Ga0207689_11148336 3300025942 Bacteria 654
343 Ga0207661_10111673 3300025944 Bacteria 2313
344 Ga0207661_10443598 3300025944 Bacteria 1181
345 Ga0207661_10790253 3300025944 Bacteria 874
346 Ga0207661_11614958 3300025944 Bacteria 593
347 Ga0207661_11843451 3300025944 Bacteria 550
348 Ga0207679_10026630 3300025945 Bacteria 3989
349 Ga0207679_10497923 3300025945 Bacteria 1087
350 Ga0207679_10729739 3300025945 Bacteria 900
351 Ga0207651_10236092 3300025960 Bacteria 1488
352 Ga0207651_10618004 3300025960 Bacteria 949
353 Ga0207712_10249645 3300025961 Bacteria 1433
354 Ga0207712_11432158 3300025961 Bacteria 618
355 Ga0207668_10583935 3300025972 Bacteria 972
356 Ga0207640_10163885 3300025981 Bacteria 1648
357 Ga0207640_10453591 3300025981 Bacteria 1057
358 Ga0207640_10504307 3300025981 Bacteria 1008
359 Ga0207640_11369478 3300025981 Bacteria 633
360 Ga0207658_10508830 3300025986 Bacteria 1074
361 Ga0207658_10745226 3300025986 Bacteria 887
362 Ga0207677_10036819 3300026023 Bacteria 3193
363 Ga0207677_10200393 3300026023 Bacteria 1586
364 Ga0207703_10340132 3300026035 Bacteria 1379
365 Ga0207639_10073428 3300026041 Bacteria 2682
366 Ga0207678_10075798 3300026067 Bacteria 2881
367 Ga0207678_10145172 3300026067 Bacteria 2025
368 Ga0207678_10283955 3300026067 Bacteria 1421
369 Ga0207678_10387771 3300026067 Bacteria 1208
370 Ga0207708_10002745 3300026075 Bacteria 12930
371 Ga0207708_10051464 3300026075 Bacteria 3135
372 Ga0207708_10087035 3300026075 Bacteria 2405
373 Ga0207708_10102782 3300026075 Bacteria 2213
374 Ga0207708_10234988 3300026075 Bacteria 1473
375 Ga0207702_10060445 3300026078 Bacteria 3230
376 Ga0207702_10092548 3300026078 Bacteria 2650
377 Ga0207702_10135259 3300026078 Bacteria 2223
378 Ga0207702_10226691 3300026078 Bacteria 1744
379 Ga0207702_10445767 3300026078 Bacteria 1255
380 Ga0207702_11078001 3300026078 Bacteria 797
381 Ga0207641_10665825 3300026088 Bacteria 1023
382 Ga0207648_10157348 3300026089 Bacteria 2006
383 Ga0207648_10482810 3300026089 Bacteria 1132
384 Ga0207648_11823395 3300026089 Bacteria 570
385 Ga0207676_10087867 3300026095 Bacteria 2543
386 Ga0207676_12324781 3300026095 Unclassified 533
387 Ga0207674_10075148 3300026116 Bacteria 3389
388 Ga0207674_10093531 3300026116 Bacteria 2994
389 Ga0207674_10198366 3300026116 Bacteria 1956
390 Ga0207674_10657683 3300026116 Bacteria 1012
391 Ga0207675_100120105 3300026118 Bacteria 2486
392 Ga0207675_100241932 3300026118 Bacteria 1744
393 Ga0207675_100262083 3300026118 Bacteria 1675
394 Ga0207675_100273619 3300026118 Bacteria 1639
395 Ga0207675_100700872 3300026118 Bacteria 1021
396 Ga0207675_100814168 3300026118 Bacteria 948
397 Ga0207675_101954770 3300026118 Unclassified 604
398 Ga0207675_102741615 3300026118 Bacteria 501
399 Ga0207683_10097704 3300026121 Bacteria 2619
400 Ga0207683_10160787 3300026121 Bacteria 2030
401 Ga0207683_10819425 3300026121 Bacteria 864
402 Ga0207683_11703051 3300026121 Bacteria 580
403 Ga0207698_10287982 3300026142 Bacteria 1523
404 Ga0207698_10404552 3300026142 Bacteria 1305
405 Ga0207698_10691324 3300026142 Bacteria 1014
406 Ga0207698_11207210 3300026142 Bacteria 770
407 Ga0207698_11632326 3300026142 Bacteria 660
408 Ga0207428_10078696 3300027907 Bacteria 2579
409 Ga0207428_10108025 3300027907 Bacteria 2143
410 Ga0207428_10121916 3300027907 Bacteria 1999
411 Ga0207428_10164016 3300027907 Bacteria 1686
412 Ga0268266_10364087 3300028379 Bacteria 1361
413 Ga0268266_11888167 3300028379 Unclassified 571
414 Ga0268265_10923226 3300028380 Bacteria 858
415 Ga0307408_100395495 3300031548 Bacteria 1185
416 Ga0307408_100781814 3300031548 Bacteria 865
417 Ga0307408_101593908 3300031548 Bacteria 620
418 Ga0307405_11020078 3300031731 Bacteria 707
419 Ga0307413_10251431 3300031824 Bacteria 1311
420 Ga0307413_10641453 3300031824 Unclassified 875
421 Ga0307413_11714469 3300031824 Bacteria 560
422 Ga0307410_10075623 3300031852 Bacteria 2348
423 Ga0307410_10118200 3300031852 Bacteria 1929
424 Ga0307410_10330229 3300031852 Bacteria 1212
425 Ga0307410_10351504 3300031852 Bacteria 1178
426 Ga0307410_10981868 3300031852 Bacteria 727
427 Ga0307406_10155606 3300031901 Bacteria 1637
428 Ga0307406_10246390 3300031901 Bacteria 1343
429 Ga0307406_10361063 3300031901 Bacteria 1138
430 Ga0307406_10515088 3300031901 Bacteria 972
431 Ga0307406_10671684 3300031901 Bacteria 862
432 Ga0307406_11130422 3300031901 Bacteria 677
433 Ga0307407_10181597 3300031903 Bacteria 1395
434 Ga0307407_10305571 3300031903 Bacteria 1111
435 Ga0307407_10369759 3300031903 Bacteria 1020
436 Ga0307407_10555491 3300031903 Bacteria 849
437 Ga0307407_11100321 3300031903 Bacteria 618
438 Ga0307412_10316882 3300031911 Bacteria 1239
439 Ga0307409_100031646 3300031995 Bacteria 3822
440 Ga0307409_100077950 3300031995 Bacteria 2664
441 Ga0307409_100186251 3300031995 Bacteria 1843
442 Ga0307409_100392834 3300031995 Bacteria 1322
443 Ga0307409_100528124 3300031995 Bacteria 1154
444 Ga0307409_101144535 3300031995 Bacteria 800
445 Ga0307409_101511624 3300031995 Bacteria 699
446 Ga0307409_101915349 3300031995 Bacteria 622
447 Ga0307416_100199592 3300032002 Bacteria 1896
448 Ga0307416_100261872 3300032002 Bacteria 1691
449 Ga0307416_100569789 3300032002 Bacteria 1208
450 Ga0307416_102460723 3300032002 Bacteria 620
451 Ga0307414_10757133 3300032004 Bacteria 883
452 Ga0307414_11147212 3300032004 Bacteria 719
453 Ga0307411_10412570 3300032005 Bacteria 1119
454 Ga0307411_10581759 3300032005 Bacteria 960
455 Ga0307411_10951267 3300032005 Bacteria 766
456 Ga0307411_11395829 3300032005 Bacteria 641
457 Ga0307415_100155138 3300032126 Bacteria 1767
458 Ga0307415_100296308 3300032126 Bacteria 1338
459 Ga0307415_100319177 3300032126 Bacteria 1294
460 Ga0307415_100618262 3300032126 Bacteria 967
461 Ga0307415_100778849 3300032126 Bacteria 871
462 Ga0307415_101895232 3300032126 Bacteria 579
463 Ga0307415_102594727 3300032126 Unclassified 500
464 Ga0373929_0229435 3300035085 Unclassified 531
465 Ga0373932_0118756 3300035112 Bacteria 880
466 Ga0373960_0150023 3300035121 Bacteria 796
467 Ga0373960_0356485 3300035121 Bacteria 556
468 Ga0373962_0195440 3300035242 Bacteria 683
469 Ga0373931_0539495 3300035691 Bacteria 757
470 Ga0373935_1394676 3300035692 Bacteria 524
471 Ga0373937_1379376 3300036401 Bacteria 653
472 Ga0395899_0226452 3300037312 Bacteria 1293
473 Ga0395899_0396017 3300037312 Bacteria 915
474 Ga0395898_0069273 3300037466 Bacteria 3413
475 Ga0395905_0086086 3300037471 Bacteria 2945
476 Ga0395905_1540166 3300037471 Bacteria 569
477 Ga0436364_0344394 3300037853 Bacteria 19362
478 Ga0436364_0834563 3300037853 Bacteria 763
479 Ga0436364_0840900 3300037853 Bacteria 42362
480 Ga0436364_0986790 3300037853 Bacteria 1527
481 Ga0436364_1059222 3300037853 Bacteria 525
482 Ga0436364_1245384 3300037853 Unclassified 1693
483 Ga0436364_1426665 3300037853 Bacteria 33049
484 Ga0395901_0009876 3300038443 Bacteria 9673
485 Ga0395901_0261307 3300038443 Bacteria 1802
486 Ga0395901_2139192 3300038443 Bacteria 504
487 Ga0436365_0025272 3300039437 Bacteria 37971
488 Ga0436365_0062040 3300039437 Bacteria 25145
489 Ga0436365_0975923 3300039437 Bacteria 5533
490 Ga0436365_1207297 3300039437 Bacteria 676
491 Ga0436365_1685258 3300039437 Bacteria 2639
492 Ga0436365_1687595 3300039437 Bacteria 5516
493 Ga0436365_1743192 3300039437 Bacteria 618
494 Ga0436361_0425082 3300039447 Bacteria 1128
495 Ga0436363_0041489 3300039450 Bacteria 540
496 Ga0436363_0329309 3300039450 Bacteria 2260
497 Ga0436363_0352791 3300039450 Unclassified 908
498 Ga0436363_0543039 3300039450 Bacteria 810
499 Ga0436363_1045732 3300039450 Bacteria 679
500 Ga0436363_1227036 3300039450 Unclassified 2453
501 Ga0436363_1398997 3300039450 Bacteria 1163
502 Ga0436363_1578987 3300039450 Bacteria 8985
503 Ga0436362_0024438 3300039453 Bacteria 1443
504 Ga0436362_0271598 3300039453 Bacteria 576
505 Ga0436362_0342263 3300039453 Bacteria 663
506 Ga0436362_0346808 3300039453 Unclassified 588
507 Ga0436362_0562392 3300039453 Bacteria 1205
508 Ga0436362_0563165 3300039453 Bacteria 848
509 Ga0436362_0859181 3300039453 Bacteria 1815
510 Ga0436362_1088596 3300039453 Bacteria 2608
511 Ga0451793_0007379 3300041452 Bacteria 655
512 Ga0451835_0486417 3300041492 Bacteria 751
513 Ga0439463_095779 3300042016 Bacteria 765
514 Ga0466969_0195809 3300044656 Unclassified 923
515 Ga0466969_0398035 3300044656 Unclassified 625
516 Ga0466972_0099975 3300044658 Bacteria 1373
517 Ga0466965_0191470 3300044683 Unclassified 1082
518 Ga0466966_0014187 3300044684 Bacteria 5275
519 Ga0466961_0291646 3300044693 Bacteria 998
520 Ga0466961_0469489 3300044693 Bacteria 761
521 Ga0466961_0470518 3300044693 Bacteria 760
522 Ga0466961_0588653 3300044693 Bacteria 669
523 Ga0466963_0321432 3300044694 Unclassified 1089
524 Ga0466964_0165556 3300044706 Bacteria 1037
525 Ga0466971_0441171 3300044719 Bacteria 638
526 Ga0466968_0094150 3300044735 Bacteria 1331
527 Ga0466957_1288271 3300044842 Bacteria 530
528 Ga0466960_0235906 3300044901 Bacteria 1011
529 Ga0466960_0540832 3300044901 Bacteria 686
530 Ga0466959_0239149 3300045049 Bacteria 1255
531 Ga0466959_0269631 3300045049 Bacteria 1170
532 Ga0466959_0550424 3300045049 Bacteria 778
533 Ga0466959_0845714 3300045049 Bacteria 611
534 Ga0466958_0374301 3300045836 Bacteria 918
535 Ga0466958_0781596 3300045836 Bacteria 622
536 Ga0466967_0019891 3300045976 Bacteria 5412
537 Ga0466967_0129094 3300045976 Bacteria 2345
538 Ga0466967_0262366 3300045976 Bacteria 1653
539 Ga0466967_0569223 3300045976 Unclassified 1116
540 Ga0466967_0899445 3300045976 Viruses 880
541 Ga0466967_1061872 3300045976 Bacteria 807
542 Ga0466967_1141195 3300045976 Bacteria 776
543 Ga0466967_2046651 3300045976 Bacteria 569
544 Ga0466967_2348888 3300045976 Bacteria 529
545 Ga0495592_0002781 3300046454 Bacteria 12400
546 Ga0495651_0171278 3300046462 Bacteria 1546
547 Ga0495651_0227545 3300046462 Bacteria 1286
548 Ga0495653_0108873 3300046463 Bacteria 1995
549 Ga0495662_0000043 3300046476 Bacteria 42697
550 Ga0495596_0077922 3300046500 Bacteria 1287
551 Ga0495616_0456542 3300046513 Bacteria 517
552 Ga0495620_0238799 3300046515 Bacteria 694
553 Ga0495628_0070126 3300046516 Bacteria 2733
554 Ga0495628_0910425 3300046516 Bacteria 610
555 Ga0495630_0142150 3300046517 Bacteria 1825
556 Ga0495631_0299858 3300046518 Bacteria 684
557 Ga0495643_0175240 3300046522 Bacteria 1046
558 Ga0495644_0215377 3300046523 Bacteria 742
559 Ga0495586_0178459 3300046535 Bacteria 1201
560 Ga0495598_0361552 3300046537 Bacteria 561
561 Ga0495598_0444267 3300046537 Bacteria 513
562 Ga0495597_0138600 3300046542 Unclassified 1005
563 Ga0495656_0404321 3300046615 Bacteria 715
564 Ga0495668_0078847 3300046616 Bacteria 1808
565 Ga0495657_0004457 3300046675 Bacteria 11190
566 Ga0495671_0170901 3300046692 Unclassified 1057
567 Ga0495581_0072208 3300047315 Bacteria 1997
568 Ga0495674_0724573 3300047319 Bacteria 779
569 Ga0495674_1497480 3300047319 Bacteria 500
570 Ga0495680_0000312 3300047322 Bacteria 54495
571 Ga0495686_0338213 3300047472 Unclassified 821
572 Ga0495602_0387187 3300048088 Unclassified 1000
573 Ga0495615_0202096 3300048090 Bacteria 614
574 Ga0495626_0395658 3300048091 Bacteria 535
575 Ga0496100_0000263 3300048903 Bacteria 26697
576 Ga0496100_0010838 3300048903 Bacteria 5172
577 Ga0496100_0293352 3300048903 Bacteria 1215
578 Ga0496100_0363971 3300048903 Bacteria 1095
579 Ga0496100_1002266 3300048903 Unclassified 657
580 Ga0496101_0000448 3300048904 Bacteria 26182
581 Ga0496101_0001748 3300048904 Bacteria 13013
582 Ga0496101_0084092 3300048904 Bacteria 2356
583 Ga0496101_0147858 3300048904 Bacteria 1795
584 Ga0496101_0472217 3300048904 Bacteria 990
585 Ga0496101_0924330 3300048904 Bacteria 687
586 Ga0496102_0014074 3300048905 Bacteria 6950
587 Ga0496102_0141956 3300048905 Bacteria 2252
588 Ga0496102_0194499 3300048905 Bacteria 1911
589 Ga0496102_0823487 3300048905 Unclassified 850
590 Ga0496103_0134998 3300048906 Bacteria 1577
591 Ga0496103_0570594 3300048906 Bacteria 722
592 Ga0496104_0000213 3300048907 Bacteria 51219
593 Ga0496104_0013833 3300048907 Bacteria 7280
594 Ga0496104_0047043 3300048907 Bacteria 4065
595 Ga0496104_0302639 3300048907 Bacteria 1511
596 Ga0496104_0373008 3300048907 Bacteria 1339
597 Ga0496105_0000059 3300048908 Bacteria 86884
598 Ga0496105_0052609 3300048908 Bacteria 3364
599 Ga0496105_0101009 3300048908 Bacteria 2382
600 Ga0496105_0153433 3300048908 Bacteria 1892
601 Ga0496106_0001051 3300048909 Bacteria 20321
602 Ga0496106_0022916 3300048909 Bacteria 4638
603 Ga0496106_0035341 3300048909 Bacteria 3737
604 Ga0496106_0114966 3300048909 Bacteria 2098
605 Ga0496106_0631517 3300048909 Unclassified 857
606 Ga0496106_0815803 3300048909 Bacteria 740
607 Ga0496107_0014668 3300048910 Bacteria 5486
608 Ga0496107_0042725 3300048910 Bacteria 3256
609 Ga0496107_0538666 3300048910 Bacteria 865
610 Ga0496107_1067017 3300048910 Unclassified 584
611 Ga0496107_1375522 3300048910 Bacteria 503
612 Ga0496108_0000407 3300048911 Bacteria 35282
613 Ga0496108_0016583 3300048911 Bacteria 6014
614 Ga0496108_0020700 3300048911 Bacteria 5406
615 Ga0496108_0089832 3300048911 Bacteria 2611
616 Ga0496108_0095802 3300048911 Bacteria 2527
617 Ga0496109_0001222 3300048912 Bacteria 21334
618 Ga0496109_0009025 3300048912 Bacteria 8493
619 Ga0496109_0020559 3300048912 Bacteria 5830
620 Ga0496109_0036056 3300048912 Bacteria 4464
621 Ga0496109_0046855 3300048912 Bacteria 3928
622 Ga0496109_1078144 3300048912 Bacteria 740
623 Ga0496109_1202683 3300048912 Bacteria 694
624 Ga0496109_1955386 3300048912 Unclassified 519
625 Ga0496110_0000936 3300048913 Bacteria 20525
626 Ga0496110_0056261 3300048913 Bacteria 3461
627 Ga0496110_0094583 3300048913 Bacteria 2675
628 Ga0496110_0128658 3300048913 Bacteria 2286
629 Ga0496110_1079854 3300048913 Bacteria 711
630 Ga0496111_0002445 3300048914 Bacteria 11224
631 Ga0496111_0004786 3300048914 Bacteria 8590
632 Ga0496111_0137186 3300048914 Bacteria 1812
633 Ga0496111_0313838 3300048914 Bacteria 1161
634 Ga0496111_0742604 3300048914 Bacteria 712
635 Ga0496112_0016036 3300048915 Bacteria 7006
636 Ga0496112_0163971 3300048915 Bacteria 2188
637 Ga0496112_0295083 3300048915 Bacteria 1567
638 Ga0496112_1093709 3300048915 Bacteria 715
639 Ga0496112_1245764 3300048915 Bacteria 660
640 Ga0496113_0017167 3300048916 Bacteria 5018
641 Ga0496113_0104350 3300048916 Bacteria 2199
642 Ga0496113_0108943 3300048916 Bacteria 2153
643 Ga0496113_0193871 3300048916 Bacteria 1613
644 Ga0496114_0106479 3300048917 Bacteria 2399
645 Ga0496114_0260733 3300048917 Bacteria 1526
646 Ga0496114_0415799 3300048917 Bacteria 1191
647 Ga0496114_0462243 3300048917 Bacteria 1123
648 Ga0496114_0719143 3300048917 Bacteria 875
649 Ga0496114_0953703 3300048917 Bacteria 740
650 Ga0496115_0181037 3300048918 Bacteria 1742
651 Ga0496116_0000257 3300048919 Bacteria 93214
652 Ga0496118_0063278 3300048921 Bacteria 2723
653 Ga0496119_0002850 3300048922 Bacteria 18467
654 Ga0501031_0070716 3300049568 Bacteria 2273
655 Ga0501031_0151144 3300049568 Bacteria 1517
656 Ga0501032_0871633 3300049569 Bacteria 567
657 Ga0501033_0258586 3300049570 Bacteria 1233
658 Ga0501034_0574623 3300049571 Bacteria 1035
659 Ga0501036_0332474 3300049572 Bacteria 1269
660 Ga0501036_0799737 3300049572 Bacteria 776
661 Ga0501036_1168771 3300049572 Bacteria 628
662 Ga0501039_0300789 3300049575 Bacteria 1261
663 Ga0501040_0364783 3300049576 Bacteria 1035
664 Ga0501040_1010016 3300049576 Bacteria 603
665 Ga0501041_0036888 3300049577 Bacteria 2961
666 Ga0501041_0228155 3300049577 Bacteria 1169
667 Ga0501043_0161822 3300049579 Bacteria 1749
668 Ga0501046_0234060 3300049580 Bacteria 1356
669 Ga0501068_0972326 3300049584 Bacteria 560
670 Ga0501068_1136662 3300049584 Bacteria 517
671 Ga0501071_0075022 3300049587 Bacteria 2468
672 Ga0501071_0102029 3300049587 Bacteria 2115
673 Ga0501072_0085266 3300049588 Bacteria 2505
674 Ga0501072_0359680 3300049588 Bacteria 1155
675 Ga0501073_1069127 3300049589 Unclassified 555
676 Ga0501074_0848081 3300049590 Bacteria 643
677 Ga0501075_0320065 3300049591 Bacteria 1182
678 Ga0501075_0349920 3300049591 Bacteria 1126
679 Ga0501075_0565796 3300049591 Bacteria 867
680 Ga0501076_0046382 3300049592 Bacteria 3434
681 Ga0501077_0071913 3300049593 Bacteria 2192
682 Ga0501077_0985438 3300049593 Unclassified 542
683 Ga0501208_167332 3300049655 Bacteria 502
684 Ga0501079_0261116 3300049741 Bacteria 1354
685 Ga0501080_0894693 3300049742 Bacteria 774
686 Ga0501081_0060315 3300049743 Bacteria 2628
687 Ga0501081_0096258 3300049743 Unclassified 2088
688 Ga0501081_0639575 3300049743 Unclassified 797
689 Ga0501083_0155000 3300049744 Bacteria 1500
690 Ga0501044_0758553 3300049823 Bacteria 852
691 Ga0501044_1228111 3300049823 Bacteria 617
692 nmdc:mga03n38_111491_c1 3300050490 Bacteria 1333
693 nmdc:mga03n38_424662_c1 3300050490 Bacteria 735
694 nmdc:mga0yw44_118022_c1 3300050492 Unclassified 1706
695 nmdc:mga06z11_496383_c1 3300050494 Unclassified 739
696 nmdc:mga05p37_388128_c1 3300050507 Bacteria 1634
697 nmdc:mga09592_1184421_c1 3300050508 Bacteria 632
698 nmdc:mga09592_1349565_c1 3300050508 Bacteria 584
699 nmdc:mga09592_934768_c1 3300050508 Bacteria 727
700 nmdc:mga08y16_115058_c1 3300050511 Bacteria 2800
701 nmdc:mga08y16_115445_c1 3300050511 Bacteria 2795
702 nmdc:mga08y16_157338_c1 3300050511 Bacteria 2361
703 nmdc:mga08y16_158476_c1 3300050511 Bacteria 2352
704 nmdc:mga08y16_217935_c1 3300050511 Bacteria 1976
705 nmdc:mga08y16_269180_c1 3300050511 Bacteria 1759
706 nmdc:mga0n895_1000967_c1 3300050512 Unclassified 817
707 nmdc:mga0n895_488661_c1 3300050512 Bacteria 1241
708 nmdc:mga0a205_891176_c1 3300050515 Bacteria 736
709 Ga0495601_0003646 3300053077 Bacteria 8854
710 Ga0495601_0295440 3300053077 Bacteria 1056
711 Ga0495612_0604346 3300053078 Unclassified 507
712 Ga0495655_0000521 3300053083 Bacteria 6331
713 Ga0495655_0227688 3300053083 Bacteria 619
714 Ga0500595_014869 3300053119 Bacteria 2941
715 Ga0501084_0060451 3300054114 Bacteria 3172
716 Ga0466962_0645669 3300061719 Bacteria 541
717 Ga0530510_0248891 3300061734 Bacteria 1324
718 Ga0530510_1035927 3300061734 Bacteria 628

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_101107390 Ga0070689_1011073902 78
2 3300005355 Ga0070671_100729946 Ga0070671_1007299461 78
3 3300005356 Ga0070674_100452724 Ga0070674_1004527242 78
4 3300009148 Ga0105243_10812840 Ga0105243_108128402 78
5 3300025931 Ga0207644_10653344 Ga0207644_106533442 79
6 3300048903 Ga0496100_0010838 Ga0496100_0010838_3042_3311 79
7 3300048904 Ga0496101_0001748 Ga0496101_0001748_11680_11949 79
8 3300048905 Ga0496102_0823487 Ga0496102_0823487_497_766 79
9 3300048909 Ga0496106_0114966 Ga0496106_0114966_651_920 79
10 3300048917 Ga0496114_0462243 Ga0496114_0462243_807_1076 79
11 3300041492 Ga0451835_0486417 Ga0451835_0486417_183_440 84
12 3300005341 Ga0070691_10000036 Ga0070691_100000367 85
13 3300005435 Ga0070714_100295345 Ga0070714_1002953452 85
14 3300005436 Ga0070713_100340851 Ga0070713_1003408512 85
15 3300005545 Ga0070695_100237756 Ga0070695_1002377562 85
16 3300006028 Ga0070717_11094272 Ga0070717_110942722 85
17 3300006178 Ga0075367_10164043 Ga0075367_101640432 85
18 3300009098 Ga0105245_11775631 Ga0105245_117756311 85
19 3300020081 Ga0206354_10694457 Ga0206354_106944572 85
20 3300021377 Ga0213874_10033143 Ga0213874_100331432 85
21 3300021384 Ga0213876_10016056 Ga0213876_100160562 85
22 3300021384 Ga0213876_10020659 Ga0213876_100206594 85
23 3300021384 Ga0213876_10062355 Ga0213876_100623552 85
24 3300021388 Ga0213875_10029581 Ga0213875_100295813 85
25 3300025898 Ga0207692_10699898 Ga0207692_106998981 85
26 3300025929 Ga0207664_10416035 Ga0207664_104160352 85
27 3300031903 Ga0307407_10181597 Ga0307407_101815972 85
28 3300031995 Ga0307409_100528124 Ga0307409_1005281242 85
29 3300032126 Ga0307415_102594727 Ga0307415_1025947272 85
30 3300037853 Ga0436364_0840900 Ga0436364_0840900_19720_19977 85
31 3300037853 Ga0436364_0986790 Ga0436364_0986790_66_323 85
32 3300039437 Ga0436365_0025272 Ga0436365_0025272_16137_16394 85
33 3300039437 Ga0436365_0062040 Ga0436365_0062040_18781_19038 85
34 3300039437 Ga0436365_1685258 Ga0436365_1685258_233_490 85
35 3300039450 Ga0436363_1045732 Ga0436363_1045732_62_319 85
36 3300039450 Ga0436363_1227036 Ga0436363_1227036_1781_2038 85
37 3300039450 Ga0436363_1398997 Ga0436363_1398997_702_959 85
38 3300039450 Ga0436363_1578987 Ga0436363_1578987_3627_3884 85
39 3300039453 Ga0436362_0024438 Ga0436362_0024438_954_1301 85
40 3300039453 Ga0436362_0346808 Ga0436362_0346808_230_520 85
41 3300039453 Ga0436362_1088596 Ga0436362_1088596_612_869 85
42 3300044683 Ga0466965_0191470 Ga0466965_0191470_415_672 85
43 3300045976 Ga0466967_0019891 Ga0466967_0019891_2939_3196 85
44 3300045976 Ga0466967_0569223 Ga0466967_0569223_439_696 85
45 3300045976 Ga0466967_2348888 Ga0466967_2348888_46_303 85
46 3300048088 Ga0495602_0387187 Ga0495602_0387187_693_950 85
47 3300048911 Ga0496108_0089832 Ga0496108_0089832_876_1139 85
48 3300048912 Ga0496109_0001222 Ga0496109_0001222_17916_18179 85
49 3300048914 Ga0496111_0137186 Ga0496111_0137186_348_611 85
50 3300050490 nmdc:mga03n38_111491_c1 nmdc:mga03n38_111491_c1_733_1017 85
51 3300005329 Ga0070683_100234465 Ga0070683_1002344651 86
52 3300005334 Ga0068869_102157506 Ga0068869_1021575061 86
53 3300005335 Ga0070666_10211469 Ga0070666_102114692 86
54 3300005337 Ga0070682_100007138 Ga0070682_1000071387 86
55 3300005338 Ga0068868_100010050 Ga0068868_1000100502 86
56 3300005338 Ga0068868_100648830 Ga0068868_1006488302 86
57 3300005339 Ga0070660_100031927 Ga0070660_1000319272 86
58 3300005341 Ga0070691_10011903 Ga0070691_100119032 86
59 3300005341 Ga0070691_10321939 Ga0070691_103219392 86
60 3300005347 Ga0070668_100145669 Ga0070668_1001456692 86
61 3300005347 Ga0070668_101112767 Ga0070668_1011127671 86
62 3300005353 Ga0070669_100169177 Ga0070669_1001691772 86
63 3300005354 Ga0070675_100099857 Ga0070675_1000998571 86
64 3300005354 Ga0070675_101591945 Ga0070675_1015919452 86
65 3300005355 Ga0070671_100519028 Ga0070671_1005190282 86
66 3300005356 Ga0070674_100108308 Ga0070674_1001083082 86
67 3300005356 Ga0070674_100738979 Ga0070674_1007389791 86
68 3300005364 Ga0070673_100315934 Ga0070673_1003159342 86
69 3300005365 Ga0070688_100074839 Ga0070688_1000748393 86
70 3300005366 Ga0070659_100195893 Ga0070659_1001958931 86
71 3300005435 Ga0070714_100040485 Ga0070714_1000404852 86
72 3300005435 Ga0070714_101252318 Ga0070714_1012523181 86
73 3300005436 Ga0070713_100135837 Ga0070713_1001358372 86
74 3300005438 Ga0070701_11040855 Ga0070701_110408552 86
75 3300005439 Ga0070711_101403151 Ga0070711_1014031511 86
76 3300005441 Ga0070700_100047320 Ga0070700_1000473203 86
77 3300005455 Ga0070663_100054355 Ga0070663_1000543553 86
78 3300005456 Ga0070678_100024888 Ga0070678_1000248883 86
79 3300005457 Ga0070662_100285357 Ga0070662_1002853572 86
80 3300005530 Ga0070679_101992604 Ga0070679_1019926041 86
81 3300005535 Ga0070684_100465129 Ga0070684_1004651291 86
82 3300005535 Ga0070684_101594684 Ga0070684_1015946841 86
83 3300005539 Ga0068853_100069447 Ga0068853_1000694473 86
84 3300005546 Ga0070696_100694554 Ga0070696_1006945542 86
85 3300005547 Ga0070693_100471892 Ga0070693_1004718922 86
86 3300005548 Ga0070665_100137122 Ga0070665_1001371223 86
87 3300005548 Ga0070665_100695140 Ga0070665_1006951402 86
88 3300005564 Ga0070664_100347297 Ga0070664_1003472972 86
89 3300005577 Ga0068857_101159052 Ga0068857_1011590522 86
90 3300005578 Ga0068854_100072013 Ga0068854_1000720134 86
91 3300005615 Ga0070702_100039462 Ga0070702_1000394623 86
92 3300005615 Ga0070702_100800954 Ga0070702_1008009542 86
93 3300005616 Ga0068852_100026617 Ga0068852_1000266173 86
94 3300005616 Ga0068852_100926321 Ga0068852_1009263211 86
95 3300005618 Ga0068864_100013404 Ga0068864_1000134042 86
96 3300005718 Ga0068866_10419279 Ga0068866_104192792 86
97 3300005719 Ga0068861_100265344 Ga0068861_1002653443 86
98 3300005841 Ga0068863_101290701 Ga0068863_1012907012 86
99 3300005843 Ga0068860_100527756 Ga0068860_1005277563 86
100 3300006028 Ga0070717_10021464 Ga0070717_100214645 86
101 3300006028 Ga0070717_10382118 Ga0070717_103821182 86
102 3300006173 Ga0070716_101092590 Ga0070716_1010925902 86
103 3300006175 Ga0070712_100076020 Ga0070712_1000760202 86
104 3300006871 Ga0075434_100850577 Ga0075434_1008505771 86
105 3300006871 Ga0075434_102368070 Ga0075434_1023680702 86
106 3300006881 Ga0068865_100318638 Ga0068865_1003186382 86
107 3300007076 Ga0075435_100871773 Ga0075435_1008717732 86
108 3300009094 Ga0111539_10138008 Ga0111539_101380082 86
109 3300009094 Ga0111539_10235088 Ga0111539_102350883 86
110 3300009098 Ga0105245_10108713 Ga0105245_101087133 86
111 3300009098 Ga0105245_10664010 Ga0105245_106640102 86
112 3300009148 Ga0105243_10054657 Ga0105243_100546574 86
113 3300009177 Ga0105248_10299404 Ga0105248_102994042 86
114 3300009545 Ga0105237_10534083 Ga0105237_105340832 86
115 3300010375 Ga0105239_10300271 Ga0105239_103002712 86
116 3300011119 Ga0105246_10356798 Ga0105246_103567981 86
117 3300011119 Ga0105246_12058640 Ga0105246_120586401 86
118 3300013105 Ga0157369_11178130 Ga0157369_111781302 86
119 3300013296 Ga0157374_10042730 Ga0157374_100427303 86
120 3300013297 Ga0157378_10242718 Ga0157378_102427182 86
121 3300013307 Ga0157372_10012848 Ga0157372_100128485 86
122 3300013308 Ga0157375_10066165 Ga0157375_100661652 86
123 3300014325 Ga0163163_10046029 Ga0163163_100460293 86
124 3300014326 Ga0157380_10209386 Ga0157380_102093862 86
125 3300014326 Ga0157380_10238081 Ga0157380_102380812 86
126 3300014745 Ga0157377_10134527 Ga0157377_101345271 86
127 3300021361 Ga0213872_10287730 Ga0213872_102877302 86
128 3300021388 Ga0213875_10000351 Ga0213875_100003512 86
129 3300021388 Ga0213875_10118675 Ga0213875_101186752 86
130 3300025901 Ga0207688_10016243 Ga0207688_100162433 86
131 3300025903 Ga0207680_10267734 Ga0207680_102677342 86
132 3300025907 Ga0207645_10631613 Ga0207645_106316131 86
133 3300025914 Ga0207671_10622282 Ga0207671_106222822 86
134 3300025915 Ga0207693_10108283 Ga0207693_101082831 86
135 3300025916 Ga0207663_11559156 Ga0207663_115591562 86
136 3300025917 Ga0207660_10545687 Ga0207660_105456871 86
137 3300025919 Ga0207657_11140985 Ga0207657_111409852 86
138 3300025921 Ga0207652_11841609 Ga0207652_118416092 86
139 3300025923 Ga0207681_10154159 Ga0207681_101541592 86
140 3300025926 Ga0207659_10141939 Ga0207659_101419392 86
141 3300025926 Ga0207659_10811102 Ga0207659_108111022 86
142 3300025927 Ga0207687_10248118 Ga0207687_102481182 86
143 3300025927 Ga0207687_11302126 Ga0207687_113021262 86
144 3300025927 Ga0207687_11341742 Ga0207687_113417422 86
145 3300025929 Ga0207664_12006259 Ga0207664_120062592 86
146 3300025931 Ga0207644_11082504 Ga0207644_110825041 86
147 3300025932 Ga0207690_10295168 Ga0207690_102951681 86
148 3300025933 Ga0207706_10037623 Ga0207706_100376234 86
149 3300025935 Ga0207709_10260175 Ga0207709_102601751 86
150 3300025936 Ga0207670_10442135 Ga0207670_104421351 86
151 3300025937 Ga0207669_10171797 Ga0207669_101717971 86
152 3300025938 Ga0207704_10611099 Ga0207704_106110992 86
153 3300025941 Ga0207711_10146540 Ga0207711_101465402 86
154 3300025942 Ga0207689_10185474 Ga0207689_101854741 86
155 3300025942 Ga0207689_11148336 Ga0207689_111483362 86
156 3300025944 Ga0207661_10443598 Ga0207661_104435981 86
157 3300025945 Ga0207679_10497923 Ga0207679_104979232 86
158 3300025960 Ga0207651_10618004 Ga0207651_106180042 86
159 3300025981 Ga0207640_10453591 Ga0207640_104535912 86
160 3300026023 Ga0207677_10200393 Ga0207677_102003932 86
161 3300026041 Ga0207639_10073428 Ga0207639_100734282 86
162 3300026067 Ga0207678_10075798 Ga0207678_100757983 86
163 3300026075 Ga0207708_10002745 Ga0207708_1000274511 86
164 3300026078 Ga0207702_10092548 Ga0207702_100925481 86
165 3300026078 Ga0207702_10445767 Ga0207702_104457671 86
166 3300026088 Ga0207641_10665825 Ga0207641_106658252 86
167 3300026095 Ga0207676_12324781 Ga0207676_123247812 86
168 3300026116 Ga0207674_10198366 Ga0207674_101983661 86
169 3300026118 Ga0207675_100241932 Ga0207675_1002419322 86
170 3300026118 Ga0207675_100700872 Ga0207675_1007008722 86
171 3300026121 Ga0207683_10097704 Ga0207683_100977041 86
172 3300026121 Ga0207683_11703051 Ga0207683_117030511 86
173 3300026142 Ga0207698_11632326 Ga0207698_116323261 86
174 3300027907 Ga0207428_10108025 Ga0207428_101080252 86
175 3300027907 Ga0207428_10164016 Ga0207428_101640163 86
176 3300028379 Ga0268266_10364087 Ga0268266_103640872 86
177 3300031548 Ga0307408_101593908 Ga0307408_1015939082 86
178 3300031852 Ga0307410_10981868 Ga0307410_109818681 86
179 3300031901 Ga0307406_10361063 Ga0307406_103610632 86
180 3300032002 Ga0307416_100569789 Ga0307416_1005697891 86
181 3300032005 Ga0307411_10951267 Ga0307411_109512672 86
182 3300035692 Ga0373935_1394676 Ga0373935_1394676_20_280 86
183 3300036401 Ga0373937_1379376 Ga0373937_1379376_169_429 86
184 3300037853 Ga0436364_1245384 Ga0436364_1245384_1259_1519 86
185 3300037853 Ga0436364_1426665 Ga0436364_1426665_1358_1618 86
186 3300039447 Ga0436361_0425082 Ga0436361_0425082_340_600 86
187 3300039450 Ga0436363_0041489 Ga0436363_0041489_62_322 86
188 3300039453 Ga0436362_0563165 Ga0436362_0563165_516_776 86
189 3300044735 Ga0466968_0094150 Ga0466968_0094150_727_987 86
190 3300045976 Ga0466967_0262366 Ga0466967_0262366_770_1030 86
191 3300046500 Ga0495596_0077922 Ga0495596_0077922_886_1146 86
192 3300046523 Ga0495644_0215377 Ga0495644_0215377_151_411 86
193 3300046542 Ga0495597_0138600 Ga0495597_0138600_190_450 86
194 3300046692 Ga0495671_0170901 Ga0495671_0170901_757_1017 86
195 3300047319 Ga0495674_1497480 Ga0495674_1497480_198_458 86
196 3300048903 Ga0496100_0000263 Ga0496100_0000263_8297_8563 86
197 3300048903 Ga0496100_1002266 Ga0496100_1002266_185_445 86
198 3300048904 Ga0496101_0000448 Ga0496101_0000448_8853_9119 86
199 3300048904 Ga0496101_0147858 Ga0496101_0147858_596_856 86
200 3300048905 Ga0496102_0141956 Ga0496102_0141956_946_1206 86
201 3300048906 Ga0496103_0134998 Ga0496103_0134998_143_403 86
202 3300048907 Ga0496104_0047043 Ga0496104_0047043_3163_3423 86
203 3300048908 Ga0496105_0153433 Ga0496105_0153433_210_470 86
204 3300048909 Ga0496106_0035341 Ga0496106_0035341_1961_2221 86
205 3300048910 Ga0496107_1067017 Ga0496107_1067017_228_488 86
206 3300048911 Ga0496108_0095802 Ga0496108_0095802_166_426 86
207 3300048912 Ga0496109_0020559 Ga0496109_0020559_1970_2230 86
208 3300048912 Ga0496109_1955386 Ga0496109_1955386_35_295 86
209 3300048913 Ga0496110_0056261 Ga0496110_0056261_2514_2774 86
210 3300048913 Ga0496110_1079854 Ga0496110_1079854_334_594 86
211 3300048914 Ga0496111_0002445 Ga0496111_0002445_6045_6305 86
212 3300048915 Ga0496112_0163971 Ga0496112_0163971_1844_2104 86
213 3300048915 Ga0496112_1245764 Ga0496112_1245764_270_530 86
214 3300048916 Ga0496113_0017167 Ga0496113_0017167_3538_3798 86
215 3300048917 Ga0496114_0260733 Ga0496114_0260733_1145_1405 86
216 3300049572 Ga0501036_1168771 Ga0501036_1168771_252_512 86
217 3300049584 Ga0501068_0972326 Ga0501068_0972326_85_345 86
218 3300049584 Ga0501068_1136662 Ga0501068_1136662_171_431 86
219 3300049589 Ga0501073_1069127 Ga0501073_1069127_64_324 86
220 3300049591 Ga0501075_0565796 Ga0501075_0565796_256_516 86
221 3300049741 Ga0501079_0261116 Ga0501079_0261116_906_1166 86
222 3300050508 nmdc:mga09592_1349565_c1 nmdc:mga09592_1349565_c1_76_336 86
223 3300050511 nmdc:mga08y16_158476_c1 nmdc:mga08y16_158476_c1_1128_1388 86
224 3300050511 nmdc:mga08y16_269180_c1 nmdc:mga08y16_269180_c1_830_1090 86
225 3300050512 nmdc:mga0n895_488661_c1 nmdc:mga0n895_488661_c1_718_978 86
226 3300053083 Ga0495655_0227688 Ga0495655_0227688_53_313 86
227 3300061719 Ga0466962_0645669 Ga0466962_0645669_95_355 86
228 3300061734 Ga0530510_1035927 Ga0530510_1035927_269_529 86
229 3300003373 JGI25407J50210_10012297 JGI25407J50210_100122972 87
230 3300005719 Ga0068861_101600187 Ga0068861_1016001871 87
231 3300005937 Ga0081455_10053856 Ga0081455_100538562 87
232 3300005937 Ga0081455_10220487 Ga0081455_102204872 87
233 3300005981 Ga0081538_10000010 Ga0081538_10000010109 87
234 3300009094 Ga0111539_11247245 Ga0111539_112472452 87
235 3300009098 Ga0105245_10919179 Ga0105245_109191792 87
236 3300025908 Ga0207643_10675600 Ga0207643_106756001 87
237 3300025935 Ga0207709_11549829 Ga0207709_115498291 87
238 3300026118 Ga0207675_100273619 Ga0207675_1002736192 87
239 3300032002 Ga0307416_100261872 Ga0307416_1002618722 87
240 3300032126 Ga0307415_100778849 Ga0307415_1007788492 87
241 3300035085 Ga0373929_0229435 Ga0373929_0229435_121_384 87
242 3300044693 Ga0466961_0470518 Ga0466961_0470518_454_717 87
243 3300044694 Ga0466963_0321432 Ga0466963_0321432_565_828 87
244 3300044901 Ga0466960_0540832 Ga0466960_0540832_62_325 87
245 3300045049 Ga0466959_0550424 Ga0466959_0550424_168_431 87
246 3300045836 Ga0466958_0781596 Ga0466958_0781596_28_291 87
247 3300045976 Ga0466967_0129094 Ga0466967_0129094_930_1193 87
248 3300045976 Ga0466967_2046651 Ga0466967_2046651_263_526 87
249 3300046462 Ga0495651_0171278 Ga0495651_0171278_177_440 87
250 3300046463 Ga0495653_0108873 Ga0495653_0108873_26_289 87
251 3300046516 Ga0495628_0910425 Ga0495628_0910425_208_471 87
252 3300047319 Ga0495674_0724573 Ga0495674_0724573_153_416 87
253 3300047472 Ga0495686_0338213 Ga0495686_0338213_374_637 87
254 3300048916 Ga0496113_0193871 Ga0496113_0193871_948_1223 87
255 3300049743 Ga0501081_0060315 Ga0501081_0060315_606_869 87
256 3300053077 Ga0495601_0295440 Ga0495601_0295440_358_621 87
257 3300053078 Ga0495612_0604346 Ga0495612_0604346_152_415 87
258 3300000549 LJQas_1003721 LJQas_10037212 88
259 3300005327 Ga0070658_10993827 Ga0070658_109938271 88
260 3300005329 Ga0070683_100079293 Ga0070683_1000792933 88
261 3300005329 Ga0070683_100268237 Ga0070683_1002682372 88
262 3300005329 Ga0070683_101102070 Ga0070683_1011020702 88
263 3300005330 Ga0070690_101156523 Ga0070690_1011565232 88
264 3300005331 Ga0070670_100399115 Ga0070670_1003991152 88
265 3300005334 Ga0068869_100091774 Ga0068869_1000917742 88
266 3300005335 Ga0070666_10256104 Ga0070666_102561042 88
267 3300005336 Ga0070680_100238447 Ga0070680_1002384472 88
268 3300005336 Ga0070680_101108248 Ga0070680_1011082482 88
269 3300005336 Ga0070680_101179354 Ga0070680_1011793542 88
270 3300005337 Ga0070682_100047721 Ga0070682_1000477213 88
271 3300005337 Ga0070682_100077275 Ga0070682_1000772752 88
272 3300005337 Ga0070682_102035353 Ga0070682_1020353531 88
273 3300005338 Ga0068868_100851474 Ga0068868_1008514741 88
274 3300005340 Ga0070689_100246910 Ga0070689_1002469101 88
275 3300005341 Ga0070691_10168754 Ga0070691_101687542 88
276 3300005343 Ga0070687_100451609 Ga0070687_1004516091 88
277 3300005343 Ga0070687_100991779 Ga0070687_1009917791 88
278 3300005344 Ga0070661_100000121 Ga0070661_1000001217 88
279 3300005344 Ga0070661_100399284 Ga0070661_1003992842 88
280 3300005345 Ga0070692_10045198 Ga0070692_100451982 88
281 3300005347 Ga0070668_100658453 Ga0070668_1006584532 88
282 3300005353 Ga0070669_100259329 Ga0070669_1002593292 88
283 3300005353 Ga0070669_100653961 Ga0070669_1006539612 88
284 3300005354 Ga0070675_101571817 Ga0070675_1015718171 88
285 3300005355 Ga0070671_100270008 Ga0070671_1002700082 88
286 3300005355 Ga0070671_100716991 Ga0070671_1007169912 88
287 3300005355 Ga0070671_101216978 Ga0070671_1012169781 88
288 3300005364 Ga0070673_100087760 Ga0070673_1000877603 88
289 3300005365 Ga0070688_100024878 Ga0070688_1000248783 88
290 3300005366 Ga0070659_100268641 Ga0070659_1002686412 88
291 3300005366 Ga0070659_100876186 Ga0070659_1008761862 88
292 3300005435 Ga0070714_100318676 Ga0070714_1003186762 88
293 3300005435 Ga0070714_101686631 Ga0070714_1016866311 88
294 3300005438 Ga0070701_10883995 Ga0070701_108839951 88
295 3300005439 Ga0070711_100001758 Ga0070711_10000175811 88
296 3300005439 Ga0070711_100197261 Ga0070711_1001972611 88
297 3300005440 Ga0070705_101128450 Ga0070705_1011284501 88
298 3300005441 Ga0070700_100094863 Ga0070700_1000948632 88
299 3300005441 Ga0070700_100127834 Ga0070700_1001278342 88
300 3300005441 Ga0070700_101012078 Ga0070700_1010120782 88
301 3300005444 Ga0070694_100951667 Ga0070694_1009516671 88
302 3300005455 Ga0070663_100262763 Ga0070663_1002627632 88
303 3300005455 Ga0070663_100628260 Ga0070663_1006282602 88
304 3300005456 Ga0070678_100157828 Ga0070678_1001578283 88
305 3300005456 Ga0070678_101368757 Ga0070678_1013687572 88
306 3300005457 Ga0070662_101661841 Ga0070662_1016618411 88
307 3300005459 Ga0068867_100123876 Ga0068867_1001238762 88
308 3300005459 Ga0068867_100455530 Ga0068867_1004555302 88
309 3300005466 Ga0070685_10063306 Ga0070685_100633062 88
310 3300005466 Ga0070685_11168132 Ga0070685_111681321 88
311 3300005530 Ga0070679_100659778 Ga0070679_1006597781 88
312 3300005530 Ga0070679_100949116 Ga0070679_1009491161 88
313 3300005535 Ga0070684_100064281 Ga0070684_1000642811 88
314 3300005535 Ga0070684_100071876 Ga0070684_1000718762 88
315 3300005535 Ga0070684_100294417 Ga0070684_1002944172 88
316 3300005535 Ga0070684_101106408 Ga0070684_1011064081 88
317 3300005539 Ga0068853_100150063 Ga0068853_1001500632 88
318 3300005539 Ga0068853_102223912 Ga0068853_1022239122 88
319 3300005544 Ga0070686_100216560 Ga0070686_1002165601 88
320 3300005545 Ga0070695_100588833 Ga0070695_1005888331 88
321 3300005546 Ga0070696_100833335 Ga0070696_1008333352 88
322 3300005546 Ga0070696_101009077 Ga0070696_1010090772 88
323 3300005547 Ga0070693_100128480 Ga0070693_1001284802 88
324 3300005549 Ga0070704_100471076 Ga0070704_1004710762 88
325 3300005549 Ga0070704_101277544 Ga0070704_1012775442 88
326 3300005564 Ga0070664_100067895 Ga0070664_1000678951 88
327 3300005577 Ga0068857_100422012 Ga0068857_1004220122 88
328 3300005577 Ga0068857_100943566 Ga0068857_1009435661 88
329 3300005578 Ga0068854_100164987 Ga0068854_1001649872 88
330 3300005578 Ga0068854_100259550 Ga0068854_1002595502 88
331 3300005578 Ga0068854_100349091 Ga0068854_1003490912 88
332 3300005578 Ga0068854_101746285 Ga0068854_1017462851 88
333 3300005614 Ga0068856_100154621 Ga0068856_1001546212 88
334 3300005614 Ga0068856_100332574 Ga0068856_1003325742 88
335 3300005614 Ga0068856_100766437 Ga0068856_1007664372 88
336 3300005614 Ga0068856_101029126 Ga0068856_1010291262 88
337 3300005614 Ga0068856_101274202 Ga0068856_1012742021 88
338 3300005615 Ga0070702_100007435 Ga0070702_1000074352 88
339 3300005615 Ga0070702_100209512 Ga0070702_1002095121 88
340 3300005615 Ga0070702_100634301 Ga0070702_1006343012 88
341 3300005616 Ga0068852_100582542 Ga0068852_1005825422 88
342 3300005617 Ga0068859_100205668 Ga0068859_1002056682 88
343 3300005618 Ga0068864_100151603 Ga0068864_1001516032 88
344 3300005718 Ga0068866_10347831 Ga0068866_103478312 88
345 3300005719 Ga0068861_100052918 Ga0068861_1000529182 88
346 3300005719 Ga0068861_101953409 Ga0068861_1019534092 88
347 3300005840 Ga0068870_11328003 Ga0068870_113280032 88
348 3300005842 Ga0068858_100810577 Ga0068858_1008105772 88
349 3300005844 Ga0068862_100131450 Ga0068862_1001314502 88
350 3300005844 Ga0068862_101935617 Ga0068862_1019356172 88
351 3300005937 Ga0081455_10006687 Ga0081455_100066873 88
352 3300005937 Ga0081455_10260881 Ga0081455_102608812 88
353 3300005981 Ga0081538_10004233 Ga0081538_1000423310 88
354 3300005983 Ga0081540_1058138 Ga0081540_10581382 88
355 3300005985 Ga0081539_10014299 Ga0081539_100142994 88
356 3300006038 Ga0075365_10142667 Ga0075365_101426672 88
357 3300006048 Ga0075363_100425443 Ga0075363_1004254432 88
358 3300006173 Ga0070716_100129954 Ga0070716_1001299542 88
359 3300006178 Ga0075367_10592735 Ga0075367_105927352 88
360 3300006844 Ga0075428_100102641 Ga0075428_1001026413 88
361 3300006844 Ga0075428_100727192 Ga0075428_1007271922 88
362 3300006847 Ga0075431_101074529 Ga0075431_1010745292 88
363 3300006880 Ga0075429_100549721 Ga0075429_1005497212 88
364 3300006881 Ga0068865_100083165 Ga0068865_1000831652 88
365 3300006881 Ga0068865_100653734 Ga0068865_1006537342 88
366 3300006931 Ga0097620_100205671 Ga0097620_1002056712 88
367 3300007076 Ga0075435_101289371 Ga0075435_1012893712 88
368 3300009093 Ga0105240_10843774 Ga0105240_108437742 88
369 3300009094 Ga0111539_10089788 Ga0111539_100897882 88
370 3300009094 Ga0111539_10118853 Ga0111539_101188532 88
371 3300009094 Ga0111539_10136307 Ga0111539_101363072 88
372 3300009094 Ga0111539_10409133 Ga0111539_104091332 88
373 3300009094 Ga0111539_13526584 Ga0111539_135265841 88
374 3300009098 Ga0105245_10398686 Ga0105245_103986862 88
375 3300009098 Ga0105245_10422968 Ga0105245_104229682 88
376 3300009101 Ga0105247_10026037 Ga0105247_100260372 88
377 3300009101 Ga0105247_10494181 Ga0105247_104941811 88
378 3300009101 Ga0105247_11074637 Ga0105247_110746372 88
379 3300009147 Ga0114129_10110299 Ga0114129_101102992 88
380 3300009148 Ga0105243_10019896 Ga0105243_100198962 88
381 3300009148 Ga0105243_10023843 Ga0105243_100238435 88
382 3300009148 Ga0105243_10308697 Ga0105243_103086972 88
383 3300009148 Ga0105243_10378264 Ga0105243_103782642 88
384 3300009148 Ga0105243_10848690 Ga0105243_108486901 88
385 3300009176 Ga0105242_10236711 Ga0105242_102367112 88
386 3300009176 Ga0105242_10694396 Ga0105242_106943961 88
387 3300009176 Ga0105242_11887535 Ga0105242_118875351 88
388 3300009176 Ga0105242_11900143 Ga0105242_119001432 88
389 3300009176 Ga0105242_12855253 Ga0105242_128552531 88
390 3300009177 Ga0105248_11696473 Ga0105248_116964731 88
391 3300009177 Ga0105248_12991718 Ga0105248_129917181 88
392 3300009545 Ga0105237_10255961 Ga0105237_102559612 88
393 3300009551 Ga0105238_10573913 Ga0105238_105739132 88
394 3300009553 Ga0105249_10066786 Ga0105249_100667862 88
395 3300009553 Ga0105249_10270563 Ga0105249_102705632 88
396 3300009553 Ga0105249_12057678 Ga0105249_120576782 88
397 3300010375 Ga0105239_10044868 Ga0105239_100448684 88
398 3300010375 Ga0105239_10229283 Ga0105239_102292832 88
399 3300010375 Ga0105239_10245576 Ga0105239_102455762 88
400 3300011119 Ga0105246_11458175 Ga0105246_114581751 88
401 3300013105 Ga0157369_10228435 Ga0157369_102284353 88
402 3300013296 Ga0157374_10429397 Ga0157374_104293972 88
403 3300013296 Ga0157374_10687606 Ga0157374_106876062 88
404 3300013296 Ga0157374_11849776 Ga0157374_118497762 88
405 3300013306 Ga0163162_10245249 Ga0163162_102452492 88
406 3300013306 Ga0163162_11614008 Ga0163162_116140082 88
407 3300013307 Ga0157372_10176165 Ga0157372_101761652 88
408 3300013307 Ga0157372_10746142 Ga0157372_107461422 88
409 3300013307 Ga0157372_10977835 Ga0157372_109778352 88
410 3300013307 Ga0157372_12025757 Ga0157372_120257572 88
411 3300013307 Ga0157372_13082470 Ga0157372_130824701 88
412 3300013308 Ga0157375_10041901 Ga0157375_100419013 88
413 3300013308 Ga0157375_10572357 Ga0157375_105723572 88
414 3300013308 Ga0157375_10779208 Ga0157375_107792082 88
415 3300013308 Ga0157375_10941341 Ga0157375_109413411 88
416 3300014325 Ga0163163_10182441 Ga0163163_101824412 88
417 3300014325 Ga0163163_10524071 Ga0163163_105240711 88
418 3300014326 Ga0157380_11028025 Ga0157380_110280252 88
419 3300014326 Ga0157380_12939863 Ga0157380_129398631 88
420 3300014326 Ga0157380_13543780 Ga0157380_135437802 88
421 3300014745 Ga0157377_10420860 Ga0157377_104208602 88
422 3300014745 Ga0157377_10559778 Ga0157377_105597782 88
423 3300014968 Ga0157379_10201032 Ga0157379_102010321 88
424 3300014968 Ga0157379_10545873 Ga0157379_105458732 88
425 3300014969 Ga0157376_10229611 Ga0157376_102296112 88
426 3300020610 Ga0154015_1575334 Ga0154015_15753342 88
427 3300021358 Ga0213873_10007528 Ga0213873_100075283 88
428 3300021377 Ga0213874_10054906 Ga0213874_100549062 88
429 3300021384 Ga0213876_10003076 Ga0213876_100030767 88
430 3300021384 Ga0213876_10543979 Ga0213876_105439792 88
431 3300021388 Ga0213875_10044831 Ga0213875_100448312 88
432 3300025899 Ga0207642_10068187 Ga0207642_100681872 88
433 3300025899 Ga0207642_10069521 Ga0207642_100695212 88
434 3300025899 Ga0207642_10270648 Ga0207642_102706482 88
435 3300025900 Ga0207710_10372713 Ga0207710_103727132 88
436 3300025901 Ga0207688_10011962 Ga0207688_100119621 88
437 3300025903 Ga0207680_10851897 Ga0207680_108518972 88
438 3300025904 Ga0207647_10169641 Ga0207647_101696412 88
439 3300025907 Ga0207645_10561847 Ga0207645_105618471 88
440 3300025908 Ga0207643_10054459 Ga0207643_100544592 88
441 3300025910 Ga0207684_11309512 Ga0207684_113095122 88
442 3300025914 Ga0207671_11508595 Ga0207671_115085951 88
443 3300025916 Ga0207663_10001192 Ga0207663_1000119212 88
444 3300025916 Ga0207663_10014473 Ga0207663_100144732 88
445 3300025917 Ga0207660_11181358 Ga0207660_111813581 88
446 3300025918 Ga0207662_10007363 Ga0207662_100073633 88
447 3300025919 Ga0207657_10129056 Ga0207657_101290562 88
448 3300025921 Ga0207652_10766905 Ga0207652_107669052 88
449 3300025923 Ga0207681_10195611 Ga0207681_101956112 88
450 3300025924 Ga0207694_10606835 Ga0207694_106068352 88
451 3300025927 Ga0207687_10876091 Ga0207687_108760912 88
452 3300025931 Ga0207644_10176874 Ga0207644_101768742 88
453 3300025931 Ga0207644_10605621 Ga0207644_106056212 88
454 3300025932 Ga0207690_10033481 Ga0207690_100334812 88
455 3300025932 Ga0207690_10080597 Ga0207690_100805972 88
456 3300025933 Ga0207706_10508765 Ga0207706_105087652 88
457 3300025933 Ga0207706_11145076 Ga0207706_111450762 88
458 3300025934 Ga0207686_10081376 Ga0207686_100813762 88
459 3300025934 Ga0207686_10500230 Ga0207686_105002302 88
460 3300025935 Ga0207709_10236491 Ga0207709_102364912 88
461 3300025935 Ga0207709_11364356 Ga0207709_113643561 88
462 3300025937 Ga0207669_10382777 Ga0207669_103827772 88
463 3300025938 Ga0207704_10240663 Ga0207704_102406632 88
464 3300025940 Ga0207691_10150056 Ga0207691_101500561 88
465 3300025941 Ga0207711_10809786 Ga0207711_108097862 88
466 3300025944 Ga0207661_10111673 Ga0207661_101116732 88
467 3300025944 Ga0207661_10790253 Ga0207661_107902531 88
468 3300025944 Ga0207661_11614958 Ga0207661_116149581 88
469 3300025944 Ga0207661_11843451 Ga0207661_118434511 88
470 3300025945 Ga0207679_10026630 Ga0207679_100266303 88
471 3300025945 Ga0207679_10729739 Ga0207679_107297391 88
472 3300025960 Ga0207651_10236092 Ga0207651_102360922 88
473 3300025961 Ga0207712_10249645 Ga0207712_102496452 88
474 3300025961 Ga0207712_11432158 Ga0207712_114321581 88
475 3300025972 Ga0207668_10583935 Ga0207668_105839352 88
476 3300025981 Ga0207640_10163885 Ga0207640_101638852 88
477 3300025981 Ga0207640_10504307 Ga0207640_105043072 88
478 3300025981 Ga0207640_11369478 Ga0207640_113694781 88
479 3300025986 Ga0207658_10508830 Ga0207658_105088302 88
480 3300025986 Ga0207658_10745226 Ga0207658_107452262 88
481 3300026023 Ga0207677_10036819 Ga0207677_100368193 88
482 3300026035 Ga0207703_10340132 Ga0207703_103401321 88
483 3300026067 Ga0207678_10145172 Ga0207678_101451722 88
484 3300026067 Ga0207678_10283955 Ga0207678_102839552 88
485 3300026067 Ga0207678_10387771 Ga0207678_103877712 88
486 3300026075 Ga0207708_10051464 Ga0207708_100514642 88
487 3300026075 Ga0207708_10087035 Ga0207708_100870352 88
488 3300026075 Ga0207708_10102782 Ga0207708_101027823 88
489 3300026075 Ga0207708_10234988 Ga0207708_102349881 88
490 3300026078 Ga0207702_10060445 Ga0207702_100604453 88
491 3300026078 Ga0207702_10135259 Ga0207702_101352591 88
492 3300026078 Ga0207702_10226691 Ga0207702_102266912 88
493 3300026078 Ga0207702_11078001 Ga0207702_110780012 88
494 3300026089 Ga0207648_10157348 Ga0207648_101573482 88
495 3300026089 Ga0207648_10482810 Ga0207648_104828102 88
496 3300026089 Ga0207648_11823395 Ga0207648_118233952 88
497 3300026095 Ga0207676_10087867 Ga0207676_100878672 88
498 3300026116 Ga0207674_10075148 Ga0207674_100751482 88
499 3300026116 Ga0207674_10093531 Ga0207674_100935312 88
500 3300026116 Ga0207674_10657683 Ga0207674_106576832 88
501 3300026118 Ga0207675_100120105 Ga0207675_1001201053 88
502 3300026118 Ga0207675_100262083 Ga0207675_1002620832 88
503 3300026118 Ga0207675_100814168 Ga0207675_1008141682 88
504 3300026118 Ga0207675_101954770 Ga0207675_1019547702 88
505 3300026118 Ga0207675_102741615 Ga0207675_1027416151 88
506 3300026121 Ga0207683_10160787 Ga0207683_101607872 88
507 3300026121 Ga0207683_10819425 Ga0207683_108194252 88
508 3300026142 Ga0207698_10287982 Ga0207698_102879821 88
509 3300026142 Ga0207698_10404552 Ga0207698_104045522 88
510 3300026142 Ga0207698_10691324 Ga0207698_106913242 88
511 3300026142 Ga0207698_11207210 Ga0207698_112072102 88
512 3300027907 Ga0207428_10078696 Ga0207428_100786962 88
513 3300027907 Ga0207428_10121916 Ga0207428_101219163 88
514 3300028379 Ga0268266_11888167 Ga0268266_118881672 88
515 3300028380 Ga0268265_10923226 Ga0268265_109232262 88
516 3300031548 Ga0307408_100395495 Ga0307408_1003954952 88
517 3300031548 Ga0307408_100781814 Ga0307408_1007818142 88
518 3300031731 Ga0307405_11020078 Ga0307405_110200782 88
519 3300031824 Ga0307413_10251431 Ga0307413_102514312 88
520 3300031824 Ga0307413_10641453 Ga0307413_106414532 88
521 3300031824 Ga0307413_11714469 Ga0307413_117144691 88
522 3300031852 Ga0307410_10075623 Ga0307410_100756232 88
523 3300031852 Ga0307410_10118200 Ga0307410_101182002 88
524 3300031852 Ga0307410_10330229 Ga0307410_103302292 88
525 3300031852 Ga0307410_10351504 Ga0307410_103515042 88
526 3300031901 Ga0307406_10155606 Ga0307406_101556062 88
527 3300031901 Ga0307406_10246390 Ga0307406_102463902 88
528 3300031901 Ga0307406_10515088 Ga0307406_105150882 88
529 3300031901 Ga0307406_10671684 Ga0307406_106716842 88
530 3300031901 Ga0307406_11130422 Ga0307406_111304221 88
531 3300031903 Ga0307407_10305571 Ga0307407_103055711 88
532 3300031903 Ga0307407_10369759 Ga0307407_103697592 88
533 3300031903 Ga0307407_10555491 Ga0307407_105554912 88
534 3300031903 Ga0307407_11100321 Ga0307407_111003211 88
535 3300031911 Ga0307412_10316882 Ga0307412_103168822 88
536 3300031995 Ga0307409_100031646 Ga0307409_1000316463 88
537 3300031995 Ga0307409_100077950 Ga0307409_1000779502 88
538 3300031995 Ga0307409_100186251 Ga0307409_1001862513 88
539 3300031995 Ga0307409_100392834 Ga0307409_1003928342 88
540 3300031995 Ga0307409_101144535 Ga0307409_1011445351 88
541 3300031995 Ga0307409_101511624 Ga0307409_1015116242 88
542 3300031995 Ga0307409_101915349 Ga0307409_1019153492 88
543 3300032002 Ga0307416_100199592 Ga0307416_1001995922 88
544 3300032002 Ga0307416_102460723 Ga0307416_1024607231 88
545 3300032004 Ga0307414_10757133 Ga0307414_107571331 88
546 3300032004 Ga0307414_11147212 Ga0307414_111472122 88
547 3300032005 Ga0307411_10412570 Ga0307411_104125702 88
548 3300032005 Ga0307411_10581759 Ga0307411_105817592 88
549 3300032005 Ga0307411_11395829 Ga0307411_113958291 88
550 3300032126 Ga0307415_100155138 Ga0307415_1001551383 88
551 3300032126 Ga0307415_100296308 Ga0307415_1002963082 88
552 3300032126 Ga0307415_100319177 Ga0307415_1003191772 88
553 3300032126 Ga0307415_100618262 Ga0307415_1006182622 88
554 3300032126 Ga0307415_101895232 Ga0307415_1018952321 88
555 3300035112 Ga0373932_0118756 Ga0373932_0118756_366_635 88
556 3300035121 Ga0373960_0150023 Ga0373960_0150023_123_389 88
557 3300035121 Ga0373960_0356485 Ga0373960_0356485_45_314 88
558 3300035242 Ga0373962_0195440 Ga0373962_0195440_86_358 88
559 3300035691 Ga0373931_0539495 Ga0373931_0539495_371_646 88
560 3300037312 Ga0395899_0226452 Ga0395899_0226452_976_1242 88
561 3300037312 Ga0395899_0396017 Ga0395899_0396017_99_365 88
562 3300037466 Ga0395898_0069273 Ga0395898_0069273_367_633 88
563 3300037471 Ga0395905_0086086 Ga0395905_0086086_967_1233 88
564 3300037471 Ga0395905_1540166 Ga0395905_1540166_248_517 88
565 3300037853 Ga0436364_0344394 Ga0436364_0344394_16273_16542 88
566 3300037853 Ga0436364_0834563 Ga0436364_0834563_258_527 88
567 3300037853 Ga0436364_1059222 Ga0436364_1059222_69_338 88
568 3300038443 Ga0395901_0009876 Ga0395901_0009876_6505_6771 88
569 3300038443 Ga0395901_0261307 Ga0395901_0261307_1140_1406 88
570 3300038443 Ga0395901_2139192 Ga0395901_2139192_27_296 88
571 3300039437 Ga0436365_0975923 Ga0436365_0975923_3507_3776 88
572 3300039437 Ga0436365_1207297 Ga0436365_1207297_390_656 88
573 3300039437 Ga0436365_1687595 Ga0436365_1687595_4075_4341 88
574 3300039437 Ga0436365_1743192 Ga0436365_1743192_320_586 88
575 3300039450 Ga0436363_0329309 Ga0436363_0329309_1185_1451 88
576 3300039450 Ga0436363_0352791 Ga0436363_0352791_198_467 88
577 3300039450 Ga0436363_0543039 Ga0436363_0543039_322_591 88
578 3300039453 Ga0436362_0271598 Ga0436362_0271598_30_296 88
579 3300039453 Ga0436362_0342263 Ga0436362_0342263_276_545 88
580 3300039453 Ga0436362_0562392 Ga0436362_0562392_371_640 88
581 3300039453 Ga0436362_0859181 Ga0436362_0859181_846_1112 88
582 3300041452 Ga0451793_0007379 Ga0451793_0007379_75_341 88
583 3300042016 Ga0439463_095779 Ga0439463_095779_291_557 88
584 3300044656 Ga0466969_0195809 Ga0466969_0195809_349_618 88
585 3300044656 Ga0466969_0398035 Ga0466969_0398035_50_319 88
586 3300044658 Ga0466972_0099975 Ga0466972_0099975_201_470 88
587 3300044684 Ga0466966_0014187 Ga0466966_0014187_3638_3904 88
588 3300044693 Ga0466961_0291646 Ga0466961_0291646_160_426 88
589 3300044693 Ga0466961_0469489 Ga0466961_0469489_478_747 88
590 3300044693 Ga0466961_0588653 Ga0466961_0588653_165_434 88
591 3300044706 Ga0466964_0165556 Ga0466964_0165556_207_473 88
592 3300044719 Ga0466971_0441171 Ga0466971_0441171_22_291 88
593 3300044842 Ga0466957_1288271 Ga0466957_1288271_144_497 88
594 3300044901 Ga0466960_0235906 Ga0466960_0235906_22_291 88
595 3300045049 Ga0466959_0239149 Ga0466959_0239149_339_608 88
596 3300045049 Ga0466959_0269631 Ga0466959_0269631_40_309 88
597 3300045049 Ga0466959_0845714 Ga0466959_0845714_136_405 88
598 3300045836 Ga0466958_0374301 Ga0466958_0374301_49_318 88
599 3300045976 Ga0466967_0899445 Ga0466967_0899445_73_342 88
600 3300045976 Ga0466967_1061872 Ga0466967_1061872_362_634 88
601 3300045976 Ga0466967_1141195 Ga0466967_1141195_366_632 88
602 3300046454 Ga0495592_0002781 Ga0495592_0002781_9351_9620 88
603 3300046462 Ga0495651_0227545 Ga0495651_0227545_220_489 88
604 3300046476 Ga0495662_0000043 Ga0495662_0000043_41289_41558 88
605 3300046513 Ga0495616_0456542 Ga0495616_0456542_110_382 88
606 3300046515 Ga0495620_0238799 Ga0495620_0238799_146_412 88
607 3300046516 Ga0495628_0070126 Ga0495628_0070126_349_618 88
608 3300046517 Ga0495630_0142150 Ga0495630_0142150_1138_1407 88
609 3300046518 Ga0495631_0299858 Ga0495631_0299858_163_429 88
610 3300046522 Ga0495643_0175240 Ga0495643_0175240_401_667 88
611 3300046535 Ga0495586_0178459 Ga0495586_0178459_85_354 88
612 3300046537 Ga0495598_0361552 Ga0495598_0361552_113_394 88
613 3300046537 Ga0495598_0444267 Ga0495598_0444267_58_324 88
614 3300046615 Ga0495656_0404321 Ga0495656_0404321_41_307 88
615 3300046616 Ga0495668_0078847 Ga0495668_0078847_1164_1433 88
616 3300046675 Ga0495657_0004457 Ga0495657_0004457_7565_7834 88
617 3300047315 Ga0495581_0072208 Ga0495581_0072208_83_352 88
618 3300047322 Ga0495680_0000312 Ga0495680_0000312_31785_32054 88
619 3300048090 Ga0495615_0202096 Ga0495615_0202096_98_370 88
620 3300048091 Ga0495626_0395658 Ga0495626_0395658_49_315 88
621 3300048903 Ga0496100_0293352 Ga0496100_0293352_522_791 88
622 3300048903 Ga0496100_0363971 Ga0496100_0363971_23_292 88
623 3300048904 Ga0496101_0084092 Ga0496101_0084092_402_677 88
624 3300048904 Ga0496101_0472217 Ga0496101_0472217_292_561 88
625 3300048904 Ga0496101_0924330 Ga0496101_0924330_390_665 88
626 3300048905 Ga0496102_0014074 Ga0496102_0014074_307_576 88
627 3300048905 Ga0496102_0194499 Ga0496102_0194499_639_914 88
628 3300048906 Ga0496103_0570594 Ga0496103_0570594_384_653 88
629 3300048907 Ga0496104_0000213 Ga0496104_0000213_30890_31156 88
630 3300048907 Ga0496104_0013833 Ga0496104_0013833_5999_6268 88
631 3300048907 Ga0496104_0302639 Ga0496104_0302639_780_1049 88
632 3300048907 Ga0496104_0373008 Ga0496104_0373008_878_1153 88
633 3300048908 Ga0496105_0000059 Ga0496105_0000059_84294_84560 88
634 3300048908 Ga0496105_0052609 Ga0496105_0052609_2311_2586 88
635 3300048908 Ga0496105_0101009 Ga0496105_0101009_1234_1503 88
636 3300048909 Ga0496106_0001051 Ga0496106_0001051_10717_10986 88
637 3300048909 Ga0496106_0022916 Ga0496106_0022916_1735_2004 88
638 3300048909 Ga0496106_0631517 Ga0496106_0631517_11_286 88
639 3300048909 Ga0496106_0815803 Ga0496106_0815803_112_387 88
640 3300048910 Ga0496107_0014668 Ga0496107_0014668_5109_5378 88
641 3300048910 Ga0496107_0042725 Ga0496107_0042725_1685_1954 88
642 3300048910 Ga0496107_0538666 Ga0496107_0538666_137_412 88
643 3300048910 Ga0496107_1375522 Ga0496107_1375522_74_340 88
644 3300048911 Ga0496108_0000407 Ga0496108_0000407_27429_27698 88
645 3300048911 Ga0496108_0016583 Ga0496108_0016583_3817_4086 88
646 3300048911 Ga0496108_0020700 Ga0496108_0020700_3465_3740 88
647 3300048912 Ga0496109_0009025 Ga0496109_0009025_3014_3283 88
648 3300048912 Ga0496109_0036056 Ga0496109_0036056_919_1194 88
649 3300048912 Ga0496109_0046855 Ga0496109_0046855_1439_1705 88
650 3300048912 Ga0496109_1078144 Ga0496109_1078144_457_723 88
651 3300048912 Ga0496109_1202683 Ga0496109_1202683_54_323 88
652 3300048913 Ga0496110_0000936 Ga0496110_0000936_2519_2788 88
653 3300048913 Ga0496110_0094583 Ga0496110_0094583_251_526 88
654 3300048913 Ga0496110_0128658 Ga0496110_0128658_993_1259 88
655 3300048914 Ga0496111_0004786 Ga0496111_0004786_6301_6570 88
656 3300048914 Ga0496111_0313838 Ga0496111_0313838_552_827 88
657 3300048914 Ga0496111_0742604 Ga0496111_0742604_187_453 88
658 3300048915 Ga0496112_0016036 Ga0496112_0016036_407_676 88
659 3300048915 Ga0496112_0295083 Ga0496112_0295083_884_1153 88
660 3300048915 Ga0496112_1093709 Ga0496112_1093709_294_569 88
661 3300048916 Ga0496113_0104350 Ga0496113_0104350_1600_1875 88
662 3300048916 Ga0496113_0108943 Ga0496113_0108943_1754_2023 88
663 3300048917 Ga0496114_0106479 Ga0496114_0106479_1516_1791 88
664 3300048917 Ga0496114_0415799 Ga0496114_0415799_413_679 88
665 3300048917 Ga0496114_0719143 Ga0496114_0719143_541_816 88
666 3300048917 Ga0496114_0953703 Ga0496114_0953703_422_691 88
667 3300048918 Ga0496115_0181037 Ga0496115_0181037_1012_1287 88
668 3300048919 Ga0496116_0000257 Ga0496116_0000257_49056_49328 88
669 3300048921 Ga0496118_0063278 Ga0496118_0063278_186_458 88
670 3300048922 Ga0496119_0002850 Ga0496119_0002850_4174_4446 88
671 3300049568 Ga0501031_0070716 Ga0501031_0070716_57_323 88
672 3300049568 Ga0501031_0151144 Ga0501031_0151144_498_764 88
673 3300049569 Ga0501032_0871633 Ga0501032_0871633_291_557 88
674 3300049570 Ga0501033_0258586 Ga0501033_0258586_263_529 88
675 3300049571 Ga0501034_0574623 Ga0501034_0574623_144_410 88
676 3300049572 Ga0501036_0332474 Ga0501036_0332474_552_818 88
677 3300049572 Ga0501036_0799737 Ga0501036_0799737_12_278 88
678 3300049575 Ga0501039_0300789 Ga0501039_0300789_921_1187 88
679 3300049576 Ga0501040_0364783 Ga0501040_0364783_443_709 88
680 3300049576 Ga0501040_1010016 Ga0501040_1010016_72_338 88
681 3300049577 Ga0501041_0036888 Ga0501041_0036888_857_1123 88
682 3300049577 Ga0501041_0228155 Ga0501041_0228155_762_1028 88
683 3300049579 Ga0501043_0161822 Ga0501043_0161822_14_280 88
684 3300049580 Ga0501046_0234060 Ga0501046_0234060_499_765 88
685 3300049587 Ga0501071_0075022 Ga0501071_0075022_178_444 88
686 3300049587 Ga0501071_0102029 Ga0501071_0102029_368_634 88
687 3300049588 Ga0501072_0085266 Ga0501072_0085266_1716_1982 88
688 3300049588 Ga0501072_0359680 Ga0501072_0359680_636_902 88
689 3300049590 Ga0501074_0848081 Ga0501074_0848081_344_610 88
690 3300049591 Ga0501075_0320065 Ga0501075_0320065_155_421 88
691 3300049591 Ga0501075_0349920 Ga0501075_0349920_315_581 88
692 3300049592 Ga0501076_0046382 Ga0501076_0046382_1915_2181 88
693 3300049593 Ga0501077_0071913 Ga0501077_0071913_1873_2139 88
694 3300049593 Ga0501077_0985438 Ga0501077_0985438_89_355 88
695 3300049655 Ga0501208_167332 Ga0501208_167332_170_436 88
696 3300049742 Ga0501080_0894693 Ga0501080_0894693_86_352 88
697 3300049743 Ga0501081_0096258 Ga0501081_0096258_1024_1290 88
698 3300049743 Ga0501081_0639575 Ga0501081_0639575_322_588 88
699 3300049744 Ga0501083_0155000 Ga0501083_0155000_546_812 88
700 3300049823 Ga0501044_0758553 Ga0501044_0758553_221_487 88
701 3300049823 Ga0501044_1228111 Ga0501044_1228111_289_567 88
702 3300050490 nmdc:mga03n38_424662_c1 nmdc:mga03n38_424662_c1_322_588 88
703 3300050492 nmdc:mga0yw44_118022_c1 nmdc:mga0yw44_118022_c1_733_999 88
704 3300050494 nmdc:mga06z11_496383_c1 nmdc:mga06z11_496383_c1_53_319 88
705 3300050507 nmdc:mga05p37_388128_c1 nmdc:mga05p37_388128_c1_1114_1380 88
706 3300050508 nmdc:mga09592_1184421_c1 nmdc:mga09592_1184421_c1_179_445 88
707 3300050508 nmdc:mga09592_934768_c1 nmdc:mga09592_934768_c1_431_700 88
708 3300050511 nmdc:mga08y16_115058_c1 nmdc:mga08y16_115058_c1_968_1243 88
709 3300050511 nmdc:mga08y16_115445_c1 nmdc:mga08y16_115445_c1_1802_2068 88
710 3300050511 nmdc:mga08y16_157338_c1 nmdc:mga08y16_157338_c1_1556_1822 88
711 3300050511 nmdc:mga08y16_217935_c1 nmdc:mga08y16_217935_c1_1010_1276 88
712 3300050512 nmdc:mga0n895_1000967_c1 nmdc:mga0n895_1000967_c1_513_782 88
713 3300050515 nmdc:mga0a205_891176_c1 nmdc:mga0a205_891176_c1_24_290 88
714 3300053077 Ga0495601_0003646 Ga0495601_0003646_2382_2648 88
715 3300053083 Ga0495655_0000521 Ga0495655_0000521_4899_5165 88
716 3300053119 Ga0500595_014869 Ga0500595_014869_229_507 88
717 3300054114 Ga0501084_0060451 Ga0501084_0060451_294_560 88
718 3300061734 Ga0530510_0248891 Ga0530510_0248891_319_585 88

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

14

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a4a-assembly1.cif.gz_A cpgh89 (e483q, e601q), from clostridium perfringens, in complex with its substrate glcnac-alpha-1,4-galactose 0.9669 24 59
4b6x-assembly2.cif.gz_B crystal structure of in planta processed avrrps4 0.9656 17 65
7mfk-assembly1.cif.gz_A structure of the clostridium perfringens gh89 in complex with alpha-hnjnac 0.9633 24 59
7qnl-assembly1.cif.gz_AAA lov2-darpin fusion - d4_deltalov 0.9598 17 65
3jza-assembly1.cif.gz_B crystal structure of human rab1b in complex with the gef domain of drra/sidm from legionella pneumophila 0.9592 23 60
ID Description Score Start End Superfamily
4b6xB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9656 17 65 1.20.58.90
5o74A00 Mainly Alpha;Up-down Bundle;Ferritin; 0.9537 23 60 1.20.1260.70
af_A0A0R0JQH9_25_317_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9459 21 59 1.20.120.670
2vc9A04 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9451 21 59 1.20.120.670
af_O96151_9_341_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.9426 44 83 2.60.40.150
ID Description Score Start End GO Terms
AF-X1Q509-F1-model_v4 30S ribosomal protein S20 0.9781 16 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0F2QW75-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9653 21 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A419FMU6-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.965 20 86 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A6L6B8C7-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9645 20 87 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A1W1XM27-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9552 20 87 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181

Feature Viewer

pLDDT pTM Quality
94.32 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map